F477565

General Info

Members Datasets Scaffolds Average Seq Length
724 285 1448 258

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10078774|Ga0209974_100787742
Length 289
Sequence LKSSGCKINRIGGTRRFVKSAAGYYNSRVLSSPCYIISDAHLGVASPGIERQLVGFLRGLATRAGSLVINGDLFDFWFEWKSVIPRNSFRALAALADLRDSGLPILWIAGNHDCWGDEILRSDIGVEYHLGSWRGNLAGWNTRIEHGDGLREKEDRGYRMVRPIMRNRFAIKAFRALHPDWASSLAMGSSDASRNYRSRDEGRGLRAIAMKELDSDPTMELLIYGHSHVAALEQAPGGGVFANAGSWLDAPTYLRVTHETIELRSASGSAEGDCLNSIDRRSEKAATNS

Samples

Sample ID Description Type Environment
1 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
269 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.52
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209974_10078774 3300027876 Bacteria 1131
2 MBSR1b_contig_2222046 2162886012 Bacteria 2214
3 Ga0065715_10098441 3300005293 Bacteria 3547
4 Ga0065715_10137766 3300005293 Bacteria 1902
5 Ga0070658_10007335 3300005327 Bacteria 8903
6 Ga0070658_10008523 3300005327 Bacteria 8243
7 Ga0070658_10200848 3300005327 Bacteria 1682
8 Ga0070658_10235304 3300005327 Bacteria 1552
9 Ga0070658_10413044 3300005327 Unclassified 1160
10 Ga0070676_10000608 3300005328 Bacteria 17438
11 Ga0070676_10031606 3300005328 Bacteria 3027
12 Ga0070676_10032216 3300005328 Bacteria 3002
13 Ga0070676_10093448 3300005328 Bacteria 1847
14 Ga0070676_10103050 3300005328 Bacteria 1766
15 Ga0070676_10232374 3300005328 Unclassified 1223
16 Ga0070683_100002470 3300005329 Bacteria 14715
17 Ga0070683_100005121 3300005329 Bacteria 10901
18 Ga0070683_100011318 3300005329 Bacteria 7705
19 Ga0070683_100022264 3300005329 Bacteria 5662
20 Ga0070683_100049544 3300005329 Bacteria 3885
21 Ga0070683_100089202 3300005329 Bacteria 2894
22 Ga0070683_100093757 3300005329 Bacteria 2821
23 Ga0070683_100127393 3300005329 Bacteria 2407
24 Ga0070683_100127971 3300005329 Bacteria 2402
25 Ga0070683_100258850 3300005329 Bacteria 1655
26 Ga0070683_100383412 3300005329 Unclassified 1339
27 Ga0070690_100057005 3300005330 Bacteria 2507
28 Ga0070690_100128668 3300005330 Bacteria 1708
29 Ga0070670_100034172 3300005331 Bacteria 4376
30 Ga0070670_100155320 3300005331 Bacteria 1981
31 Ga0070666_10072566 3300005335 Bacteria 2343
32 Ga0070680_100000644 3300005336 Bacteria 24320
33 Ga0070680_100003468 3300005336 Bacteria 11775
34 Ga0070680_100040666 3300005336 Bacteria 3766
35 Ga0070680_100044586 3300005336 Bacteria 3604
36 Ga0070680_100081433 3300005336 Bacteria 2671
37 Ga0070680_100209161 3300005336 Bacteria 1646
38 Ga0070680_100280780 3300005336 Bacteria 1411
39 Ga0070682_100004179 3300005337 Bacteria 8010
40 Ga0070682_100007538 3300005337 Bacteria 6132
41 Ga0070682_100045192 3300005337 Bacteria 2729
42 Ga0068868_100004167 3300005338 Bacteria 10106
43 Ga0068868_100006488 3300005338 Bacteria 8282
44 Ga0068868_100018653 3300005338 Bacteria 5190
45 Ga0070660_100028651 3300005339 Bacteria 4168
46 Ga0070660_100044055 3300005339 Bacteria 3411
47 Ga0070660_100155587 3300005339 Bacteria 1840
48 Ga0070660_100253727 3300005339 Bacteria 1435
49 Ga0070660_100460021 3300005339 Unclassified 1056
50 Ga0070691_10003613 3300005341 Bacteria 6983
51 Ga0070691_10036025 3300005341 Unclassified 2331
52 Ga0070691_10107053 3300005341 Bacteria 1395
53 Ga0070687_100014508 3300005343 Bacteria 3539
54 Ga0070687_100035590 3300005343 Bacteria 2474
55 Ga0070687_100115345 3300005343 Bacteria 1527
56 Ga0070661_100000761 3300005344 Bacteria 23231
57 Ga0070661_100003802 3300005344 Bacteria 10401
58 Ga0070661_100005457 3300005344 Bacteria 8768
59 Ga0070661_100006089 3300005344 Bacteria 8301
60 Ga0070661_100189548 3300005344 Bacteria 1568
61 Ga0070661_100387216 3300005344 Bacteria 1103
62 Ga0070668_100003223 3300005347 Bacteria 12024
63 Ga0070668_100031055 3300005347 Bacteria 4064
64 Ga0070668_100086811 3300005347 Bacteria 2461
65 Ga0070668_100116602 3300005347 Bacteria 2130
66 Ga0070668_100271360 3300005347 Bacteria 1414
67 Ga0070668_100783394 3300005347 Unclassified 846
68 Ga0070669_100006603 3300005353 Bacteria 8349
69 Ga0070669_100014174 3300005353 Bacteria 5673
70 Ga0070669_100041929 3300005353 Bacteria 3330
71 Ga0070669_100182871 3300005353 Bacteria 1641
72 Ga0070675_100001278 3300005354 Bacteria 18388
73 Ga0070675_100002172 3300005354 Bacteria 14521
74 Ga0070671_100065318 3300005355 Bacteria 3031
75 Ga0070671_100137532 3300005355 Bacteria 2060
76 Ga0070674_100009271 3300005356 Bacteria 5890
77 Ga0070674_100057554 3300005356 Unclassified 2699
78 Ga0070674_100070416 3300005356 Bacteria 2471
79 Ga0070673_100043394 3300005364 Bacteria 3475
80 Ga0070673_100178854 3300005364 Unclassified 1815
81 Ga0070673_100409003 3300005364 Unclassified 1215
82 Ga0070688_100045724 3300005365 Bacteria 2707
83 Ga0070688_100185027 3300005365 Bacteria 1447
84 Ga0070688_100346993 3300005365 Bacteria 1086
85 Ga0070659_100038398 3300005366 Bacteria 3734
86 Ga0070659_100064476 3300005366 Bacteria 2899
87 Ga0070659_100113091 3300005366 Bacteria 2193
88 Ga0070659_100140221 3300005366 Bacteria 1968
89 Ga0070667_100014962 3300005367 Bacteria 6409
90 Ga0070667_100042982 3300005367 Bacteria 3791
91 Ga0070667_100047745 3300005367 Bacteria 3602
92 Ga0070667_100071641 3300005367 Bacteria 2952
93 Ga0070667_100072809 3300005367 Bacteria 2929
94 Ga0070703_10097768 3300005406 Bacteria 1030
95 Ga0070709_10004306 3300005434 Bacteria 7676
96 Ga0070709_10312948 3300005434 Unclassified 1150
97 Ga0070714_100001226 3300005435 Bacteria 18495
98 Ga0070714_100023692 3300005435 Bacteria 5047
99 Ga0070713_100043932 3300005436 Bacteria 3656
100 Ga0070711_100031915 3300005439 Bacteria 3499
101 Ga0070711_100137629 3300005439 Unclassified 1827
102 Ga0070711_100537193 3300005439 Unclassified 968
103 Ga0070705_100152137 3300005440 Bacteria 1536
104 Ga0070705_100299812 3300005440 Bacteria 1151
105 Ga0070700_100037072 3300005441 Bacteria 2962
106 Ga0070694_100083507 3300005444 Bacteria 2226
107 Ga0070694_100166674 3300005444 Bacteria 1620
108 Ga0070708_100000190 3300005445 Bacteria 44442
109 Ga0070708_100020067 3300005445 Bacteria 5629
110 Ga0070708_100182744 3300005445 Bacteria 1960
111 Ga0070662_100001376 3300005457 Bacteria 14957
112 Ga0070662_100198086 3300005457 Bacteria 1592
113 Ga0070662_100262866 3300005457 Bacteria 1391
114 Ga0070681_10000928 3300005458 Bacteria 24678
115 Ga0070681_10004415 3300005458 Bacteria 13400
116 Ga0070681_10006055 3300005458 Bacteria 11729
117 Ga0070681_10006963 3300005458 Bacteria 11001
118 Ga0070681_10007632 3300005458 Bacteria 10578
119 Ga0070681_10075580 3300005458 Unclassified 3328
120 Ga0070681_10226143 3300005458 Bacteria 1786
121 Ga0070681_10262673 3300005458 Bacteria 1638
122 Ga0068867_100022856 3300005459 Bacteria 4474
123 Ga0068867_100144673 3300005459 Bacteria 1862
124 Ga0068867_100268110 3300005459 Bacteria 1395
125 Ga0070685_10016878 3300005466 Bacteria 3896
126 Ga0070685_10267015 3300005466 Bacteria 1140
127 Ga0070706_100013029 3300005467 Bacteria 7695
