F477393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 373 | 680 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_003304|Ga0500595_003304_3563_4510 |
| Length | 315 |
| Sequence | MLMLRPDRRSAMLRPIAAFRAIPPAGIHAFPLHRKECQTAPAAAMGLDNIGAGAAVIASAMPEMPGLFTLAIALSGMFLIAFMKGAFGGGFAIVGIPLLSLAMDPITAGALLAPLFVVMDITALHYWRPNTWSRVDLAMLLPALVVGIGLGYFALRDLDRHAVEIVMGAVTLAFVALWFLGGGEVKPRPRSTWKAMLAGLSSGVTTMVAHSGGPPLAIYLLPLGMSKALYAGTTSLFFTVGNLLKAGPWLVLATPSKSLWILMALCVPAVPAGVWAGWRLHERLDQRALYRACYAILVVTAAKLLWDGLAGYVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 2 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 3 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 4 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 5 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 8 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 9 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 10 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 11 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 12 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 13 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 14 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 15 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 16 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 17 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 18 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 19 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 20 | 2904699407 | |||
| 21 | 2906610324 | |||
| 22 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 23 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 24 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 25 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 26 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 27 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 28 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 41 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 42 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 43 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 56 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 116 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 117 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 118 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 147 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 348 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 350 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 352 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 360 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 366 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 367 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 368 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 369 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 370 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 371 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 372 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 373 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.58 |
| Metatranscriptomes | 0 |
| Isolates | 5.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.59 |
| Nodule | 5.13 |
| Rhizoplane | 8.18 |
| Rhizosphere | 60.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10004632 | 3300001989 | Bacteria | 5258 |
| 2 | JGI25159J45721_1000030 | 3300002987 | Bacteria | 102429 |
| 3 | JGI25151J46595_10001370 | 3300003187 | Bacteria | 16856 |
| 4 | JGI25151J46595_10002889 | 3300003187 | Bacteria | 9851 |
| 5 | JGI25406J46586_10000085 | 3300003203 | Bacteria | 42549 |
| 6 | JGI25165J46597_1000975 | 3300003214 | Bacteria | 19228 |
| 7 | rootH2_10065025 | 3300003320 | Bacteria | 1425 |
| 8 | rootH1_10265325 | 3300003323 | Bacteria | 1805 |
| 9 | JGI25160J50197_1000075 | 3300003354 | Bacteria | 102429 |
| 10 | JGI25160J50197_1000524 | 3300003354 | Bacteria | 22193 |
| 11 | JGI25161J50226_1000388 | 3300003374 | Bacteria | 22193 |
| 12 | JGI25161J50226_1000593 | 3300003374 | Bacteria | 15214 |
| 13 | JGI25404J52841_10000831 | 3300003659 | Bacteria | 4943 |
| 14 | Ga0055532_1001009 | 3300003758 | Bacteria | 8826 |
| 15 | Ga0055527_1000150 | 3300003760 | Bacteria | 49156 |
| 16 | Ga0055535_1000202 | 3300003761 | Bacteria | 63538 |
| 17 | Ga0055542_1000237 | 3300003762 | Bacteria | 63538 |
| 18 | Ga0055529_1000257 | 3300003763 | Bacteria | 63538 |
| 19 | Ga0055526_1002008 | 3300003771 | Bacteria | 14018 |
| 20 | Ga0055526_1006673 | 3300003771 | Bacteria | 6192 |
| 21 | Ga0055526_1008700 | 3300003771 | Bacteria | 5009 |
| 22 | Ga0055526_1012200 | 3300003771 | Bacteria | 3774 |
| 23 | Ga0055524_1000014 | 3300003775 | Bacteria | 259417 |
| 24 | Ga0055524_1006932 | 3300003775 | Bacteria | 4872 |
| 25 | Ga0055536_1000203 | 3300003781 | Bacteria | 48522 |
| 26 | Ga0055536_1005974 | 3300003781 | Bacteria | 5804 |
| 27 | Ga0055534_1000660 | 3300003784 | Bacteria | 17385 |
| 28 | Ga0055534_1004256 | 3300003784 | Bacteria | 4211 |
| 29 | Ga0055528_1000858 | 3300003790 | Bacteria | 20639 |
| 30 | Ga0055531_10018718 | 3300003794 | Bacteria | 2843 |
| 31 | Ga0058692_1011333 | 3300003856 | Bacteria | 2160 |
| 32 | Ga0055543_1000168 | 3300004625 | Bacteria | 54974 |
| 33 | Ga0055543_1000449 | 3300004625 | Bacteria | 25002 |
| 34 | Ga0065165_1000206 | 3300005262 | Bacteria | 102467 |
| 35 | Ga0065165_1001476 | 3300005262 | Bacteria | 25122 |
| 36 | Ga0070683_100149183 | 3300005329 | Bacteria | 2217 |
| 37 | Ga0068869_100435843 | 3300005334 | Bacteria | 1084 |
| 38 | Ga0068868_100105920 | 3300005338 | Bacteria | 2281 |
| 39 | Ga0070691_10001016 | 3300005341 | Bacteria | 11520 |
| 40 | Ga0070661_100070893 | 3300005344 | Bacteria | 2564 |
| 41 | Ga0070668_100113315 | 3300005347 | Bacteria | 2160 |
| 42 | Ga0070668_100311228 | 3300005347 | Bacteria | 1323 |
| 43 | Ga0070669_100010500 | 3300005353 | Bacteria | 6576 |
| 44 | Ga0070669_100312136 | 3300005353 | Bacteria | 1268 |
| 45 | Ga0070675_100246230 | 3300005354 | Bacteria | 1563 |
| 46 | Ga0070671_100034409 | 3300005355 | Bacteria | 4194 |