128 Ga0070707_100006169 3300005468 Bacteria 11165
129 Ga0070698_100002088 3300005471 Bacteria 22182
130 Ga0070698_100070929 3300005471 Bacteria 3495
131 Ga0070698_100112664 3300005471 Bacteria 2685
132 Ga0070699_100013450 3300005518 Bacteria 7047
133 Ga0070699_100068146 3300005518 Bacteria 3090
134 Ga0070699_100151410 3300005518 Bacteria 2052
135 Ga0070679_100003697 3300005530 Bacteria 14017
136 Ga0070679_100028372 3300005530 Bacteria 5517
137 Ga0070679_100030359 3300005530 Bacteria 5337
138 Ga0070679_100175834 3300005530 Bacteria 2113
139 Ga0070679_100247057 3300005530 Unclassified 1741
140 Ga0070679_100274732 3300005530 Bacteria 1638
141 Ga0070679_100382530 3300005530 Bacteria 1354
142 Ga0070684_100001167 3300005535 Bacteria 18840
143 Ga0070684_100013355 3300005535 Bacteria 6618
144 Ga0070684_100045353 3300005535 Bacteria 3807
145 Ga0070684_100117164 3300005535 Bacteria 2393
146 Ga0070684_100139212 3300005535 Bacteria 2194
147 Ga0070684_100195633 3300005535 Bacteria 1841
148 Ga0070684_100379016 3300005535 Bacteria 1303
149 Ga0070684_100513702 3300005535 Bacteria 1110
150 Ga0070697_100150433 3300005536 Bacteria 1962
151 Ga0068853_100008655 3300005539 Bacteria 8182
152 Ga0068853_100013170 3300005539 Bacteria 6749
153 Ga0068853_100024196 3300005539 Bacteria 5090
154 Ga0068853_100382303 3300005539 Bacteria 1315
155 Ga0068853_100435154 3300005539 Bacteria 1232
156 Ga0070672_100002022 3300005543 Bacteria 12756
157 Ga0070672_100003297 3300005543 Bacteria 10451
158 Ga0070672_100007221 3300005543 Bacteria 7524
159 Ga0070672_100090357 3300005543 Bacteria 2469
160 Ga0070672_100102598 3300005543 Bacteria 2322
161 Ga0070672_100167010 3300005543 Bacteria 1828
162 Ga0070672_100540619 3300005543 Bacteria 1011
163 Ga0070686_100199390 3300005544 Bacteria 1434
164 Ga0070696_100002920 3300005546 Bacteria 11361
165 Ga0070696_100047408 3300005546 Bacteria 2981
166 Ga0070693_100004867 3300005547 Bacteria 6409
167 Ga0070693_100026889 3300005547 Bacteria 3110
168 Ga0070693_100108602 3300005547 Bacteria 1703
169 Ga0070665_100307066 3300005548 Bacteria 1590
170 Ga0070704_100151997 3300005549 Bacteria 1821
171 Ga0070704_100186569 3300005549 Bacteria 1663
172 Ga0068855_100004766 3300005563 Bacteria 16560
173 Ga0068855_100006027 3300005563 Bacteria 14787
174 Ga0068855_100068506 3300005563 Bacteria 4131
175 Ga0070664_100018634 3300005564 Archaea 5706
176 Ga0070664_100030407 3300005564 Bacteria 4506
177 Ga0070664_100030622 3300005564 Bacteria 4490
178 Ga0070664_100051387 3300005564 Bacteria 3490
179 Ga0070664_100059812 3300005564 Bacteria 3243
180 Ga0070664_100082996 3300005564 Bacteria 2764
181 Ga0070664_100140912 3300005564 Bacteria 2123
182 Ga0070664_100186172 3300005564 Bacteria 1848
183 Ga0070664_100240562 3300005564 Bacteria 1625
184 Ga0070664_100284877 3300005564 Bacteria 1490
185 Ga0070664_100292295 3300005564 Bacteria 1471
186 Ga0070664_100528248 3300005564 Bacteria 1090
187 Ga0068857_100016634 3300005577 Bacteria 6443
188 Ga0068857_100019480 3300005577 Bacteria 5960
189 Ga0068857_100039395 3300005577 Bacteria 4185
190 Ga0068857_100117434 3300005577 Bacteria 2394
191 Ga0068854_100048636 3300005578 Bacteria 3026
192 Ga0068854_100204841 3300005578 Bacteria 1553
193 Ga0068856_100109648 3300005614 Bacteria 2757
194 Ga0070702_100046835 3300005615 Bacteria 2453
195 Ga0068852_100002352 3300005616 Bacteria 13021
196 Ga0068852_100010557 3300005616 Bacteria 6909
197 Ga0068852_100153289 3300005616 Bacteria 2145
198 Ga0068859_100126537 3300005617 Bacteria 2624
199 Ga0068859_100319975 3300005617 Bacteria 1645
200 Ga0068859_100714827 3300005617 Bacteria 1092
201 Ga0068864_100140137 3300005618 Bacteria 2181
202 Ga0068864_100281032 3300005618 Bacteria 1553
203 Ga0068866_10039494 3300005718 Unclassified 2331
204 Ga0068866_10041824 3300005718 Bacteria 2276
205 Ga0068861_100001161 3300005719 Bacteria 16407
206 Ga0068861_100247609 3300005719 Bacteria 1519
207 Ga0068861_100256475 3300005719 Bacteria 1495
208 Ga0068870_10001351 3300005840 Bacteria 9904
209 Ga0068863_100035844 3300005841 Bacteria 4724
210 Ga0068863_100474435 3300005841 Bacteria 1230
211 Ga0068858_100067568 3300005842 Bacteria 3311
212 Ga0068858_100092971 3300005842 Bacteria 2807
213 Ga0068860_100003640 3300005843 Bacteria 15856
214 Ga0068860_100597318 3300005843 Unclassified 1109
215 Ga0068862_100000608 3300005844 Bacteria 37205
216 Ga0068862_100004345 3300005844 Bacteria 11998
217 Ga0068862_100215105 3300005844 Bacteria 1738
218 Ga0068862_100260112 3300005844 Unclassified 1584
219 Ga0081455_10168667 3300005937 Unclassified 1670
220 Ga0070716_100003603 3300006173 Bacteria 7320
221 Ga0070712_100121858 3300006175 Unclassified 1963
222 Ga0075428_100008077 3300006844 Bacteria 11686
223 Ga0075428_100205402 3300006844 Bacteria 2129
224 Ga0075430_100004875 3300006846 Bacteria 11293
225 Ga0075430_100054680 3300006846 Bacteria 3358
226 Ga0075430_100102250 3300006846 Bacteria 2392
227 Ga0075430_100199632 3300006846 Bacteria 1661
228 Ga0075431_100021710 3300006847 Bacteria 6564
229 Ga0075431_100047339 3300006847 Bacteria 4433
230 Ga0075431_100082659 3300006847 Bacteria 3315
231 Ga0075431_100226721 3300006847 Bacteria 1905
232 Ga0075431_100384747 3300006847 Bacteria 1406
233 Ga0075433_10031738 3300006852 Bacteria 4518
234 Ga0075433_10064605 3300006852 Bacteria 3208
235 Ga0075433_10143515 3300006852 Unclassified 2122
236 Ga0075434_100031077 3300006871 Bacteria 5263
237 Ga0075434_100052731 3300006871 Unclassified 4042
238 Ga0075434_100089151 3300006871 Bacteria 3086
239 Ga0075429_100094794 3300006880 Bacteria 2603
240 Ga0075429_100109237 3300006880 Bacteria 2417
241 Ga0068865_100008019 3300006881 Bacteria 6520
242 Ga0068865_100008154 3300006881 Bacteria 6465
243 Ga0075436_100005006 3300006914 Bacteria 9104
244 Ga0075436_100045049 3300006914 Bacteria 3043
245 Ga0097620_100126550 3300006931 Bacteria 2624
246 Ga0097620_100319946 3300006931 Bacteria 1645
247 Ga0097620_100714948 3300006931 Bacteria 1092
248 Ga0099795_10024207 3300007788 Bacteria 2022
249 Ga0105240_10090925 3300009093 Bacteria 3730
250 Ga0105240_10102815 3300009093 Bacteria 3472
251 Ga0105240_10146451 3300009093 Bacteria 2817
252 Ga0105240_10244213 3300009093 Bacteria 2080
253 Ga0111539_10030654 3300009094 Bacteria 6538
254 Ga0111539_10499172 3300009094 Bacteria 1417
255 Ga0105245_10031008 3300009098 Bacteria 4729
256 Ga0105245_10126923 3300009098 Bacteria 2389
257 Ga0105245_10177829 3300009098 Bacteria 2031
258 Ga0105245_10287740 3300009098 Bacteria 1608
259 Ga0114129_10021149 3300009147 Bacteria 9239
260 Ga0114129_10053191 3300009147 Bacteria 5679
261 Ga0114129_10287927 3300009147 Bacteria 2193
262 Ga0105243_10316618 3300009148 Bacteria 1420
263 Ga0105242_10008278 3300009176 Bacteria 7990
264 Ga0105242_10233655 3300009176 Bacteria 1649
265 Ga0105248_10117051 3300009177 Bacteria 3006
266 Ga0105248_10122142 3300009177 Bacteria 2938
267 Ga0105238_10039130 3300009551 Bacteria 4810
268 Ga0105249_10000208 3300009553 Bacteria 67107
269 Ga0105249_10201937 3300009553 Bacteria 1946
270 Ga0105246_10168029 3300011119 Unclassified 1677
271 Ga0157373_10026857 3300013100 Bacteria 4155
272 Ga0157373_10219960 3300013100 Bacteria 1340
273 Ga0157371_10096372 3300013102 Bacteria 2097
274 Ga0157370_10005070 3300013104 Bacteria 14859
275 Ga0157370_10195687 3300013104 Bacteria 1876
276 Ga0157369_10009743 3300013105 Bacteria 10988
277 Ga0157369_10053160 3300013105 Bacteria 4379
278 Ga0157369_10110963 3300013105 Bacteria 2915
279 Ga0157374_10313348 3300013296 Bacteria 1554
280 Ga0157374_10728137 3300013296 Bacteria 1006
281 Ga0157378_10081739 3300013297 Bacteria 2920
282 Ga0157378_10085175 3300013297 Bacteria 2863
283 Ga0157378_10391422 3300013297 Bacteria 1367
284 Ga0163162_10131833 3300013306 Bacteria 2608
285 Ga0163162_10228470 3300013306 Bacteria 1991
286 Ga0157372_10005643 3300013307 Bacteria 13304
287 Ga0157372_10006972 3300013307 Bacteria 12031
288 Ga0157372_10007450 3300013307 Bacteria 11640
289 Ga0157372_10023999 3300013307 Bacteria 6616
290 Ga0157372_10025279 3300013307 Bacteria 6456
291 Ga0157372_10162186 3300013307 Bacteria 2584
292 Ga0157372_10228764 3300013307 Bacteria 2156
293 Ga0157372_10247635 3300013307 Bacteria 2068
294 Ga0157375_10012095 3300013308 Bacteria 7645
295 Ga0157375_10206901 3300013308 Bacteria 2119
296 Ga0163163_10019359 3300014325 Bacteria 6392
297 Ga0163163_10472978 3300014325 Bacteria 1314
298 Ga0157380_10128982 3300014326 Bacteria 2154
299 Ga0157380_10253304 3300014326 Unclassified 1595
300 Ga0163161_10049140 3300017792 Bacteria 3047
301 Ga0213876_10130196 3300021384 Bacteria 1337
302 Ga0207697_10003898 3300025315 Bacteria 7274
303 Ga0207682_10079133 3300025893 Unclassified 1405
304 Ga0207692_10023246 3300025898 Unclassified 2864
305 Ga0207642_10006306 3300025899 Unclassified 3933
306 Ga0207642_10027998 3300025899 Bacteria 2314
307 Ga0207688_10012873 3300025901 Bacteria 4548
308 Ga0207688_10069554 3300025901 Bacteria 1995
309 Ga0207680_10040161 3300025903 Bacteria 2721
310 Ga0207647_10136564 3300025904 Bacteria 1439
311 Ga0207699_10007472 3300025906 Bacteria 5349
312 Ga0207645_10000255 3300025907 Bacteria 44205
313 Ga0207645_10039342 3300025907 Bacteria 3030
314 Ga0207645_10039507 3300025907 Bacteria 3024
315 Ga0207645_10067756 3300025907 Bacteria 2281
316 Ga0207645_10107469 3300025907 Unclassified 1804
317 Ga0207643_10008073 3300025908 Bacteria 5645
318 Ga0207643_10013627 3300025908 Bacteria 4405
319 Ga0207705_10005249 3300025909 Bacteria 9711
320 Ga0207705_10010606 3300025909 Bacteria 6696
321 Ga0207705_10266898 3300025909 Bacteria 1308
322 Ga0207707_10002165 3300025912 Bacteria 17778
323 Ga0207707_10003993 3300025912 Bacteria 13096
324 Ga0207707_10004922 3300025912 Bacteria 11744
325 Ga0207707_10005626 3300025912 Bacteria 10963
326 Ga0207707_10005777 3300025912 Bacteria 10817
327 Ga0207707_10006457 3300025912 Bacteria 10238
328 Ga0207707_10029850 3300025912 Bacteria 4768
329 Ga0207695_10001890 3300025913 Bacteria 32757
330 Ga0207695_10084101 3300025913 Bacteria 3213
331 Ga0207663_10196311 3300025916 Unclassified 1453
332 Ga0207663_10202228 3300025916 Bacteria 1434
333 Ga0207660_10000538 3300025917 Bacteria 25403
334 Ga0207660_10039938 3300025917 Bacteria 3282
335 Ga0207660_10056380 3300025917 Bacteria 2811
336 Ga0207660_10158374 3300025917 Bacteria 1745
337 Ga0207660_10186179 3300025917 Bacteria 1615
338 Ga0207660_10382163 3300025917 Bacteria 1132
339 Ga0207660_10550773 3300025917 Bacteria 938
340 Ga0207662_10011940 3300025918 Bacteria 4831
341 Ga0207662_10127478 3300025918 Bacteria 1601
342 Ga0207662_10191820 3300025918 Bacteria 1319
343 Ga0207657_10034011 3300025919 Bacteria 4589
344 Ga0207657_10057953 3300025919 Bacteria 3336
345 Ga0207657_10073653 3300025919 Bacteria 2885
346 Ga0207657_10161023 3300025919 Bacteria 1823
347 Ga0207657_10378102 3300025919 Unclassified 1116
348 Ga0207649_10004747 3300025920 Bacteria 7354
349 Ga0207649_10067045 3300025920 Bacteria 2277
350 Ga0207649_10089929 3300025920 Bacteria 2008
351 Ga0207649_10163238 3300025920 Bacteria 1545
352 Ga0207652_10000993 3300025921 Bacteria 26220
353 Ga0207652_10009406 3300025921 Bacteria 7857
354 Ga0207652_10013457 3300025921 Bacteria 6620
355 Ga0207652_10018463 3300025921 Bacteria 5722
356 Ga0207652_10046236 3300025921 Bacteria 3713
357 Ga0207652_10078856 3300025921 Bacteria 2876
358 Ga0207652_10162243 3300025921 Bacteria 2004
359 Ga0207652_10171250 3300025921 Unclassified 1948
360 Ga0207652_10186243 3300025921 Bacteria 1866
361 Ga0207652_10262363 3300025921 Bacteria 1558
362 Ga0207652_10433735 3300025921 Unclassified 1185
363 Ga0207652_10682072 3300025921 Bacteria 918
364 Ga0207646_10006132 3300025922 Bacteria 12506
365 Ga0207646_10250758 3300025922 Bacteria 1599
366 Ga0207681_10004619 3300025923 Bacteria 8465
367 Ga0207681_10004964 3300025923 Bacteria 8173
368 Ga0207681_10124842 3300025923 Bacteria 1893
369 Ga0207681_10301308 3300025923 Unclassified 1268
370 Ga0207681_10397171 3300025923 Bacteria 1113
371 Ga0207694_10153169 3300025924 Bacteria 1858
372 Ga0207650_10022012 3300025925 Bacteria 4511
373 Ga0207650_10048032 3300025925 Bacteria 3146
374 Ga0207650_10090153 3300025925 Bacteria 2341
375 Ga0207687_10141209 3300025927 Bacteria 1827
376 Ga0207700_10047234 3300025928 Bacteria 3190
377 Ga0207700_10474260 3300025928 Unclassified 1105
378 Ga0207664_10021485 3300025929 Bacteria 4801
379 Ga0207664_10027122 3300025929 Bacteria 4338
380 Ga0207664_10038139 3300025929 Bacteria 3724
381 Ga0207664_10091411 3300025929 Bacteria 2496
382 Ga0207644_10353372 3300025931 Bacteria 1194
383 Ga0207644_10392536 3300025931 Unclassified 1133
384 Ga0207690_10051160 3300025932 Bacteria 2761
385 Ga0207690_10181309 3300025932 Bacteria 1586
386 Ga0207690_10231405 3300025932 Bacteria 1419
387 Ga0207690_10421343 3300025932 Bacteria 1068
388 Ga0207706_10000770 3300025933 Bacteria 33279
389 Ga0207706_10019794 3300025933 Bacteria 6050
390 Ga0207706_10090620 3300025933 Bacteria 2688
391 Ga0207686_10005941 3300025934 Bacteria 6554
392 Ga0207670_10303535 3300025936 Bacteria 1251
393 Ga0207669_10044870 3300025937 Bacteria 2601
394 Ga0207669_10137859 3300025937 Bacteria 1689
395 Ga0207704_10004663 3300025938 Bacteria 6282
396 Ga0207665_10004505 3300025939 Bacteria 9241
397 Ga0207665_10262284 3300025939 Bacteria 1280
398 Ga0207691_10005752 3300025940 Bacteria 11995
399 Ga0207691_10017519 3300025940 Bacteria 6791
400 Ga0207691_10022196 3300025940 Bacteria 5987
401 Ga0207691_10040641 3300025940 Bacteria 4296
402 Ga0207691_10043544 3300025940 Bacteria 4136
403 Ga0207691_10110383 3300025940 Bacteria 2446
404 Ga0207691_10149634 3300025940 Bacteria 2053
405 Ga0207691_10333122 3300025940 Bacteria 1300
406 Ga0207691_10347724 3300025940 Bacteria 1269
407 Ga0207691_10506386 3300025940 Bacteria 1025
408 Ga0207711_10140269 3300025941 Bacteria 2174