| 47 | Ga0070671_100081155 | 3300005355 | Bacteria | 2712 |
| 48 | Ga0070671_100318680 | 3300005355 | Bacteria | 1325 |
| 49 | Ga0070674_100041548 | 3300005356 | Bacteria | 3118 |
| 50 | Ga0070674_100597411 | 3300005356 | Bacteria | 932 |
| 51 | Ga0070673_100195956 | 3300005364 | Bacteria | 1737 |
| 52 | Ga0070709_10000216 | 3300005434 | Bacteria | 37230 |
| 53 | Ga0070709_10270246 | 3300005434 | Bacteria | 1232 |
| 54 | Ga0070713_100050867 | 3300005436 | Bacteria | 3425 |
| 55 | Ga0070710_10003345 | 3300005437 | Bacteria | 7602 |
| 56 | Ga0070710_10272384 | 3300005437 | Bacteria | 1095 |
| 57 | Ga0070711_100014513 | 3300005439 | Bacteria | 4964 |
| 58 | Ga0070711_100103366 | 3300005439 | Bacteria | 2076 |
| 59 | Ga0070711_100190094 | 3300005439 | Bacteria | 1577 |
| 60 | Ga0070700_100004033 | 3300005441 | Bacteria | 7642 |
| 61 | Ga0070700_100106267 | 3300005441 | Bacteria | 1858 |
| 62 | Ga0070700_100194720 | 3300005441 | Bacteria | 1420 |
| 63 | Ga0070694_100124957 | 3300005444 | Bacteria | 1851 |
| 64 | Ga0070663_100151170 | 3300005455 | Bacteria | 1780 |
| 65 | Ga0070663_100292779 | 3300005455 | Bacteria | 1301 |
| 66 | Ga0070678_100030921 | 3300005456 | Bacteria | 3687 |
| 67 | Ga0070678_100213961 | 3300005456 | Bacteria | 1599 |
| 68 | Ga0070678_100501511 | 3300005456 | Bacteria | 1071 |
| 69 | Ga0070662_100085523 | 3300005457 | Bacteria | 2357 |
| 70 | Ga0070681_10067376 | 3300005458 | Bacteria | 3548 |
| 71 | Ga0068867_100605631 | 3300005459 | Bacteria | 956 |
| 72 | Ga0070685_10148200 | 3300005466 | Bacteria | 1485 |
| 73 | Ga0070706_100201010 | 3300005467 | Bacteria | 1862 |
| 74 | Ga0070699_100055039 | 3300005518 | Bacteria | 3446 |
| 75 | Ga0068853_100740690 | 3300005539 | Bacteria | 939 |
| 76 | Ga0070695_100000381 | 3300005545 | Bacteria | 22893 |
| 77 | Ga0070696_100170054 | 3300005546 | Bacteria | 1610 |
| 78 | Ga0068855_100124512 | 3300005563 | Bacteria | 2948 |
| 79 | Ga0068856_100115164 | 3300005614 | Bacteria | 2688 |
| 80 | Ga0068856_100824728 | 3300005614 | Bacteria | 947 |
| 81 | Ga0068852_100032142 | 3300005616 | Bacteria | 4341 |
| 82 | Ga0068859_100249718 | 3300005617 | Bacteria | 1864 |
| 83 | Ga0068864_100053213 | 3300005618 | Bacteria | 3492 |
| 84 | Ga0068864_100482899 | 3300005618 | Bacteria | 1189 |
| 85 | Ga0068861_100025826 | 3300005719 | Bacteria | 4265 |
| 86 | Ga0068863_100684527 | 3300005841 | Bacteria | 1019 |
| 87 | Ga0068858_100422023 | 3300005842 | Bacteria | 1283 |
| 88 | Ga0068860_100271287 | 3300005843 | Bacteria | 1656 |
| 89 | Ga0068862_100717787 | 3300005844 | Bacteria | 970 |
| 90 | Ga0081455_10015097 | 3300005937 | Bacteria | 7519 |
| 91 | Ga0081540_1001168 | 3300005983 | Bacteria | 23063 |
| 92 | Ga0081540_1001292 | 3300005983 | Bacteria | 21853 |
| 93 | Ga0081540_1001561 | 3300005983 | Bacteria | 19619 |
| 94 | Ga0081540_1004935 | 3300005983 | Bacteria | 10034 |
| 95 | Ga0081540_1010233 | 3300005983 | Bacteria | 6371 |
| 96 | Ga0081540_1013374 | 3300005983 | Bacteria | 5340 |
| 97 | Ga0081540_1024995 | 3300005983 | Bacteria | 3452 |
| 98 | Ga0081540_1037124 | 3300005983 | Bacteria | 2587 |
| 99 | Ga0081540_1046539 | 3300005983 | Bacteria | 2189 |
| 100 | Ga0081540_1047943 | 3300005983 | Bacteria | 2144 |
| 101 | Ga0081540_1059518 | 3300005983 | Bacteria | 1833 |
| 102 | Ga0081540_1064159 | 3300005983 | Bacteria | 1734 |
| 103 | Ga0081540_1082315 | 3300005983 | Bacteria | 1444 |
| 104 | Ga0081540_1105346 | 3300005983 | Bacteria | 1205 |
| 105 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 106 | Ga0075365_10080588 | 3300006038 | Bacteria | 2204 |
| 107 | Ga0075365_10081745 | 3300006038 | Bacteria | 2190 |
| 108 | Ga0075363_100023998 | 3300006048 | Bacteria | 3097 |
| 109 | Ga0075363_100114755 | 3300006048 | Bacteria | 1500 |
| 110 | Ga0075363_100159599 | 3300006048 | Bacteria | 1276 |
| 111 | Ga0070716_100011407 | 3300006173 | Bacteria | 4473 |
| 112 | Ga0070716_100386896 | 3300006173 | Bacteria | 1001 |
| 113 | Ga0070712_100056386 | 3300006175 | Bacteria | 2756 |
| 114 | Ga0070712_100174541 | 3300006175 | Bacteria | 1670 |
| 115 | Ga0075362_10013528 | 3300006177 | Bacteria | 3269 |
| 116 | Ga0075362_10014315 | 3300006177 | Bacteria | 3198 |
| 117 | Ga0075362_10194877 | 3300006177 | Bacteria | 985 |
| 118 | Ga0075367_10009837 | 3300006178 | Bacteria | 5010 |
| 119 | Ga0075367_10176499 | 3300006178 | Bacteria | 1331 |
| 120 | Ga0075367_10176815 | 3300006178 | Bacteria | 1330 |
| 121 | Ga0075369_10004647 | 3300006186 | Bacteria | 5092 |
| 122 | Ga0075369_10071047 | 3300006186 | Bacteria | 1532 |
| 123 | Ga0075369_10137584 | 3300006186 | Bacteria | 1112 |
| 124 | Ga0075366_10024023 | 3300006195 | Bacteria | 3554 |
| 125 | Ga0097621_100197921 | 3300006237 | Bacteria | 1743 |
| 126 | Ga0097621_100484999 | 3300006237 | Bacteria | 1118 |
| 127 | Ga0075370_10031353 | 3300006353 | Bacteria | 2967 |
| 128 | Ga0075370_10283004 | 3300006353 | Bacteria | 985 |
| 129 | Ga0068871_100139043 | 3300006358 | Bacteria | 2064 |
| 130 | Ga0075428_100440920 | 3300006844 | Bacteria | 1395 |
| 131 | Ga0075433_10007299 | 3300006852 | Bacteria | 8766 |
| 132 | Ga0075434_100011869 | 3300006871 | Bacteria | 8235 |
| 133 | Ga0075434_100187476 | 3300006871 | Bacteria | 2089 |
| 134 | Ga0068865_100248066 | 3300006881 | Bacteria | 1404 |
| 135 | Ga0068865_100341054 | 3300006881 | Bacteria | 1211 |
| 136 | Ga0068865_100382044 | 3300006881 | Bacteria | 1149 |
| 137 | Ga0097620_100249719 | 3300006931 | Bacteria | 1864 |
| 138 | Ga0099823_1016936 | 3300006944 | Bacteria | 7127 |
| 139 | Ga0099823_1018785 | 3300006944 | Bacteria | 6648 |
| 140 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 141 | Ga0099795_10065222 | 3300007788 | Bacteria | 1361 |
| 142 | Ga0099795_10104886 | 3300007788 | Bacteria | 1113 |
| 143 | Ga0105251_10016616 | 3300009011 | Bacteria | 3968 |
| 144 | Ga0105251_10021512 | 3300009011 | Bacteria | 3365 |
| 145 | Ga0105250_10010707 | 3300009092 | Bacteria | 3817 |
| 146 | Ga0111539_10891516 | 3300009094 | Bacteria | 1035 |