409 Ga0207711_10212244 3300025941 Bacteria 1768
410 Ga0207711_10508261 3300025941 Bacteria 1123
411 Ga0207689_10025657 3300025942 Bacteria 4937
412 Ga0207661_10002839 3300025944 Bacteria 11968
413 Ga0207661_10062256 3300025944 Bacteria 3018
414 Ga0207661_10062587 3300025944 Bacteria 3011
415 Ga0207661_10083953 3300025944 Bacteria 2637
416 Ga0207661_10097718 3300025944 Unclassified 2459
417 Ga0207661_10416122 3300025944 Unclassified 1220
418 Ga0207679_10003688 3300025945 Bacteria 9488
419 Ga0207679_10003926 3300025945 Bacteria 9235
420 Ga0207679_10005035 3300025945 Bacteria 8258
421 Ga0207679_10005619 3300025945 Bacteria 7865
422 Ga0207679_10013332 3300025945 Archaea 5384
423 Ga0207679_10036355 3300025945 Bacteria 3493
424 Ga0207679_10068334 3300025945 Bacteria 2669
425 Ga0207679_10119294 3300025945 Bacteria 2097
426 Ga0207679_10217931 3300025945 Bacteria 1604
427 Ga0207679_10352930 3300025945 Bacteria 1282
428 Ga0207651_10099068 3300025960 Bacteria 2157
429 Ga0207712_10000290 3300025961 Bacteria 47611
430 Ga0207712_10017710 3300025961 Bacteria 4631
431 Ga0207668_10044341 3300025972 Bacteria 3024
432 Ga0207668_10166852 3300025972 Bacteria 1722
433 Ga0207668_10289844 3300025972 Bacteria 1346
434 Ga0207668_10456204 3300025972 Bacteria 1092
435 Ga0207640_10000509 3300025981 Bacteria 23500
436 Ga0207640_10232942 3300025981 Unclassified 1418
437 Ga0207640_10487006 3300025981 Bacteria 1024
438 Ga0207658_10032976 3300025986 Bacteria 3691
439 Ga0207658_10079119 3300025986 Bacteria 2514
440 Ga0207658_10082426 3300025986 Bacteria 2470
441 Ga0207677_10021799 3300026023 Bacteria 3923
442 Ga0207677_10454335 3300026023 Bacteria 1098
443 Ga0207703_10014482 3300026035 Bacteria 6150
444 Ga0207703_10195929 3300026035 Bacteria 1792
445 Ga0207703_10429656 3300026035 Bacteria 1230
446 Ga0207639_10055852 3300026041 Bacteria 3024
447 Ga0207639_10131974 3300026041 Bacteria 2069
448 Ga0207639_10256132 3300026041 Bacteria 1528
449 Ga0207639_10386674 3300026041 Bacteria 1258
450 Ga0207678_10008884 3300026067 Bacteria 8848
451 Ga0207678_10650971 3300026067 Bacteria 926
452 Ga0207708_10009583 3300026075 Bacteria 7180
453 Ga0207708_10048521 3300026075 Bacteria 3232
454 Ga0207708_10400244 3300026075 Bacteria 1135
455 Ga0207641_10182855 3300026088 Bacteria 1921
456 Ga0207641_10324974 3300026088 Unclassified 1460
457 Ga0207641_10364772 3300026088 Bacteria 1380
458 Ga0207648_10030908 3300026089 Bacteria 4738
459 Ga0207648_10048359 3300026089 Bacteria 3724
460 Ga0207648_10106775 3300026089 Bacteria 2457
461 Ga0207648_10294070 3300026089 Bacteria 1455
462 Ga0207648_10967005 3300026089 Unclassified 797
463 Ga0207676_10041528 3300026095 Bacteria 3532
464 Ga0207674_10012303 3300026116 Bacteria 9567
465 Ga0207674_10012336 3300026116 Bacteria 9552
466 Ga0207674_10015688 3300026116 Bacteria 8314
467 Ga0207674_10021232 3300026116 Bacteria 6999
468 Ga0207674_10049833 3300026116 Unclassified 4280
469 Ga0207675_100005653 3300026118 Bacteria 11972
470 Ga0207675_100536262 3300026118 Bacteria 1168
471 Ga0207683_10111201 3300026121 Bacteria 2453
472 Ga0207683_10176802 3300026121 Bacteria 1935
473 Ga0207698_10007338 3300026142 Bacteria 6909
474 Ga0207698_10015633 3300026142 Bacteria 5089
475 Ga0207698_10141387 3300026142 Bacteria 2074
476 Ga0209968_1007495 3300027526 Bacteria 1651
477 Ga0209966_1002589 3300027695 Bacteria 3018
478 Ga0268266_10462823 3300028379 Unclassified 1207
479 Ga0268266_10749460 3300028379 Bacteria 942
480 Ga0268265_10004153 3300028380 Bacteria 10148
481 Ga0268265_10351404 3300028380 Bacteria 1346
482 Ga0268265_10520558 3300028380 Bacteria 1124
483 Ga0268264_10009565 3300028381 Bacteria 8026
484 Ga0268264_10026267 3300028381 Bacteria 4757
485 Ga0265327_10040269 3300031251 Bacteria 2529
486 Ga0307408_100003032 3300031548 Bacteria 11596
487 Ga0307408_100008170 3300031548 Bacteria 6913
488 Ga0307408_100034685 3300031548 Bacteria 3536
489 Ga0307408_100100010 3300031548 Unclassified 2208
490 Ga0307408_100119866 3300031548 Bacteria 2036
491 Ga0307408_100202121 3300031548 Bacteria 1609
492 Ga0265314_10020957 3300031711 Bacteria 5039
493 Ga0265314_10021872 3300031711 Bacteria 4905
494 Ga0307405_10002001 3300031731 Bacteria 8826
495 Ga0307405_10009256 3300031731 Bacteria 5040
496 Ga0307405_10015805 3300031731 Bacteria 4097
497 Ga0307405_10028459 3300031731 Unclassified 3255
498 Ga0307405_10092769 3300031731 Bacteria 2004
499 Ga0307405_10108725 3300031731 Unclassified 1874
500 Ga0307413_10024558 3300031824 Bacteria 3288
501 Ga0307413_10064044 3300031824 Bacteria 2282
502 Ga0307413_10092899 3300031824 Bacteria 1970
503 Ga0307413_10578111 3300031824 Bacteria 916
504 Ga0307410_10000047 3300031852 Bacteria 42459
505 Ga0307410_10005752 3300031852 Bacteria 6607
506 Ga0307410_10120782 3300031852 Bacteria 1910
507 Ga0307406_10001847 3300031901 Bacteria 11546
508 Ga0307406_10011061 3300031901 Bacteria 5111
509 Ga0307406_10029156 3300031901 Bacteria 3340
510 Ga0307406_10029479 3300031901 Bacteria 3324
511 Ga0307406_10034451 3300031901 Bacteria 3106
512 Ga0307406_10068400 3300031901 Bacteria 2318
513 Ga0307406_10154336 3300031901 Unclassified 1642
514 Ga0307407_10000259 3300031903 Bacteria 15683
515 Ga0307407_10000370 3300031903 Bacteria 13506
516 Ga0307407_10006717 3300031903 Bacteria 5147
517 Ga0307412_10001685 3300031911 Bacteria 12220
518 Ga0307412_10153292 3300031911 Bacteria 1703
519 Ga0307412_10228372 3300031911 Bacteria 1432
520 Ga0307412_10258342 3300031911 Bacteria 1356
521 Ga0307412_10321831 3300031911 Unclassified 1231
522 Ga0307412_10431696 3300031911 Bacteria 1080
523 Ga0307409_100001779 3300031995 Bacteria 10889
524 Ga0307409_100001816 3300031995 Bacteria 10825
525 Ga0307409_100029189 3300031995 Bacteria 3943
526 Ga0307409_100373419 3300031995 Bacteria 1353
527 Ga0307409_100443791 3300031995 Bacteria 1251
528 Ga0307416_100002414 3300032002 Bacteria 10716
529 Ga0307416_100035242 3300032002 Bacteria 3819
530 Ga0307416_100079616 3300032002 Unclassified 2762
531 Ga0307416_100386717 3300032002 Bacteria 1431
532 Ga0307416_100452834 3300032002 Bacteria 1336
533 Ga0307416_100763566 3300032002 Bacteria 1060
534 Ga0307416_100849682 3300032002 Bacteria 1011
535 Ga0307414_10002864 3300032004 Bacteria 9109
536 Ga0307414_10005623 3300032004 Bacteria 6915
537 Ga0307414_10126327 3300032004 Bacteria 1977
538 Ga0307414_10177640 3300032004 Bacteria 1709
539 Ga0307411_10001457 3300032005 Bacteria 9689
540 Ga0307411_10003317 3300032005 Bacteria 7442
541 Ga0307411_10003550 3300032005 Bacteria 7260
542 Ga0307411_10257987 3300032005 Bacteria 1375
543 Ga0307411_10366408 3300032005 Bacteria 1180
544 Ga0307411_10421142 3300032005 Bacteria 1109
545 Ga0307415_100006362 3300032126 Bacteria 6360
546 Ga0307415_100042751 3300032126 Bacteria 3018
547 Ga0307415_100071240 3300032126 Bacteria 2444
548 Ga0307415_100204727 3300032126 Bacteria 1569
549 Ga0307415_100265261 3300032126 Bacteria 1404
550 Ga0307415_100338226 3300032126 Bacteria 1262