| 147 | Ga0105245_10049804 | 3300009098 | Bacteria | 3752 |
| 148 | Ga0105245_10079949 | 3300009098 | Bacteria | 2986 |
| 149 | Ga0105245_10230938 | 3300009098 | Bacteria | 1789 |
| 150 | Ga0105245_10404395 | 3300009098 | Bacteria | 1365 |
| 151 | Ga0105247_10257099 | 3300009101 | Bacteria | 1196 |
| 152 | Ga0105247_10325575 | 3300009101 | Bacteria | 1074 |
| 153 | Ga0114129_10196308 | 3300009147 | Bacteria | 2736 |
| 154 | Ga0105243_10179674 | 3300009148 | Bacteria | 1839 |
| 155 | Ga0105243_10336116 | 3300009148 | Bacteria | 1382 |
| 156 | Ga0105243_10387330 | 3300009148 | Bacteria | 1295 |
| 157 | Ga0105243_10621299 | 3300009148 | Bacteria | 1043 |
| 158 | Ga0105241_10035047 | 3300009174 | Bacteria | 3774 |
| 159 | Ga0105241_10064819 | 3300009174 | Bacteria | 2822 |
| 160 | Ga0105242_10084686 | 3300009176 | Bacteria | 2657 |
| 161 | Ga0105242_10362484 | 3300009176 | Bacteria | 1342 |
| 162 | Ga0105248_10034058 | 3300009177 | Bacteria | 5693 |
| 163 | Ga0105248_10054096 | 3300009177 | Bacteria | 4501 |
| 164 | Ga0105248_10194397 | 3300009177 | Bacteria | 2286 |
| 165 | Ga0105237_10030235 | 3300009545 | Bacteria | 5503 |
| 166 | Ga0105237_10130535 | 3300009545 | Bacteria | 2507 |
| 167 | Ga0105237_10231480 | 3300009545 | Bacteria | 1849 |
| 168 | Ga0105237_10264745 | 3300009545 | Bacteria | 1722 |
| 169 | Ga0105237_10518106 | 3300009545 | Bacteria | 1199 |
| 170 | Ga0105238_10289878 | 3300009551 | Bacteria | 1619 |
| 171 | Ga0105238_10874636 | 3300009551 | Bacteria | 916 |
| 172 | Ga0105249_10074635 | 3300009553 | Bacteria | 3139 |
| 173 | Ga0105249_10302474 | 3300009553 | Bacteria | 1605 |
| 174 | Ga0105249_10889471 | 3300009553 | Bacteria | 957 |
| 175 | Ga0099796_10046893 | 3300010159 | Bacteria | 1485 |
| 176 | Ga0105239_10011851 | 3300010375 | Bacteria | 9727 |
| 177 | Ga0105239_10012140 | 3300010375 | Bacteria | 9606 |
| 178 | Ga0105239_10075944 | 3300010375 | Bacteria | 3695 |
| 179 | Ga0105239_10421767 | 3300010375 | Bacteria | 1512 |
| 180 | Ga0105246_10083115 | 3300011119 | Bacteria | 2287 |
| 181 | Ga0105246_10098459 | 3300011119 | Bacteria | 2124 |
| 182 | Ga0105246_10191172 | 3300011119 | Bacteria | 1584 |
| 183 | Ga0105246_10501948 | 3300011119 | Bacteria | 1030 |
| 184 | Ga0157370_10027578 | 3300013104 | Bacteria | 5599 |
| 185 | Ga0157370_10168772 | 3300013104 | Bacteria | 2034 |
| 186 | Ga0157374_10080954 | 3300013296 | Bacteria | 3081 |
| 187 | Ga0157374_10258654 | 3300013296 | Bacteria | 1714 |
| 188 | Ga0163162_10124775 | 3300013306 | Bacteria | 2680 |
| 189 | Ga0163162_10141115 | 3300013306 | Bacteria | 2523 |
| 190 | Ga0157375_10018732 | 3300013308 | Bacteria | 6282 |
| 191 | Ga0157375_10112761 | 3300013308 | Bacteria | 2820 |
| 192 | Ga0157375_10255364 | 3300013308 | Bacteria | 1914 |
| 193 | Ga0157375_10422745 | 3300013308 | Bacteria | 1499 |
| 194 | Ga0163163_10174349 | 3300014325 | Bacteria | 2197 |
| 195 | Ga0163163_10175381 | 3300014325 | Bacteria | 2190 |
| 196 | Ga0163163_10214567 | 3300014325 | Bacteria | 1974 |
| 197 | Ga0163163_10333207 | 3300014325 | Bacteria | 1572 |
| 198 | Ga0157380_10340015 | 3300014326 | Bacteria | 1400 |
| 199 | Ga0157380_10461206 | 3300014326 | Bacteria | 1223 |
| 200 | Ga0157377_10160862 | 3300014745 | Bacteria | 1396 |
| 201 | Ga0157377_10203701 | 3300014745 | Bacteria | 1258 |
| 202 | Ga0157379_10780084 | 3300014968 | Bacteria | 901 |
| 203 | Ga0157376_10019174 | 3300014969 | Bacteria | 5264 |
| 204 | Ga0157376_10143567 | 3300014969 | Bacteria | 2144 |
| 205 | Ga0157376_10667290 | 3300014969 | Bacteria | 1042 |
| 206 | Ga0182007_10000608 | 3300015262 | Bacteria | 20908 |
| 207 | Ga0182005_1014887 | 3300015265 | Bacteria | 2174 |
| 208 | Ga0163161_10053658 | 3300017792 | Bacteria | 2924 |
| 209 | Ga0163161_10059876 | 3300017792 | Bacteria | 2770 |
| 210 | Ga0163161_10207646 | 3300017792 | Bacteria | 1512 |
| 211 | Ga0214542_1027346 | 3300021321 | Bacteria | 2626 |
| 212 | Ga0214543_1001580 | 3300021327 | Bacteria | 44273 |
| 213 | Ga0213872_10000907 | 3300021361 | Bacteria | 21260 |
| 214 | Ga0213872_10001086 | 3300021361 | Bacteria | 18698 |
| 215 | Ga0213872_10001611 | 3300021361 | Bacteria | 14275 |
| 216 | Ga0213872_10001866 | 3300021361 | Bacteria | 13028 |
| 217 | Ga0213872_10028434 | 3300021361 | Bacteria | 2563 |
| 218 | Ga0213872_10104833 | 3300021361 | Bacteria | 1258 |
| 219 | Ga0209672_100035 | 3300025228 | Bacteria | 303111 |
| 220 | Ga0209147_100041 | 3300025229 | Bacteria | 303111 |
| 221 | Ga0209147_100156 | 3300025229 | Bacteria | 93105 |
| 222 | Ga0209437_100858 | 3300025233 | Bacteria | 12861 |
| 223 | Ga0209258_100063 | 3300025242 | Bacteria | 303577 |
| 224 | Ga0209148_1000088 | 3300025254 | Bacteria | 258188 |
| 225 | Ga0209233_1000584 | 3300025261 | Bacteria | 19289 |
| 226 | Ga0209233_1001106 | 3300025261 | Bacteria | 11025 |
| 227 | Ga0209233_1010556 | 3300025261 | Bacteria | 2761 |
| 228 | Ga0209565_1000201 | 3300025263 | Bacteria | 71408 |
| 229 | Ga0209565_1006577 | 3300025263 | Bacteria | 3245 |
| 230 | Ga0209455_1000075 | 3300025272 | Bacteria | 285430 |
| 231 | Ga0209455_1002576 | 3300025272 | Bacteria | 6913 |
| 232 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 233 | Ga0209673_1000061 | 3300025273 | Bacteria | 262274 |
| 234 | Ga0209130_1000154 | 3300025284 | Bacteria | 102645 |
| 235 | Ga0209130_1000409 | 3300025284 | Bacteria | 46757 |
| 236 | Ga0209130_1006540 | 3300025284 | Bacteria | 3766 |
| 237 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 238 | Ga0209675_1000167 | 3300025291 | Bacteria | 79477 |
| 239 | Ga0209675_1007498 | 3300025291 | Bacteria | 4174 |
| 240 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 241 | Ga0209676_1005963 | 3300025292 | Bacteria | 6163 |
| 242 | Ga0209025_1000032 | 3300025294 | Bacteria | 416141 |
| 243 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 244 | Ga0209025_1001002 | 3300025294 | Bacteria | 41890 |
| 245 | Ga0209025_1008061 | 3300025294 | Bacteria | 7670 |
| 246 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 247 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 248 | Ga0209564_1000240 | 3300025295 | Bacteria | 118922 |
| 249 | Ga0209564_1000434 | 3300025295 | Bacteria | 72534 |
| 250 | Ga0209564_1000578 | 3300025295 | Bacteria | 58027 |
| 251 | Ga0209564_1003386 | 3300025295 | Bacteria | 10994 |
| 252 | Ga0209564_1004064 | 3300025295 | Bacteria | 9225 |
| 253 | Ga0209564_1019204 | 3300025295 | Bacteria | 2566 |
| 254 | Ga0209758_1000868 | 3300025297 | Bacteria | 41599 |
| 255 | Ga0209050_1019218 | 3300025298 | Bacteria | 2608 |
| 256 | Ga0209256_1000052 | 3300025299 | Bacteria | 299374 |
| 257 | Ga0209256_1000801 | 3300025299 | Bacteria | 40223 |
| 258 | Ga0209256_1009401 | 3300025299 | Bacteria | 4296 |
| 259 | Ga0207426_1000269 | 3300025302 | Bacteria | 109050 |
| 260 | Ga0207426_1000286 | 3300025302 | Bacteria | 102853 |
| 261 | Ga0207426_1000439 | 3300025302 | Bacteria | 67107 |
| 262 | Ga0209051_1015854 | 3300025303 | Bacteria | 3449 |
| 263 | Ga0209257_1005525 | 3300025304 | Bacteria | 8814 |
| 264 | Ga0209257_1012653 | 3300025304 | Bacteria | 3867 |
| 265 | Ga0207697_10053949 | 3300025315 | Bacteria | 1665 |
| 266 | Ga0207697_10059965 | 3300025315 | Bacteria | 1582 |
| 267 | Ga0207713_1055515 | 3300025735 | Bacteria | 1545 |
| 268 | Ga0207692_10001498 | 3300025898 | Bacteria | 8769 |
| 269 | Ga0207688_10060451 | 3300025901 | Bacteria | 2134 |
| 270 | Ga0207688_10063154 | 3300025901 | Bacteria | 2089 |
| 271 | Ga0207688_10078029 | 3300025901 | Bacteria | 1888 |
| 272 | Ga0207647_10024012 | 3300025904 | Bacteria | 4023 |
| 273 | Ga0207647_10253591 | 3300025904 | Bacteria | 1008 |
| 274 | Ga0207685_10104914 | 3300025905 | Bacteria | 1215 |
| 275 | Ga0207699_10001209 | 3300025906 | Bacteria | 12241 |
| 276 | Ga0207699_10229295 | 3300025906 | Bacteria | 1271 |
| 277 | Ga0207645_10081665 | 3300025907 | Bacteria | 2072 |
| 278 | Ga0207684_10296148 | 3300025910 | Bacteria | 1395 |
| 279 | Ga0207654_10066590 | 3300025911 | Bacteria | 2125 |
| 280 | Ga0207707_10162591 | 3300025912 | Bacteria | 1952 |
| 281 | Ga0207695_10154144 | 3300025913 | Bacteria | 2233 |
| 282 | Ga0207671_10222242 | 3300025914 | Bacteria | 1480 |
| 283 | Ga0207693_10021080 | 3300025915 | Bacteria | 5180 |
| 284 | Ga0207693_10032038 | 3300025915 | Bacteria | 4151 |
| 285 | Ga0207693_10174175 | 3300025915 | Bacteria | 1693 |
| 286 | Ga0207693_10201893 | 3300025915 | Bacteria | 1563 |
| 287 | Ga0207693_10344303 | 3300025915 | Bacteria | 1167 |
| 288 | Ga0207663_10001932 | 3300025916 | Bacteria | 9814 |
| 289 | Ga0207663_10124266 | 3300025916 | Bacteria | 1772 |
| 290 | Ga0207649_10093549 | 3300025920 | Bacteria | 1973 |
| 291 | Ga0207694_10080092 | 3300025924 | Bacteria | 2563 |
| 292 | Ga0207650_10479750 | 3300025925 | Bacteria | 1038 |
| 293 | Ga0207687_10025333 | 3300025927 | Bacteria | 3970 |
| 294 | Ga0207687_10110474 | 3300025927 | Bacteria | 2039 |
| 295 | Ga0207687_10221890 | 3300025927 | Bacteria | 1489 |
| 296 | Ga0207700_10058522 | 3300025928 | Bacteria | 2911 |
| 297 | Ga0207664_10050921 | 3300025929 | Bacteria | 3268 |
| 298 | Ga0207644_10126042 | 3300025931 | Bacteria | 1955 |
| 299 | Ga0207706_10005893 | 3300025933 | Bacteria | 11399 |
| 300 | Ga0207686_10137816 | 3300025934 | Bacteria | 1682 |
| 301 | Ga0207686_10299409 | 3300025934 | Bacteria | 1194 |
| 302 | Ga0207709_10116283 | 3300025935 | Bacteria | 1798 |
| 303 | Ga0207709_10306939 | 3300025935 | Bacteria | 1182 |
| 304 | Ga0207665_10019548 | 3300025939 | Bacteria | 4454 |
| 305 | Ga0207665_10234163 | 3300025939 | Bacteria | 1351 |
| 306 | Ga0207691_10227241 | 3300025940 | Bacteria | 1617 |
| 307 | Ga0207691_10312468 | 3300025940 | Bacteria | 1348 |
| 308 | Ga0207711_10048075 | 3300025941 | Bacteria | 3649 |
| 309 | Ga0207711_10141715 | 3300025941 | Bacteria | 2163 |
| 310 | Ga0207711_10404783 | 3300025941 | Bacteria | 1268 |
| 311 | Ga0207689_10005976 | 3300025942 | Bacteria | 10768 |
| 312 | Ga0207689_10204640 | 3300025942 | Bacteria | 1630 |
| 313 | Ga0207689_10206622 | 3300025942 | Bacteria | 1622 |
| 314 | Ga0207667_10061099 | 3300025949 | Bacteria | 3943 |
| 315 | Ga0207712_10256372 | 3300025961 | Bacteria | 1416 |
| 316 | Ga0207712_10441389 | 3300025961 | Bacteria | 1102 |
| 317 | Ga0207668_10007990 | 3300025972 | Bacteria | 6296 |
| 318 | Ga0207668_10123377 | 3300025972 | Bacteria | 1965 |
| 319 | Ga0207668_10206681 | 3300025972 | Bacteria | 1567 |
| 320 | Ga0207658_10119941 | 3300025986 | Bacteria | 2095 |
| 321 | Ga0207703_10166302 | 3300026035 | Bacteria | 1936 |
| 322 | Ga0207703_10168249 | 3300026035 | Bacteria | 1926 |
| 323 | Ga0207703_10231864 | 3300026035 | Bacteria | 1655 |
| 324 | Ga0207678_10053206 | 3300026067 | Bacteria | 3490 |
| 325 | Ga0207678_10118746 | 3300026067 | Bacteria | 2257 |
| 326 | Ga0207678_10288341 | 3300026067 | Bacteria | 1410 |
| 327 | Ga0207708_10005744 | 3300026075 | Bacteria | 9168 |
| 328 | Ga0207708_10021747 | 3300026075 | Bacteria | 4840 |
| 329 | Ga0207708_10145077 | 3300026075 | Bacteria | 1865 |
| 330 | Ga0207708_10339450 | 3300026075 | Bacteria | 1230 |
| 331 | Ga0207641_10312969 | 3300026088 | Bacteria | 1487 |
| 332 | Ga0207641_10420258 | 3300026088 | Bacteria | 1287 |
| 333 | Ga0207648_10598162 | 3300026089 | Bacteria | 1016 |
| 334 | Ga0207648_10659761 | 3300026089 | Bacteria | 967 |
| 335 | Ga0207676_10264548 | 3300026095 | Bacteria | 1554 |
| 336 | Ga0207674_10208086 | 3300026116 | Bacteria | 1905 |
| 337 | Ga0207675_100045363 | 3300026118 | Bacteria | 4107 |
| 338 | Ga0207675_100115548 | 3300026118 | Bacteria | 2536 |
| 339 | Ga0207683_10073252 | 3300026121 | Bacteria | 3030 |
| 340 | Ga0207683_10088006 | 3300026121 | Bacteria | 2763 |
| 341 | Ga0207683_10090469 | 3300026121 | Bacteria | 2725 |
| 342 | Ga0207683_10121405 | 3300026121 | Bacteria | 2346 |
| 343 | Ga0207698_10306334 | 3300026142 | Bacteria | 1481 |
| 344 | Ga0209389_1008948 | 3300027296 | Bacteria | 8938 |
| 345 | Ga0209389_1010024 | 3300027296 | Bacteria | 8516 |
| 346 | Ga0209371_1000179 | 3300027312 | Bacteria | 93861 |