551 Ga0307415_100473423 3300032126 Bacteria 1089
552 Ga0373959_0007883 3300034820 Bacteria 1798
553 Ga0373934_0002324 3300035086 Bacteria 6989
554 Ga0373934_0006365 3300035086 Bacteria 4378
555 Ga0373923_0017666 3300035111 Unclassified 2731
556 Ga0373953_0002216 3300035117 Bacteria 5832
557 Ga0373954_0023670 3300035118 Bacteria 2795
558 Ga0373954_0138779 3300035118 Bacteria 1185
559 Ga0373956_0004485 3300035119 Bacteria 5579
560 Ga0373957_0002433 3300035120 Bacteria 5309
561 Ga0373957_0132186 3300035120 Bacteria 1016
562 Ga0373955_0005431 3300035172 Bacteria 5727
563 Ga0373955_0060480 3300035172 Unclassified 2089
564 Ga0373935_0145903 3300035692 Bacteria 1602
565 Ga0373927_0112100 3300035695 Bacteria 1778
566 Ga0373933_0000727 3300035724 Bacteria 20200
567 Ga0373933_0007899 3300035724 Bacteria 5806
568 Ga0373937_0004152 3300036401 Bacteria 12285
569 Ga0373937_0048978 3300036401 Bacteria 3869
570 Ga0373937_0345309 3300036401 Bacteria 1409
571 Ga0373925_0068445 3300037068 Bacteria 2680
572 Ga0395899_0053141 3300037312 Bacteria 3001
573 Ga0395900_0007213 3300037418 Bacteria 11519
574 Ga0395905_0019793 3300037471 Bacteria 6380
575 Ga0395901_0014842 3300038443 Bacteria 7914
576 Ga0436365_0913083 3300039437 Bacteria 1740
577 Ga0439439_0026673 3300041406 Unclassified 1457
578 Ga0439462_0012210 3300042015 Bacteria 2193
579 Ga0439434_0005170 3300042435 Bacteria 3816
580 Ga0466963_0160400 3300044694 Bacteria 1565
581 Ga0466959_0063732 3300045049 Bacteria 2676
582 Ga0451576_0442915 3300045051 Bacteria 1363
583 Ga0466958_0300939 3300045836 Bacteria 1030
584 Ga0466967_0027194 3300045976 Bacteria 4756
585 Ga0495592_0010739 3300046454 Bacteria 6903
586 Ga0495592_0074555 3300046454 Bacteria 2465
587 Ga0495603_0212452 3300046455 Unclassified 1117
588 Ga0495629_0014963 3300046459 Bacteria 5574
589 Ga0495629_0084880 3300046459 Bacteria 2209
590 Ga0495651_0005886 3300046462 Bacteria 9354
591 Ga0495651_0021818 3300046462 Bacteria 4979
592 Ga0495653_0005466 3300046463 Bacteria 10352
593 Ga0495582_0047682 3300046473 Bacteria 2360
594 Ga0495662_0012019 3300046476 Bacteria 4232
595 Ga0495664_0053412 3300046477 Bacteria 2403
596 Ga0495664_0071782 3300046477 Unclassified 2068
597 Ga0495594_0026759 3300046499 Bacteria 3105
598 Ga0495594_0031276 3300046499 Bacteria 2885
599 Ga0495596_0066847 3300046500 Bacteria 1397
600 Ga0495608_0000277 3300046511 Bacteria 36499
601 Ga0495608_0109166 3300046511 Bacteria 1779
602 Ga0495618_0046167 3300046514 Bacteria 2749
603 Ga0495628_0024676 3300046516 Bacteria 4918
604 Ga0495628_0076070 3300046516 Bacteria 2613
605 Ga0495630_0071192 3300046517 Bacteria 2616
606 Ga0495630_0456239 3300046517 Unclassified 979
607 Ga0495652_0002422 3300046529 Bacteria 19233
608 Ga0495652_0007864 3300046529 Bacteria 9794
609 Ga0495652_0159343 3300046529 Bacteria 1754
610 Ga0495665_0002520 3300046531 Bacteria 9895
611 Ga0495640_0222496 3300046533 Unclassified 1190
612 Ga0495586_0018442 3300046535 Bacteria 3716
613 Ga0495587_0000741 3300046536 Bacteria 21806
614 Ga0495587_0198857 3300046536 Unclassified 1134
615 Ga0495621_0034069 3300046539 Bacteria 1758
616 Ga0495621_0053975 3300046539 Unclassified 1444
617 Ga0495645_0000065 3300046543 Bacteria 73256
618 Ga0495645_0078923 3300046543 Bacteria 2365
619 Ga0495667_0007384 3300046559 Bacteria 7454
620 Ga0495667_0023573 3300046559 Bacteria 4145
621 Ga0495634_0091874 3300046642 Bacteria 1970
622 Ga0495634_0137999 3300046642 Bacteria 1550
623 Ga0495634_0226964 3300046642 Bacteria 1150
624 Ga0495635_0000621 3300046663 Bacteria 22813
625 Ga0495588_0012155 3300046674 Unclassified 4059
626 Ga0495657_0002423 3300046675 Bacteria 15722
627 Ga0495657_0034768 3300046675 Bacteria 3498
628 Ga0495599_0000543 3300046678 Bacteria 21650
629 Ga0495599_0007947 3300046678 Bacteria 6433
630 Ga0495599_0089345 3300046678 Bacteria 1923
631 Ga0495623_0000896 3300046679 Bacteria 20182
632 Ga0495623_0012412 3300046679 Bacteria 5516
633 Ga0495623_0130543 3300046679 Bacteria 1505
634 Ga0495646_0012239 3300046680 Bacteria 5454
635 Ga0495613_0033909 3300046689 Unclassified 3792
636 Ga0495613_0116344 3300046689 Bacteria 1923
637 Ga0495600_0004793 3300046809 Bacteria 8118
638 Ga0495604_0001331 3300047317 Bacteria 20196
639 Ga0495604_0017740 3300047317 Bacteria 5695
640 Ga0495604_0098576 3300047317 Bacteria 2153
641 Ga0495604_0167192 3300047317 Bacteria 1550
642 Ga0495604_0312094 3300047317 Unclassified 1053
643 Ga0495674_0016990 3300047319 Bacteria 6782
644 Ga0495674_0156303 3300047319 Bacteria 1910
645 Ga0495674_0311403 3300047319 Bacteria 1284
646 Ga0495680_0010118 3300047322 Bacteria 8432
647 Ga0495675_0017790 3300047444 Bacteria 4506
648 Ga0495675_0020349 3300047444 Bacteria 4220
649 Ga0495684_0001702 3300047471 Bacteria 17687
650 Ga0495684_0027913 3300047471 Bacteria 4335
651 Ga0495593_0067379 3300047673 Bacteria 1864
652 Ga0495602_0002778 3300048088 Bacteria 17891
653 Ga0496104_0384045 3300048907 Bacteria 1317
654 Ga0496108_0018376 3300048911 Bacteria 5725
655 Ga0496108_0097540 3300048911 Bacteria 2505
656 Ga0496109_0270608 3300048912 Bacteria 1601
657 Ga0496109_0445923 3300048912 Bacteria 1223
658 Ga0496112_0030415 3300048915 Bacteria 5225
659 Ga0496112_0311897 3300048915 Bacteria 1518
660 Ga0496112_0363822 3300048915 Bacteria 1388
661 Ga0496112_0381843 3300048915 Bacteria 1350
662 Ga0496113_0413832 3300048916 Unclassified 1083
663 Ga0496115_0147240 3300048918 Bacteria 1944
664 Ga0501031_0219629 3300049568 Bacteria 1238
665 Ga0501034_0099478 3300049571 Bacteria 2903
666 Ga0501038_0068858 3300049574 Bacteria 3008
667 Ga0501038_0425854 3300049574 Bacteria 1023
668 Ga0501039_0209215 3300049575 Bacteria 1534
669 Ga0501039_0214622 3300049575 Bacteria 1513
670 Ga0501040_0086399 3300049576 Bacteria 2178
671 Ga0501040_0518734 3300049576 Unclassified 859
672 Ga0501041_0120455 3300049577 Bacteria 1630
673 Ga0501041_0451671 3300049577 Bacteria 816
674 Ga0501046_0224319 3300049580 Bacteria 1390
675 Ga0501069_0132268 3300049585 Bacteria 1429
676 Ga0501069_0171546 3300049585 Unclassified 1252
677 Ga0501070_0007386 3300049586 Bacteria 9334
678 Ga0501070_0018592 3300049586 Bacteria 5830
679 Ga0501072_0042171 3300049588 Bacteria 3585
680 Ga0501075_0106945 3300049591 Bacteria 2126
681 Ga0501076_0176119 3300049592 Bacteria 1743
682 Ga0501235_002486 3300049669 Bacteria 3971
683 Ga0501221_000350 3300049704 Bacteria 7042
684 Ga0501225_0001052 3300049705 Bacteria 8651
685 Ga0501079_0080579 3300049741 Bacteria 2517
686 Ga0501079_0097278 3300049741 Bacteria 2282
687 Ga0501080_0063436 3300049742 Bacteria 3439
688 Ga0501081_0025785 3300049743 Bacteria 3959
689 Ga0501268_000737 3300049765 Bacteria 3745
690 Ga0501270_000673 3300049767 Bacteria 3005
691 Ga0501035_0162260 3300049822 Bacteria 1934
692 Ga0501044_0042156 3300049823 Bacteria 4750
693 Ga0501045_0060205 3300049824 Bacteria 2783
694 nmdc:mga05p37_490429_c1 3300050507 Bacteria 1413