| 347 | Ga0209589_1000676 | 3300027357 | Bacteria | 49982 |
| 348 | Ga0209489_100062 | 3300027361 | Bacteria | 145478 |
| 349 | Ga0209489_111509 | 3300027361 | Bacteria | 8938 |
| 350 | Ga0209489_111839 | 3300027361 | Bacteria | 8516 |
| 351 | Ga0209700_110927 | 3300027363 | Bacteria | 8938 |
| 352 | Ga0209700_111242 | 3300027363 | Bacteria | 8516 |
| 353 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 354 | Ga0209588_1014646 | 3300027671 | Bacteria | 2403 |
| 355 | Ga0268266_10009304 | 3300028379 | Bacteria | 8665 |
| 356 | Ga0268266_10193947 | 3300028379 | Bacteria | 1856 |
| 357 | Ga0268265_10005524 | 3300028380 | Bacteria | 8627 |
| 358 | Ga0268265_10139082 | 3300028380 | Bacteria | 2030 |
| 359 | Ga0268265_10243572 | 3300028380 | Bacteria | 1588 |
| 360 | Ga0268264_10367337 | 3300028381 | Bacteria | 1374 |
| 361 | Ga0268264_10368601 | 3300028381 | Bacteria | 1372 |
| 362 | Ga0307515_10000160 | 3300028794 | Bacteria | 164789 |
| 363 | Ga0268256_1000149 | 3300030500 | Bacteria | 93861 |
| 364 | Ga0307513_10326741 | 3300031456 | Bacteria | 1290 |
| 365 | Ga0307516_10310350 | 3300031730 | Bacteria | 1251 |
| 366 | Ga0307510_10010555 | 3300033180 | Bacteria | 10973 |
| 367 | Ga0307510_10052806 | 3300033180 | Bacteria | 4279 |
| 368 | Ga0307510_10209592 | 3300033180 | Bacteria | 1473 |
| 369 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 370 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 371 | Ga0373940_0014228 | 3300035088 | Bacteria | 1938 |
| 372 | Ga0373952_0009842 | 3300035092 | Bacteria | 1838 |
| 373 | Ga0373932_0041064 | 3300035112 | Bacteria | 1335 |
| 374 | Ga0373945_0098173 | 3300035116 | Bacteria | 1143 |
| 375 | Ga0373960_0004154 | 3300035121 | Bacteria | 3308 |
| 376 | Ga0373943_0050055 | 3300035170 | Bacteria | 2052 |
| 377 | Ga0373942_0053073 | 3300035207 | Bacteria | 1142 |
| 378 | Ga0373961_0076659 | 3300035241 | Bacteria | 1044 |
| 379 | Ga0373931_0002876 | 3300035691 | Bacteria | 7672 |
| 380 | Ga0373931_0140751 | 3300035691 | Bacteria | 1397 |
| 381 | Ga0373927_0005782 | 3300035695 | Bacteria | 8489 |
| 382 | Ga0373927_0016306 | 3300035695 | Bacteria | 4902 |
| 383 | Ga0373947_0004169 | 3300035725 | Bacteria | 8492 |
| 384 | Ga0373947_0037380 | 3300035725 | Bacteria | 2881 |
| 385 | Ga0373925_0062663 | 3300037068 | Bacteria | 2797 |
| 386 | Ga0395905_0031525 | 3300037471 | Bacteria | 4991 |
| 387 | Ga0395905_0280648 | 3300037471 | Bacteria | 1552 |
| 388 | Ga0436365_0913976 | 3300039437 | Bacteria | 2063 |
| 389 | Ga0436365_0931078 | 3300039437 | Bacteria | 2910 |
| 390 | Ga0436365_1178230 | 3300039437 | Bacteria | 1949 |
| 391 | Ga0436365_1769494 | 3300039437 | Bacteria | 1192 |
| 392 | Ga0436360_0148226 | 3300039438 | Bacteria | 1326 |
| 393 | Ga0436360_0731023 | 3300039438 | Bacteria | 1774 |
| 394 | Ga0436360_1020232 | 3300039438 | Bacteria | 2296 |
| 395 | Ga0436361_0082970 | 3300039447 | Bacteria | 8400 |
| 396 | Ga0436361_0091951 | 3300039447 | Bacteria | 10819 |
| 397 | Ga0436361_0096149 | 3300039447 | Bacteria | 15910 |
| 398 | Ga0436361_0201274 | 3300039447 | Bacteria | 3163 |
| 399 | Ga0436361_0204659 | 3300039447 | Bacteria | 10676 |
| 400 | Ga0436361_0262026 | 3300039447 | Bacteria | 30890 |
| 401 | Ga0436361_0277135 | 3300039447 | Bacteria | 3682 |
| 402 | Ga0436361_0681104 | 3300039447 | Bacteria | 24321 |
| 403 | Ga0436361_0796193 | 3300039447 | Bacteria | 1244 |
| 404 | Ga0436361_0827273 | 3300039447 | Bacteria | 14015 |
| 405 | Ga0436361_1011321 | 3300039447 | Bacteria | 1200 |
| 406 | Ga0436361_1085489 | 3300039447 | Bacteria | 1823 |
| 407 | Ga0436363_0540076 | 3300039450 | Bacteria | 1167 |
| 408 | Ga0436362_0514368 | 3300039453 | Bacteria | 2928 |
| 409 | Ga0439452_033630 | 3300042010 | Bacteria | 1244 |
| 410 | Ga0466964_0027182 | 3300044706 | Bacteria | 2245 |
| 411 | Ga0466960_0055738 | 3300044901 | Bacteria | 1923 |
| 412 | Ga0466967_0312108 | 3300045976 | Bacteria | 1515 |
| 413 | Ga0495603_0006194 | 3300046455 | Bacteria | 7154 |
| 414 | Ga0495603_0177132 | 3300046455 | Bacteria | 1234 |
| 415 | Ga0495591_000251 | 3300046458 | Bacteria | 51890 |
| 416 | Ga0495638_0007874 | 3300046460 | Bacteria | 7603 |
| 417 | Ga0495641_0034815 | 3300046461 | Bacteria | 2378 |
| 418 | Ga0495650_0051104 | 3300046471 | Bacteria | 1705 |
| 419 | Ga0495580_0262535 | 3300046472 | Bacteria | 1181 |
| 420 | Ga0495605_0018977 | 3300046474 | Bacteria | 3680 |
| 421 | Ga0495605_0031954 | 3300046474 | Bacteria | 2684 |
| 422 | Ga0495605_0047395 | 3300046474 | Bacteria | 2108 |
| 423 | Ga0495605_0047792 | 3300046474 | Unclassified | 2097 |
| 424 | Ga0495664_0400051 | 3300046477 | Bacteria | 825 |
| 425 | Ga0495584_0000007 | 3300046491 | Bacteria | 294820 |
| 426 | Ga0495584_0000018 | 3300046491 | Bacteria | 142382 |
| 427 | Ga0495584_0000901 | 3300046491 | Bacteria | 19022 |
| 428 | Ga0495585_0000003 | 3300046492 | Bacteria | 406344 |
| 429 | Ga0495585_0000264 | 3300046492 | Bacteria | 52455 |
| 430 | Ga0495585_0001279 | 3300046492 | Bacteria | 20094 |
| 431 | Ga0495585_0006146 | 3300046492 | Bacteria | 7492 |
| 432 | Ga0495585_0020057 | 3300046492 | Bacteria | 3846 |
| 433 | Ga0495596_0001236 | 3300046500 | Bacteria | 14883 |
| 434 | Ga0495596_0005439 | 3300046500 | Bacteria | 6016 |
| 435 | Ga0495596_0077643 | 3300046500 | Bacteria | 1289 |
| 436 | Ga0495607_0007789 | 3300046501 | Bacteria | 7373 |
| 437 | Ga0495607_0030451 | 3300046501 | Bacteria | 3313 |
| 438 | Ga0495583_0001238 | 3300046506 | Bacteria | 27122 |
| 439 | Ga0495583_0004255 | 3300046506 | Bacteria | 10381 |
| 440 | Ga0495583_0008979 | 3300046506 | Bacteria | 6028 |
| 441 | Ga0495583_0039461 | 3300046506 | Bacteria | 2224 |
| 442 | Ga0495606_0001356 | 3300046507 | Bacteria | 33234 |
| 443 | Ga0495606_0002146 | 3300046507 | Bacteria | 23772 |
| 444 | Ga0495606_0036483 | 3300046507 | Bacteria | 3347 |
| 445 | Ga0495606_0042940 | 3300046507 | Bacteria | 3020 |
| 446 | Ga0495606_0063805 | 3300046507 | Bacteria | 2347 |
| 447 | Ga0495616_0000228 | 3300046513 | Bacteria | 46105 |
| 448 | Ga0495616_0003233 | 3300046513 | Bacteria | 10486 |
| 449 | Ga0495616_0003675 | 3300046513 | Bacteria | 9798 |
| 450 | Ga0495616_0015489 | 3300046513 | Bacteria | 4240 |
| 451 | Ga0495616_0034720 | 3300046513 | Bacteria | 2616 |
| 452 | Ga0495620_0001264 | 3300046515 | Bacteria | 15433 |
| 453 | Ga0495630_0122386 | 3300046517 | Bacteria | 1974 |
| 454 | Ga0495631_0000090 | 3300046518 | Bacteria | 59264 |
| 455 | Ga0495632_0000681 | 3300046519 | Bacteria | 31033 |
| 456 | Ga0495632_0169762 | 3300046519 | Bacteria | 1003 |
| 457 | Ga0495643_0013974 | 3300046522 | Bacteria | 4786 |
| 458 | Ga0495643_0037229 | 3300046522 | Bacteria | 2670 |
| 459 | Ga0495643_0063433 | 3300046522 | Bacteria | 1954 |
| 460 | Ga0495643_0151802 | 3300046522 | Bacteria | 1147 |
| 461 | Ga0495648_0000171 | 3300046524 | Bacteria | 74494 |
| 462 | Ga0495648_0003560 | 3300046524 | Bacteria | 13627 |
| 463 | Ga0495648_0005173 | 3300046524 | Bacteria | 10916 |
| 464 | Ga0495648_0010240 | 3300046524 | Bacteria | 7161 |
| 465 | Ga0495648_0029940 | 3300046524 | Bacteria | 3606 |
| 466 | Ga0495648_0078434 | 3300046524 | Unclassified | 1888 |
| 467 | Ga0495648_0083356 | 3300046524 | Bacteria | 1812 |
| 468 | Ga0495642_0003682 | 3300046528 | Bacteria | 6015 |
| 469 | Ga0495654_0007039 | 3300046530 | Bacteria | 6331 |
| 470 | Ga0495609_0000566 | 3300046538 | Bacteria | 29042 |
| 471 | Ga0495609_0020794 | 3300046538 | Bacteria | 3029 |
| 472 | Ga0495609_0034901 | 3300046538 | Unclassified | 2278 |
| 473 | Ga0495609_0038300 | 3300046538 | Bacteria | 2162 |
| 474 | Ga0495597_0008221 | 3300046542 | Bacteria | 5244 |
| 475 | Ga0495622_0069563 | 3300046557 | Bacteria | 1625 |
| 476 | Ga0495622_0085362 | 3300046557 | Bacteria | 1452 |
| 477 | Ga0495633_0000702 | 3300046558 | Bacteria | 30531 |
| 478 | Ga0495633_0013203 | 3300046558 | Bacteria | 4362 |
| 479 | Ga0495633_0031351 | 3300046558 | Bacteria | 2578 |
| 480 | Ga0495656_0054638 | 3300046615 | Bacteria | 1719 |
| 481 | Ga0495668_0000094 | 3300046616 | Bacteria | 141412 |
| 482 | Ga0495668_0000129 | 3300046616 | Bacteria | 113044 |
| 483 | Ga0495668_0007639 | 3300046616 | Bacteria | 6883 |
| 484 | Ga0495668_0009157 | 3300046616 | Bacteria | 6101 |
| 485 | Ga0495668_0145382 | 3300046616 | Bacteria | 1298 |
| 486 | Ga0495611_0013495 | 3300046648 | Bacteria | 3479 |
| 487 | Ga0495611_0077769 | 3300046648 | Bacteria | 1522 |
| 488 | Ga0495611_0185090 | 3300046648 | Bacteria | 973 |
| 489 | Ga0495625_0003017 | 3300046660 | Bacteria | 17334 |
| 490 | Ga0495625_0007263 | 3300046660 | Bacteria | 9691 |
| 491 | Ga0495625_0026997 | 3300046660 | Bacteria | 4329 |
| 492 | Ga0495625_0128561 | 3300046660 | Bacteria | 1718 |
| 493 | Ga0495659_0008109 | 3300046664 | Bacteria | 3338 |
| 494 | Ga0495659_0077495 | 3300046664 | Bacteria | 1256 |
| 495 | Ga0495661_0011409 | 3300046665 | Bacteria | 6032 |
| 496 | Ga0495661_0037066 | 3300046665 | Bacteria | 3046 |
| 497 | Ga0495661_0081364 | 3300046665 | Bacteria | 1866 |
| 498 | Ga0495588_0316572 | 3300046674 | Bacteria | 821 |
| 499 | Ga0495669_0035469 | 3300046684 | Bacteria | 2202 |
| 500 | Ga0495670_0000770 | 3300046691 | Bacteria | 15357 |
| 501 | Ga0495671_0004568 | 3300046692 | Bacteria | 8237 |
| 502 | Ga0495671_0011654 | 3300046692 | Bacteria | 4824 |
| 503 | Ga0495671_0013199 | 3300046692 | Bacteria | 4484 |
| 504 | Ga0495671_0036772 | 3300046692 | Bacteria | 2479 |
| 505 | Ga0495671_0270782 | 3300046692 | Bacteria | 819 |
| 506 | Ga0495649_0003412 | 3300046694 | Bacteria | 10738 |
| 507 | Ga0495649_0026960 | 3300046694 | Bacteria | 3190 |
| 508 | Ga0495589_0000033 | 3300046794 | Bacteria | 162794 |
| 509 | Ga0495660_0001774 | 3300046810 | Bacteria | 14278 |
| 510 | Ga0495660_0002528 | 3300046810 | Bacteria | 11661 |
| 511 | Ga0495660_0025127 | 3300046810 | Bacteria | 3385 |
| 512 | Ga0495660_0169777 | 3300046810 | Bacteria | 1063 |
| 513 | Ga0495674_0264219 | 3300047319 | Bacteria | 1413 |
| 514 | Ga0495672_0011421 | 3300047320 | Bacteria | 6269 |
| 515 | Ga0495672_0050386 | 3300047320 | Bacteria | 2457 |
| 516 | Ga0495676_0119583 | 3300047321 | Bacteria | 1919 |
| 517 | Ga0495683_0000083 | 3300047323 | Bacteria | 93743 |
| 518 | Ga0495683_0001589 | 3300047323 | Bacteria | 14641 |
| 519 | Ga0495683_0002730 | 3300047323 | Bacteria | 10522 |
| 520 | Ga0495683_0005834 | 3300047323 | Bacteria | 6775 |
| 521 | Ga0495683_0009551 | 3300047323 | Bacteria | 5167 |
| 522 | Ga0495683_0018287 | 3300047323 | Bacteria | 3626 |
| 523 | Ga0495683_0066995 | 3300047323 | Bacteria | 1768 |
| 524 | Ga0495683_0087202 | 3300047323 | Bacteria | 1516 |
| 525 | Ga0495683_0215841 | 3300047323 | Bacteria | 858 |
| 526 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 527 | Ga0495687_009263 | 3300047443 | Bacteria | 5528 |
| 528 | Ga0495687_084482 | 3300047443 | Bacteria | 1234 |
| 529 | Ga0495679_007526 | 3300047446 | Bacteria | 4526 |
| 530 | Ga0495679_043286 | 3300047446 | Bacteria | 1385 |
| 531 | Ga0495685_000938 | 3300047447 | Bacteria | 8820 |
| 532 | Ga0495685_004641 | 3300047447 | Bacteria | 4454 |
| 533 | Ga0495673_0003848 | 3300047469 | Bacteria | 9682 |
| 534 | Ga0495673_0005900 | 3300047469 | Bacteria | 7314 |
| 535 | Ga0495673_0028679 | 3300047469 | Bacteria | 2634 |
| 536 | Ga0495673_0177686 | 3300047469 | Bacteria | 808 |
| 537 | Ga0495681_0005657 | 3300047470 | Bacteria | 8326 |
| 538 | Ga0495684_0329700 | 3300047471 | Bacteria | 1089 |
| 539 | Ga0495593_0044363 | 3300047673 | Bacteria | 2379 |
| 540 | Ga0495626_0001391 | 3300048091 | Bacteria | 19406 |
| 541 | Ga0496100_0021982 | 3300048903 | Bacteria | 3852 |
| 542 | Ga0496100_0036374 | 3300048903 | Bacteria | 3105 |
| 543 | Ga0496100_0151990 | 3300048903 | Bacteria | 1652 |
| 544 | Ga0496101_0009247 | 3300048904 | Bacteria | 6471 |
| 545 | Ga0496101_0242695 | 3300048904 | Bacteria | 1402 |
| 546 | Ga0496102_0006087 | 3300048905 | Bacteria | 10289 |
| 547 | Ga0496102_0006237 | 3300048905 | Bacteria | 10164 |
| 548 | Ga0496102_0018498 | 3300048905 | Bacteria | 6124 |