695 nmdc:mga05p37_512857_c1 3300050507 Bacteria 1373
696 nmdc:mga05p37_516123_c1 3300050507 Bacteria 1368
697 nmdc:mga05p37_67940_c1 3300050507 Bacteria 4384
698 nmdc:mga05p37_88576_c1 3300050507 Bacteria 3815
699 nmdc:mga09592_118357_c1 3300050508 Bacteria 2274
700 nmdc:mga0qj67_125069_c1 3300050509 Bacteria 2081
701 nmdc:mga0qj67_129468_c1 3300050509 Bacteria 2044
702 nmdc:mga0qj67_5585_c1 3300050509 Bacteria 9188
703 nmdc:mga0qj67_7282_c1 3300050509 Bacteria 8176
704 nmdc:mga06r32_109927_c1 3300050510 Bacteria 2711
705 nmdc:mga06r32_376913_c1 3300050510 Bacteria 1402
706 nmdc:mga06r32_38542_c1 3300050510 Bacteria 4529
707 nmdc:mga06r32_491533_c1 3300050510 Bacteria 1205
708 nmdc:mga06r32_90930_c1 3300050510 Bacteria 2982
709 nmdc:mga08y16_134151_c1 3300050511 Bacteria 2573
710 nmdc:mga08y16_459857_c1 3300050511 Bacteria 1297
711 nmdc:mga0n895_36712_c1 3300050512 Bacteria 4734
712 nmdc:mga0n895_6791_c1 3300050512 Bacteria 9766
713 nmdc:mga08x19_152034_c1 3300050514 Bacteria 1568
714 nmdc:mga0a205_29313_c1 3300050515 Bacteria 3551
715 nmdc:mga0a205_4013_c1 3300050515 Bacteria 13163
716 nmdc:mga0a205_7706_c1 3300050515 Bacteria 9768
717 Ga0495601_0014776 3300053077 Bacteria 4711
718 Ga0495612_0000960 3300053078 Bacteria 11842
719 Ga0495612_0027606 3300053078 Bacteria 2283
720 Ga0495612_0114501 3300053078 Bacteria 1157
721 Ga0495595_0016347 3300053084 Unclassified 3173
722 Ga0495619_0001459 3300053085 Bacteria 15589
723 Ga0495619_0434058 3300053085 Bacteria 906
724 Ga0501084_0304395 3300054114 Bacteria 1346
725 Ga0209974_10078774
726 MBSR1b_contig_2222046
727 Ga0065715_10098441
728 Ga0065715_10137766
729 Ga0070658_10007335
730 Ga0070658_10008523
731 Ga0070658_10200848
732 Ga0070658_10235304
733 Ga0070658_10413044
734 Ga0070676_10000608
735 Ga0070676_10031606
736 Ga0070676_10032216
737 Ga0070676_10093448
738 Ga0070676_10103050
739 Ga0070676_10232374
740 Ga0070683_100002470
741 Ga0070683_100005121
742 Ga0070683_100011318
743 Ga0070683_100022264
744 Ga0070683_100049544
745 Ga0070683_100089202
746 Ga0070683_100093757
747 Ga0070683_100127393
748 Ga0070683_100127971
749 Ga0070683_100258850
750 Ga0070683_100383412
751 Ga0070690_100057005
752 Ga0070690_100128668
753 Ga0070670_100034172
754 Ga0070670_100155320
755 Ga0070666_10072566
756 Ga0070680_100000644
757 Ga0070680_100003468
758 Ga0070680_100040666
759 Ga0070680_100044586
760 Ga0070680_100081433
761 Ga0070680_100209161
762 Ga0070680_100280780
763 Ga0070682_100004179
764 Ga0070682_100007538
765 Ga0070682_100045192
766 Ga0068868_100004167
767 Ga0068868_100006488
768 Ga0068868_100018653
769 Ga0070660_100028651
770 Ga0070660_100044055
771 Ga0070660_100155587
772 Ga0070660_100253727
773 Ga0070660_100460021
774 Ga0070691_10003613
775 Ga0070691_10036025
776 Ga0070691_10107053
777 Ga0070687_100014508
778 Ga0070687_100035590
779 Ga0070687_100115345
780 Ga0070661_100000761
781 Ga0070661_100003802
782 Ga0070661_100005457
783 Ga0070661_100006089
784 Ga0070661_100189548
785 Ga0070661_100387216
786 Ga0070668_100003223
787 Ga0070668_100031055
788 Ga0070668_100086811
789 Ga0070668_100116602
790 Ga0070668_100271360
791 Ga0070668_100783394
792 Ga0070669_100006603
793 Ga0070669_100014174
794 Ga0070669_100041929
795 Ga0070669_100182871
796 Ga0070675_100001278
797 Ga0070675_100002172
798 Ga0070671_100065318
799 Ga0070671_100137532
800 Ga0070674_100009271
801 Ga0070674_100057554
802 Ga0070674_100070416
803 Ga0070673_100043394
804 Ga0070673_100178854
805 Ga0070673_100409003
806 Ga0070688_100045724
807 Ga0070688_100185027
808 Ga0070688_100346993
809 Ga0070659_100038398
810 Ga0070659_100064476
811 Ga0070659_100113091
812 Ga0070659_100140221
813 Ga0070667_100014962
814 Ga0070667_100042982
815 Ga0070667_100047745
816 Ga0070667_100071641
817 Ga0070667_100072809
818 Ga0070703_10097768
819 Ga0070709_10004306
820 Ga0070709_10312948
821 Ga0070714_100001226
822 Ga0070714_100023692
823 Ga0070713_100043932
824 Ga0070711_100031915
825 Ga0070711_100137629
826 Ga0070711_100537193
827 Ga0070705_100152137
828 Ga0070705_100299812
829 Ga0070700_100037072
830 Ga0070694_100083507
831 Ga0070694_100166674
832 Ga0070708_100000190
833 Ga0070708_100020067
834 Ga0070708_100182744
835 Ga0070662_100001376
836 Ga0070662_100198086
837 Ga0070662_100262866
838 Ga0070681_10000928
839 Ga0070681_10004415
840 Ga0070681_10006055
841 Ga0070681_10006963
842 Ga0070681_10007632
843 Ga0070681_10075580
844 Ga0070681_10226143
845 Ga0070681_10262673
846 Ga0068867_100022856
847 Ga0068867_100144673
848 Ga0068867_100268110
849 Ga0070685_10016878
850 Ga0070685_10267015
851 Ga0070706_100013029
852 Ga0070707_100006169
853 Ga0070698_100002088
854 Ga0070698_100070929
855 Ga0070698_100112664
856 Ga0070699_100013450
857 Ga0070699_100068146
858 Ga0070699_100151410
859 Ga0070679_100003697
860 Ga0070679_100028372
861 Ga0070679_100030359
862 Ga0070679_100175834
863 Ga0070679_100247057
864 Ga0070679_100274732
865 Ga0070679_100382530
866 Ga0070684_100001167
867 Ga0070684_100013355
868 Ga0070684_100045353
869 Ga0070684_100117164
870 Ga0070684_100139212
871 Ga0070684_100195633
872 Ga0070684_100379016
873 Ga0070684_100513702
874 Ga0070697_100150433
875 Ga0068853_100008655
876 Ga0068853_100013170
877 Ga0068853_100024196
878 Ga0068853_100382303
879 Ga0068853_100435154
880 Ga0070672_100002022
881 Ga0070672_100003297
882 Ga0070672_100007221
883 Ga0070672_100090357
884 Ga0070672_100102598
885 Ga0070672_100167010
886 Ga0070672_100540619
887 Ga0070686_100199390
888 Ga0070696_100002920
889 Ga0070696_100047408
890 Ga0070693_100004867
891 Ga0070693_100026889
892 Ga0070693_100108602
893 Ga0070665_100307066
894 Ga0070704_100151997
895 Ga0070704_100186569
896 Ga0068855_100004766
897 Ga0068855_100006027
898 Ga0068855_100068506
899 Ga0070664_100018634
900 Ga0070664_100030407
901 Ga0070664_100030622
902 Ga0070664_100051387
903 Ga0070664_100059812
904 Ga0070664_100082996
905 Ga0070664_100140912
906 Ga0070664_100186172
907 Ga0070664_100240562
908 Ga0070664_100284877
909 Ga0070664_100292295
910 Ga0070664_100528248
911 Ga0068857_100016634
912 Ga0068857_100019480
913 Ga0068857_100039395
914 Ga0068857_100117434
915 Ga0068854_100048636
916 Ga0068854_100204841
917 Ga0068856_100109648
918 Ga0070702_100046835
919 Ga0068852_100002352
920 Ga0068852_100010557
921 Ga0068852_100153289
922 Ga0068859_100126537
923 Ga0068859_100319975
924 Ga0068859_100714827
925 Ga0068864_100140137
926 Ga0068864_100281032
927 Ga0068866_10039494
928 Ga0068866_10041824
929 Ga0068861_100001161
930 Ga0068861_100247609
931 Ga0068861_100256475
932 Ga0068870_10001351
933 Ga0068863_100035844
934 Ga0068863_100474435
935 Ga0068858_100067568
936 Ga0068858_100092971
937 Ga0068860_100003640
938 Ga0068860_100597318
939 Ga0068862_100000608
940 Ga0068862_100004345
941 Ga0068862_100215105
942 Ga0068862_100260112
943 Ga0081455_10168667
944 Ga0070716_100003603
945 Ga0070712_100121858
946 Ga0075428_100008077
947 Ga0075428_100205402
948 Ga0075430_100004875
949 Ga0075430_100054680
950 Ga0075430_100102250
951 Ga0075430_100199632
952 Ga0075431_100021710
953 Ga0075431_100047339
954 Ga0075431_100082659
955 Ga0075431_100226721
956 Ga0075431_100384747
957 Ga0075433_10031738
958 Ga0075433_10064605
959 Ga0075433_10143515
960 Ga0075434_100031077
961 Ga0075434_100052731
962 Ga0075434_100089151
963 Ga0075429_100094794
964 Ga0075429_100109237
965 Ga0068865_100008019
966 Ga0068865_100008154
967 Ga0075436_100005006
968 Ga0075436_100045049
969 Ga0097620_100126550
970 Ga0097620_100319946
971 Ga0097620_100714948
972 Ga0099795_10024207
973 Ga0105240_10090925
974 Ga0105240_10102815
975 Ga0105240_10146451
976 Ga0105240_10244213
977 Ga0111539_10030654
978 Ga0111539_10499172
979 Ga0105245_10031008
980 Ga0105245_10126923
981 Ga0105245_10177829
982 Ga0105245_10287740
983 Ga0114129_10021149
984 Ga0114129_10053191
985 Ga0114129_10287927
986 Ga0105243_10316618
987 Ga0105242_10008278
988 Ga0105242_10233655
989 Ga0105248_10117051
990 Ga0105248_10122142
991 Ga0105238_10039130
992 Ga0105249_10000208
993 Ga0105249_10201937
994 Ga0105246_10168029
995 Ga0157373_10026857
996 Ga0157373_10219960
997 Ga0157371_10096372
998 Ga0157370_10005070
999 Ga0157370_10195687
1000 Ga0157369_10009743
1001 Ga0157369_10053160
1002 Ga0157369_10110963
1003 Ga0157374_10313348
1004 Ga0157374_10728137
1005 Ga0157378_10081739
1006 Ga0157378_10085175
1007 Ga0157378_10391422
1008 Ga0163162_10131833
1009 Ga0163162_10228470
1010 Ga0157372_10005643
1011 Ga0157372_10006972
1012 Ga0157372_10007450
1013 Ga0157372_10023999
1014 Ga0157372_10025279
1015 Ga0157372_10162186
1016 Ga0157372_10228764
1017 Ga0157372_10247635
1018 Ga0157375_10012095
1019 Ga0157375_10206901
1020 Ga0163163_10019359
1021 Ga0163163_10472978
1022 Ga0157380_10128982
1023 Ga0157380_10253304
1024 Ga0163161_10049140
1025 Ga0213876_10130196
1026 Ga0207697_10003898
1027 Ga0207682_10079133
1028 Ga0207692_10023246
1029 Ga0207642_10006306
1030 Ga0207642_10027998
1031 Ga0207688_10012873
1032 Ga0207688_10069554
1033 Ga0207680_10040161
1034 Ga0207647_10136564
1035 Ga0207699_10007472
1036 Ga0207645_10000255
1037 Ga0207645_10039342
1038 Ga0207645_10039507
1039 Ga0207645_10067756
1040 Ga0207645_10107469
1041 Ga0207643_10008073
1042 Ga0207643_10013627
1043 Ga0207705_10005249
1044 Ga0207705_10010606
1045 Ga0207705_10266898
1046 Ga0207707_10002165
1047 Ga0207707_10003993
1048 Ga0207707_10004922
1049 Ga0207707_10005626
1050 Ga0207707_10005777
1051 Ga0207707_10006457
1052 Ga0207707_10029850
1053 Ga0207695_10001890
1054 Ga0207695_10084101
1055 Ga0207663_10196311
1056 Ga0207663_10202228
1057 Ga0207660_10000538
1058 Ga0207660_10039938
1059 Ga0207660_10056380
1060 Ga0207660_10158374
1061 Ga0207660_10186179
1062 Ga0207660_10382163
1063 Ga0207660_10550773
1064 Ga0207662_10011940
1065 Ga0207662_10127478
1066 Ga0207662_10191820
1067 Ga0207657_10034011
1068 Ga0207657_10057953
1069 Ga0207657_10073653
1070 Ga0207657_10161023
1071 Ga0207657_10378102
1072 Ga0207649_10004747
1073 Ga0207649_10067045
1074 Ga0207649_10089929
1075 Ga0207649_10163238
1076 Ga0207652_10000993
1077 Ga0207652_10009406
1078 Ga0207652_10013457
1079 Ga0207652_10018463
1080 Ga0207652_10046236
1081 Ga0207652_10078856
1082 Ga0207652_10162243
1083 Ga0207652_10171250
1084 Ga0207652_10186243
1085 Ga0207652_10262363
1086 Ga0207652_10433735
1087 Ga0207652_10682072
1088 Ga0207646_10006132
1089 Ga0207646_10250758
1090 Ga0207681_10004619
1091 Ga0207681_10004964
1092 Ga0207681_10124842
1093 Ga0207681_10301308
1094 Ga0207681_10397171
1095 Ga0207694_10153169
1096 Ga0207650_10022012
1097 Ga0207650_10048032
1098 Ga0207650_10090153
1099 Ga0207687_10141209
1100 Ga0207700_10047234
1101 Ga0207700_10474260
1102 Ga0207664_10021485
1103 Ga0207664_10027122
1104 Ga0207664_10038139
1105 Ga0207664_10091411
1106 Ga0207644_10353372
1107 Ga0207644_10392536
1108 Ga0207690_10051160
1109 Ga0207690_10181309
1110 Ga0207690_10231405
1111 Ga0207690_10421343
1112 Ga0207706_10000770
1113 Ga0207706_10019794
1114 Ga0207706_10090620
1115 Ga0207686_10005941
1116 Ga0207670_10303535
1117 Ga0207669_10044870
1118 Ga0207669_10137859
1119 Ga0207704_10004663
1120 Ga0207665_10004505
1121 Ga0207665_10262284
1122 Ga0207691_10005752
1123 Ga0207691_10017519
1124 Ga0207691_10022196
1125 Ga0207691_10040641
1126 Ga0207691_10043544
1127 Ga0207691_10110383
1128 Ga0207691_10149634
1129 Ga0207691_10333122
1130 Ga0207691_10347724
1131 Ga0207691_10506386
1132 Ga0207711_10140269
1133 Ga0207711_10212244
1134 Ga0207711_10508261
1135 Ga0207689_10025657
1136 Ga0207661_10002839
1137 Ga0207661_10062256
1138 Ga0207661_10062587
1139 Ga0207661_10083953
1140 Ga0207661_10097718
1141 Ga0207661_10416122
1142 Ga0207679_10003688
1143 Ga0207679_10003926
1144 Ga0207679_10005035
1145 Ga0207679_10005619
1146 Ga0207679_10013332
1147 Ga0207679_10036355
1148 Ga0207679_10068334
1149 Ga0207679_10119294
1150 Ga0207679_10217931
1151 Ga0207679_10352930
1152 Ga0207651_10099068
1153 Ga0207712_10000290
1154 Ga0207712_10017710
1155 Ga0207668_10044341
1156 Ga0207668_10166852
1157 Ga0207668_10289844
1158 Ga0207668_10456204
1159 Ga0207640_10000509
1160 Ga0207640_10232942
1161 Ga0207640_10487006
1162 Ga0207658_10032976
1163 Ga0207658_10079119
1164 Ga0207658_10082426
1165 Ga0207677_10021799
1166 Ga0207677_10454335
1167 Ga0207703_10014482
1168 Ga0207703_10195929
1169 Ga0207703_10429656
1170 Ga0207639_10055852
1171 Ga0207639_10131974
1172 Ga0207639_10256132
1173 Ga0207639_10386674
1174 Ga0207678_10008884
1175 Ga0207678_10650971
1176 Ga0207708_10009583
1177 Ga0207708_10048521
1178 Ga0207708_10400244
1179 Ga0207641_10182855
1180 Ga0207641_10324974
1181 Ga0207641_10364772
1182 Ga0207648_10030908
1183 Ga0207648_10048359
1184 Ga0207648_10106775
1185 Ga0207648_10294070
1186 Ga0207648_10967005
1187 Ga0207676_10041528
1188 Ga0207674_10012303
1189 Ga0207674_10012336
1190 Ga0207674_10015688
1191 Ga0207674_10021232
1192 Ga0207674_10049833
1193 Ga0207675_100005653
1194 Ga0207675_100536262
1195 Ga0207683_10111201
1196 Ga0207683_10176802
1197 Ga0207698_10007338
1198 Ga0207698_10015633
1199 Ga0207698_10141387
1200 Ga0209968_1007495
1201 Ga0209966_1002589
1202 Ga0268266_10462823
1203 Ga0268266_10749460
1204 Ga0268265_10004153
1205 Ga0268265_10351404
1206 Ga0268265_10520558
1207 Ga0268264_10009565
1208 Ga0268264_10026267
1209 Ga0265327_10040269
1210 Ga0307408_100003032
1211 Ga0307408_100008170
1212 Ga0307408_100034685
1213 Ga0307408_100100010
1214 Ga0307408_100119866
1215 Ga0307408_100202121
1216 Ga0265314_10020957
1217 Ga0265314_10021872
1218 Ga0307405_10002001
1219 Ga0307405_10009256
1220 Ga0307405_10015805
1221 Ga0307405_10028459
1222 Ga0307405_10092769
1223 Ga0307405_10108725
1224 Ga0307413_10024558
1225 Ga0307413_10064044
1226 Ga0307413_10092899
1227 Ga0307413_10578111
1228 Ga0307410_10000047
1229 Ga0307410_10005752
1230 Ga0307410_10120782
1231 Ga0307406_10001847
1232 Ga0307406_10011061
1233 Ga0307406_10029156
1234 Ga0307406_10029479