| 549 | Ga0496102_0210877 | 3300048905 | Bacteria | 1831 |
| 550 | Ga0496102_0558935 | 3300048905 | Bacteria | 1067 |
| 551 | Ga0496103_0038267 | 3300048906 | Bacteria | 2942 |
| 552 | Ga0496103_0050426 | 3300048906 | Bacteria | 2575 |
| 553 | Ga0496103_0094082 | 3300048906 | Bacteria | 1893 |
| 554 | Ga0496104_0004902 | 3300048907 | Bacteria | 11673 |
| 555 | Ga0496104_0048949 | 3300048907 | Bacteria | 3985 |
| 556 | Ga0496104_0056150 | 3300048907 | Bacteria | 3723 |
| 557 | Ga0496104_0083602 | 3300048907 | Bacteria | 3044 |
| 558 | Ga0496105_0000318 | 3300048908 | Bacteria | 31631 |
| 559 | Ga0496105_0009330 | 3300048908 | Bacteria | 7670 |
| 560 | Ga0496105_0017517 | 3300048908 | Bacteria | 5746 |
| 561 | Ga0496105_0038302 | 3300048908 | Bacteria | 3950 |
| 562 | Ga0496105_0287710 | 3300048908 | Bacteria | 1324 |
| 563 | Ga0496106_0016217 | 3300048909 | Bacteria | 5511 |
| 564 | Ga0496106_0026512 | 3300048909 | Bacteria | 4316 |
| 565 | Ga0496106_0039933 | 3300048909 | Bacteria | 3514 |
| 566 | Ga0496106_0065252 | 3300048909 | Bacteria | 2772 |
| 567 | Ga0496106_0298450 | 3300048909 | Bacteria | 1292 |
| 568 | Ga0496107_0002391 | 3300048910 | Bacteria | 12143 |
| 569 | Ga0496107_0003592 | 3300048910 | Bacteria | 10401 |
| 570 | Ga0496108_0137938 | 3300048911 | Bacteria | 2100 |
| 571 | Ga0496108_0429783 | 3300048911 | Bacteria | 1153 |
| 572 | Ga0496109_0034401 | 3300048912 | Bacteria | 4563 |
| 573 | Ga0496109_0060185 | 3300048912 | Bacteria | 3470 |
| 574 | Ga0496109_0143239 | 3300048912 | Bacteria | 2235 |
| 575 | Ga0496109_0165578 | 3300048912 | Bacteria | 2072 |
| 576 | Ga0496109_0198344 | 3300048912 | Bacteria | 1887 |
| 577 | Ga0496109_0258248 | 3300048912 | Bacteria | 1641 |
| 578 | Ga0496110_0046958 | 3300048913 | Bacteria | 3779 |
| 579 | Ga0496110_0123808 | 3300048913 | Bacteria | 2331 |
| 580 | Ga0496110_0160483 | 3300048913 | Bacteria | 2038 |
| 581 | Ga0496110_0319451 | 3300048913 | Bacteria | 1414 |
| 582 | Ga0496111_0045682 | 3300048914 | Bacteria | 3152 |
| 583 | Ga0496111_0078950 | 3300048914 | Bacteria | 2400 |
| 584 | Ga0496112_0052196 | 3300048915 | Bacteria | 4012 |
| 585 | Ga0496112_0138190 | 3300048915 | Bacteria | 2406 |
| 586 | Ga0496112_0339272 | 3300048915 | Bacteria | 1446 |
| 587 | Ga0496113_0003901 | 3300048916 | Bacteria | 9039 |
| 588 | Ga0496113_0088444 | 3300048916 | Bacteria | 2383 |
| 589 | Ga0496113_0191174 | 3300048916 | Bacteria | 1625 |
| 590 | Ga0496113_0191469 | 3300048916 | Bacteria | 1623 |
| 591 | Ga0496114_0017140 | 3300048917 | Bacteria | 5842 |
| 592 | Ga0496114_0179980 | 3300048917 | Bacteria | 1846 |
| 593 | Ga0496114_0557354 | 3300048917 | Bacteria | 1012 |
| 594 | Ga0496115_0013677 | 3300048918 | Bacteria | 6144 |
| 595 | Ga0496115_0073868 | 3300048918 | Bacteria | 2768 |
| 596 | Ga0496115_0089701 | 3300048918 | Bacteria | 2511 |
| 597 | Ga0496115_0095385 | 3300048918 | Bacteria | 2435 |
| 598 | Ga0496116_0004369 | 3300048919 | Bacteria | 13514 |
| 599 | Ga0496116_0105368 | 3300048919 | Bacteria | 1673 |
| 600 | Ga0496116_0244197 | 3300048919 | Bacteria | 899 |
| 601 | Ga0496117_0002629 | 3300048920 | Bacteria | 22276 |
| 602 | Ga0496117_0055074 | 3300048920 | Bacteria | 2782 |
| 603 | Ga0496117_0094433 | 3300048920 | Bacteria | 1914 |
| 604 | Ga0496117_0141950 | 3300048920 | Bacteria | 1437 |
| 605 | Ga0496118_0000966 | 3300048921 | Bacteria | 44919 |
| 606 | Ga0496118_0031253 | 3300048921 | Bacteria | 4419 |
| 607 | Ga0496118_0044513 | 3300048921 | Bacteria | 3475 |
| 608 | Ga0496118_0054891 | 3300048921 | Bacteria | 3013 |
| 609 | Ga0496118_0104009 | 3300048921 | Bacteria | 1908 |
| 610 | Ga0496119_0016165 | 3300048922 | Bacteria | 5698 |
| 611 | Ga0496119_0023355 | 3300048922 | Bacteria | 4390 |
| 612 | Ga0496120_0013451 | 3300048923 | Bacteria | 5506 |
| 613 | Ga0496121_0002217 | 3300048924 | Bacteria | 30352 |
| 614 | Ga0496121_0015838 | 3300048924 | Bacteria | 7843 |
| 615 | Ga0496121_0137735 | 3300048924 | Bacteria | 1816 |
| 616 | Ga0496121_0262874 | 3300048924 | Bacteria | 1190 |
| 617 | Ga0496121_0317503 | 3300048924 | Bacteria | 1050 |
| 618 | Ga0496122_0000043 | 3300048925 | Bacteria | 280333 |
| 619 | Ga0496122_0000908 | 3300048925 | Bacteria | 54441 |
| 620 | Ga0496123_0000090 | 3300048926 | Bacteria | 179735 |
| 621 | Ga0496123_0000412 | 3300048926 | Bacteria | 78170 |
| 622 | Ga0496123_0020702 | 3300048926 | Bacteria | 5138 |
| 623 | Ga0496123_0096315 | 3300048926 | Bacteria | 1738 |
| 624 | Ga0496124_0180048 | 3300048927 | Bacteria | 1627 |
| 625 | Ga0496125_0000051 | 3300048928 | Bacteria | 285754 |
| 626 | Ga0496125_0311741 | 3300048928 | Bacteria | 958 |
| 627 | Ga0496126_0007725 | 3300048929 | Bacteria | 11734 |
| 628 | Ga0496126_0022164 | 3300048929 | Bacteria | 6187 |
| 629 | Ga0496126_0143739 | 3300048929 | Bacteria | 2051 |
| 630 | Ga0495678_003182 | 3300049459 | Bacteria | 10343 |
| 631 | Ga0495682_0001062 | 3300049460 | Bacteria | 16167 |
| 632 | Ga0495682_0007135 | 3300049460 | Bacteria | 4465 |
| 633 | nmdc:mga03n38_276029_c1 | 3300050490 | Bacteria | 896 |
| 634 | nmdc:mga03n38_45650_c1 | 3300050490 | Bacteria | 1930 |
| 635 | nmdc:mga00v17_62136_c1 | 3300050491 | Bacteria | 2297 |
| 636 | nmdc:mga0k408_154697_c1 | 3300050493 | Bacteria | 1366 |
| 637 | nmdc:mga06z11_158517_c1 | 3300050494 | Bacteria | 1292 |
| 638 | nmdc:mga06z11_21857_c1 | 3300050494 | Bacteria | 2979 |
| 639 | nmdc:mga06z11_357388_c1 | 3300050494 | Bacteria | 875 |
| 640 | nmdc:mga06z11_61061_c1 | 3300050494 | Bacteria | 1965 |
| 641 | nmdc:mga04h51_4538_c1 | 3300050495 | Bacteria | 3466 |
| 642 | nmdc:mga07m45_242283_c1 | 3300050496 | Bacteria | 1049 |
| 643 | nmdc:mga07m45_5932_c1 | 3300050496 | Bacteria | 6131 |
| 644 | nmdc:mga05p37_705158_c1 | 3300050507 | Bacteria | 1120 |
| 645 | nmdc:mga05p37_72341_c1 | 3300050507 | Bacteria | 4242 |
| 646 | nmdc:mga08y16_34670_c1 | 3300050511 | Bacteria | 5302 |
| 647 | nmdc:mga0n895_182164_c1 | 3300050512 | Bacteria | 2132 |
| 648 | nmdc:mga0n895_502_c1 | 3300050512 | Bacteria | 26508 |