1235 Ga0307406_10034451
1236 Ga0307406_10068400
1237 Ga0307406_10154336
1238 Ga0307407_10000259
1239 Ga0307407_10000370
1240 Ga0307407_10006717
1241 Ga0307412_10001685
1242 Ga0307412_10153292
1243 Ga0307412_10228372
1244 Ga0307412_10258342
1245 Ga0307412_10321831
1246 Ga0307412_10431696
1247 Ga0307409_100001779
1248 Ga0307409_100001816
1249 Ga0307409_100029189
1250 Ga0307409_100373419
1251 Ga0307409_100443791
1252 Ga0307416_100002414
1253 Ga0307416_100035242
1254 Ga0307416_100079616
1255 Ga0307416_100386717
1256 Ga0307416_100452834
1257 Ga0307416_100763566
1258 Ga0307416_100849682
1259 Ga0307414_10002864
1260 Ga0307414_10005623
1261 Ga0307414_10126327
1262 Ga0307414_10177640
1263 Ga0307411_10001457
1264 Ga0307411_10003317
1265 Ga0307411_10003550
1266 Ga0307411_10257987
1267 Ga0307411_10366408
1268 Ga0307411_10421142
1269 Ga0307415_100006362
1270 Ga0307415_100042751
1271 Ga0307415_100071240
1272 Ga0307415_100204727
1273 Ga0307415_100265261
1274 Ga0307415_100338226
1275 Ga0307415_100473423
1276 Ga0373959_0007883
1277 Ga0373934_0002324
1278 Ga0373934_0006365
1279 Ga0373923_0017666
1280 Ga0373953_0002216
1281 Ga0373954_0023670
1282 Ga0373954_0138779
1283 Ga0373956_0004485
1284 Ga0373957_0002433
1285 Ga0373957_0132186
1286 Ga0373955_0005431
1287 Ga0373955_0060480
1288 Ga0373935_0145903
1289 Ga0373927_0112100
1290 Ga0373933_0000727
1291 Ga0373933_0007899
1292 Ga0373937_0004152
1293 Ga0373937_0048978
1294 Ga0373937_0345309
1295 Ga0373925_0068445
1296 Ga0395899_0053141
1297 Ga0395900_0007213
1298 Ga0395905_0019793
1299 Ga0395901_0014842
1300 Ga0436365_0913083
1301 Ga0439439_0026673
1302 Ga0439462_0012210
1303 Ga0439434_0005170
1304 Ga0466963_0160400
1305 Ga0466959_0063732
1306 Ga0451576_0442915
1307 Ga0466958_0300939
1308 Ga0466967_0027194
1309 Ga0495592_0010739
1310 Ga0495592_0074555
1311 Ga0495603_0212452
1312 Ga0495629_0014963
1313 Ga0495629_0084880
1314 Ga0495651_0005886
1315 Ga0495651_0021818
1316 Ga0495653_0005466
1317 Ga0495582_0047682
1318 Ga0495662_0012019
1319 Ga0495664_0053412
1320 Ga0495664_0071782
1321 Ga0495594_0026759
1322 Ga0495594_0031276
1323 Ga0495596_0066847
1324 Ga0495608_0000277
1325 Ga0495608_0109166
1326 Ga0495618_0046167
1327 Ga0495628_0024676
1328 Ga0495628_0076070
1329 Ga0495630_0071192
1330 Ga0495630_0456239
1331 Ga0495652_0002422
1332 Ga0495652_0007864
1333 Ga0495652_0159343
1334 Ga0495665_0002520
1335 Ga0495640_0222496
1336 Ga0495586_0018442
1337 Ga0495587_0000741
1338 Ga0495587_0198857
1339 Ga0495621_0034069
1340 Ga0495621_0053975
1341 Ga0495645_0000065
1342 Ga0495645_0078923
1343 Ga0495667_0007384
1344 Ga0495667_0023573
1345 Ga0495634_0091874
1346 Ga0495634_0137999
1347 Ga0495634_0226964
1348 Ga0495635_0000621
1349 Ga0495588_0012155
1350 Ga0495657_0002423
1351 Ga0495657_0034768
1352 Ga0495599_0000543
1353 Ga0495599_0007947
1354 Ga0495599_0089345
1355 Ga0495623_0000896
1356 Ga0495623_0012412
1357 Ga0495623_0130543
1358 Ga0495646_0012239
1359 Ga0495613_0033909
1360 Ga0495613_0116344
1361 Ga0495600_0004793
1362 Ga0495604_0001331
1363 Ga0495604_0017740
1364 Ga0495604_0098576
1365 Ga0495604_0167192
1366 Ga0495604_0312094
1367 Ga0495674_0016990
1368 Ga0495674_0156303
1369 Ga0495674_0311403
1370 Ga0495680_0010118
1371 Ga0495675_0017790
1372 Ga0495675_0020349
1373 Ga0495684_0001702
1374 Ga0495684_0027913
1375 Ga0495593_0067379
1376 Ga0495602_0002778
1377 Ga0496104_0384045
1378 Ga0496108_0018376
1379 Ga0496108_0097540
1380 Ga0496109_0270608
1381 Ga0496109_0445923
1382 Ga0496112_0030415
1383 Ga0496112_0311897
1384 Ga0496112_0363822
1385 Ga0496112_0381843
1386 Ga0496113_0413832
1387 Ga0496115_0147240
1388 Ga0501031_0219629
1389 Ga0501034_0099478
1390 Ga0501038_0068858
1391 Ga0501038_0425854
1392 Ga0501039_0209215
1393 Ga0501039_0214622
1394 Ga0501040_0086399
1395 Ga0501040_0518734
1396 Ga0501041_0120455
1397 Ga0501041_0451671
1398 Ga0501046_0224319
1399 Ga0501069_0132268
1400 Ga0501069_0171546
1401 Ga0501070_0007386
1402 Ga0501070_0018592
1403 Ga0501072_0042171
1404 Ga0501075_0106945
1405 Ga0501076_0176119
1406 Ga0501235_002486
1407 Ga0501221_000350
1408 Ga0501225_0001052
1409 Ga0501079_0080579
1410 Ga0501079_0097278
1411 Ga0501080_0063436
1412 Ga0501081_0025785
1413 Ga0501268_000737
1414 Ga0501270_000673
1415 Ga0501035_0162260
1416 Ga0501044_0042156
1417 Ga0501045_0060205
1418 nmdc:mga05p37_490429_c1
1419 nmdc:mga05p37_512857_c1
1420 nmdc:mga05p37_516123_c1
1421 nmdc:mga05p37_67940_c1
1422 nmdc:mga05p37_88576_c1
1423 nmdc:mga09592_118357_c1
1424 nmdc:mga0qj67_125069_c1
1425 nmdc:mga0qj67_129468_c1
1426 nmdc:mga0qj67_5585_c1
1427 nmdc:mga0qj67_7282_c1
1428 nmdc:mga06r32_109927_c1
1429 nmdc:mga06r32_376913_c1
1430 nmdc:mga06r32_38542_c1
1431 nmdc:mga06r32_491533_c1
1432 nmdc:mga06r32_90930_c1
1433 nmdc:mga08y16_134151_c1
1434 nmdc:mga08y16_459857_c1
1435 nmdc:mga0n895_36712_c1
1436 nmdc:mga0n895_6791_c1
1437 nmdc:mga08x19_152034_c1
1438 nmdc:mga0a205_29313_c1
1439 nmdc:mga0a205_4013_c1
1440 nmdc:mga0a205_7706_c1
1441 Ga0495601_0014776
1442 Ga0495612_0000960
1443 Ga0495612_0027606
1444 Ga0495612_0114501
1445 Ga0495595_0016347
1446 Ga0495619_0001459
1447 Ga0495619_0434058
1448 Ga0501084_0304395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

32

230

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ph9-assembly1.cif.gz_A crystal structure of the klebsiella pneumoniae lpxh-lipid x complex 0.8556 6 240
5k8k-assembly1.cif.gz_A structure of the haemophilus influenzae lpxh-lipid x complex 0.8527 6 230
5b4c-assembly2.cif.gz_B crystal structure of h10n mutant of lpxh with manganese 0.8422 6 238
5b49-assembly1.cif.gz_A crystal structure of lpxh with manganese from pseudomonas aeruginosa 0.8405 6 238
5b4d-assembly2.cif.gz_B crystal structure of h10n mutant of lpxh 0.8327 6 238
ID Description Score Start End Superfamily
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8253 6 235 2.40.10.10
af_P43341_2_237_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8029 6 235 2.40.10.10
af_O15033_163_457_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7893 224 251 2.60.40.10
af_P62884_4_312_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7649 223 252 2.130.10.10
af_Q86HW2_322_412_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.7456 222 252 2.20.110.10
ID Description Score Start End GO Terms
AF-A0A2V7HKL9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9813 2 252 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2V7HKL9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9736 2 252 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A7W0VZU6-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase 0.9688 32 251 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2G4IBQ2-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9597 2 252 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2G4IBQ2-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9523 2 252 GO:0005886
GO:0008758
GO:0009245
GO:0046872

Map