| 649 | nmdc:mga0a205_4465_c1 | 3300050515 | Bacteria | 12556 |
| 650 | nmdc:mga0sz30_32577_c1 | 3300050516 | Bacteria | 2162 |
| 651 | nmdc:mga0sz30_53526_c2 | 3300050516 | Bacteria | 1155 |
| 652 | nmdc:mga0sz30_84720_c1 | 3300050516 | Bacteria | 1375 |
| 653 | Ga0500635_0037167 | 3300053080 | Bacteria | 1609 |
| 654 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 655 | Ga0500555_009621 | 3300053103 | Bacteria | 2765 |
| 656 | Ga0500556_0006082 | 3300053104 | Bacteria | 3421 |
| 657 | Ga0500556_0044133 | 3300053104 | Bacteria | 1585 |
| 658 | Ga0500562_003619 | 3300053108 | Bacteria | 3879 |
| 659 | Ga0500569_004065 | 3300053109 | Bacteria | 3047 |
| 660 | Ga0500592_005045 | 3300053116 | Bacteria | 2098 |
| 661 | Ga0500594_0020507 | 3300053118 | Bacteria | 1650 |
| 662 | Ga0500595_003304 | 3300053119 | Bacteria | 7595 |
| 663 | Ga0500642_0078492 | 3300053130 | Bacteria | 1513 |
| 664 | Ga0500564_093306 | 3300053138 | Bacteria | 1338 |
| 665 | Ga0500577_0140046 | 3300053142 | Bacteria | 1020 |
| 666 | Ga0500616_0013901 | 3300053153 | Bacteria | 4647 |
| 667 | Ga0500619_036813 | 3300053154 | Bacteria | 1525 |
| 668 | Ga0500620_021597 | 3300053155 | Bacteria | 1926 |
| 669 | Ga0500622_0025216 | 3300053156 | Bacteria | 3142 |
| 670 | Ga0500627_0038138 | 3300053158 | Bacteria | 2053 |
| 671 | Ga0500633_0013380 | 3300053160 | Bacteria | 2298 |
| 672 | Ga0500638_052038 | 3300053162 | Bacteria | 1979 |
| 673 | Ga0500638_176194 | 3300053162 | Bacteria | 927 |
| 674 | Ga0500636_0000206 | 3300053177 | Bacteria | 31849 |
| 675 | Ga0500636_0155931 | 3300053177 | Bacteria | 1250 |
| 676 | Ga0500637_0125989 | 3300053178 | Bacteria | 1485 |
| 677 | Ga0500645_016121 | 3300053730 | Bacteria | 2358 |
| 678 | Ga0500599_000862 | 3300053736 | Bacteria | 3361 |
| 679 | Ga0500601_000281 | 3300053737 | Bacteria | 9680 |
| 680 | Ga0500661_007848 | 3300055283 | Bacteria | 1968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0002629 | Ga0496117_0002629_8197_9012 | 243 |
| 2 | 3300048921 | Ga0496118_0000966 | Ga0496118_0000966_8154_8969 | 243 |
| 3 | 3300006177 | Ga0075362_10013528 | Ga0075362_100135282 | 249 |
| 4 | 3300005334 | Ga0068869_100435843 | Ga0068869_1004358432 | 250 |
| 5 | 3300005347 | Ga0070668_100113315 | Ga0070668_1001133152 | 250 |
| 6 | 3300005347 | Ga0070668_100311228 | Ga0070668_1003112282 | 250 |
| 7 | 3300005356 | Ga0070674_100597411 | Ga0070674_1005974111 | 250 |
| 8 | 3300005455 | Ga0070663_100292779 | Ga0070663_1002927792 | 250 |
| 9 | 3300005456 | Ga0070678_100501511 | Ga0070678_1005015111 | 250 |
| 10 | 3300005466 | Ga0070685_10148200 | Ga0070685_101482001 | 250 |
| 11 | 3300005617 | Ga0068859_100249718 | Ga0068859_1002497182 | 250 |
| 12 | 3300006881 | Ga0068865_100341054 | Ga0068865_1003410541 | 250 |
| 13 | 3300006931 | Ga0097620_100249719 | Ga0097620_1002497192 | 250 |
| 14 | 3300009098 | Ga0105245_10404395 | Ga0105245_104043952 | 250 |
| 15 | 3300009148 | Ga0105243_10387330 | Ga0105243_103873302 | 250 |
| 16 | 3300009553 | Ga0105249_10074635 | Ga0105249_100746351 | 250 |
| 17 | 3300009553 | Ga0105249_10302474 | Ga0105249_103024742 | 250 |
| 18 | 3300011119 | Ga0105246_10191172 | Ga0105246_101911722 | 250 |
| 19 | 3300013296 | Ga0157374_10258654 | Ga0157374_102586542 | 250 |
| 20 | 3300013306 | Ga0163162_10141115 | Ga0163162_101411152 | 250 |
| 21 | 3300013308 | Ga0157375_10255364 | Ga0157375_102553642 | 250 |
| 22 | 3300014325 | Ga0163163_10174349 | Ga0163163_101743492 | 250 |
| 23 | 3300014326 | Ga0157380_10340015 | Ga0157380_103400152 | 250 |
| 24 | 3300017792 | Ga0163161_10059876 | Ga0163161_100598762 | 250 |
| 25 | 3300025925 | Ga0207650_10479750 | Ga0207650_104797502 | 250 |
| 26 | 3300025927 | Ga0207687_10221890 | Ga0207687_102218902 | 250 |
| 27 | 3300025940 | Ga0207691_10312468 | Ga0207691_103124682 | 250 |
| 28 | 3300025942 | Ga0207689_10204640 | Ga0207689_102046402 | 250 |
| 29 | 3300025961 | Ga0207712_10441389 | Ga0207712_104413891 | 250 |
| 30 | 3300025972 | Ga0207668_10123377 | Ga0207668_101233772 | 250 |
| 31 | 3300025972 | Ga0207668_10206681 | Ga0207668_102066812 | 250 |
| 32 | 3300026035 | Ga0207703_10166302 | Ga0207703_101663022 | 250 |
| 33 | 3300026067 | Ga0207678_10288341 | Ga0207678_102883412 | 250 |
| 34 | 3300026088 | Ga0207641_10420258 | Ga0207641_104202582 | 250 |
| 35 | 3300026121 | Ga0207683_10121405 | Ga0207683_101214052 | 250 |
| 36 | 3300028379 | Ga0268266_10009304 | Ga0268266_100093046 | 250 |
| 37 | 3300028380 | Ga0268265_10243572 | Ga0268265_102435722 | 250 |
| 38 | 3300028381 | Ga0268264_10367337 | Ga0268264_103673372 | 250 |
| 39 | 3300044901 | Ga0466960_0055738 | Ga0466960_0055738_88_846 | 250 |
| 40 | 3300046471 | Ga0495650_0051104 | Ga0495650_0051104_412_1170 | 250 |
| 41 | 3300046474 | Ga0495605_0047395 | Ga0495605_0047395_877_1635 | 250 |
| 42 | 3300046492 | Ga0495585_0020057 | Ga0495585_0020057_647_1405 | 250 |
| 43 | 3300046522 | Ga0495643_0151802 | Ga0495643_0151802_249_1007 | 250 |
| 44 | 3300046538 | Ga0495609_0038300 | Ga0495609_0038300_237_995 | 250 |
| 45 | 3300046558 | Ga0495633_0031351 | Ga0495633_0031351_1222_1980 | 250 |
| 46 | 3300046615 | Ga0495656_0054638 | Ga0495656_0054638_754_1512 | 250 |
| 47 | 3300046616 | Ga0495668_0009157 | Ga0495668_0009157_3988_4746 | 250 |
| 48 | 3300046684 | Ga0495669_0035469 | Ga0495669_0035469_1136_1894 | 250 |
| 49 | 3300047323 | Ga0495683_0066995 | Ga0495683_0066995_884_1642 | 250 |
| 50 | 3300047446 | Ga0495679_043286 | Ga0495679_043286_47_805 | 250 |
| 51 | 3300048909 | Ga0496106_0298450 | Ga0496106_0298450_318_1076 | 250 |
| 52 | 3300048912 | Ga0496109_0198344 | Ga0496109_0198344_541_1299 | 250 |
| 53 | 3300048913 | Ga0496110_0319451 | Ga0496110_0319451_398_1156 | 250 |
| 54 | 3300048918 | Ga0496115_0095385 | Ga0496115_0095385_181_939 | 250 |
| 55 | 3300053118 | Ga0500594_0020507 | Ga0500594_0020507_97_855 | 250 |
| 56 | 3300003775 | Ga0055524_1000014 | Ga0055524_1000014175 | 251 |
| 57 | 3300005356 | Ga0070674_100041548 | Ga0070674_1000415482 | 251 |
| 58 | 3300005456 | Ga0070678_100213961 | Ga0070678_1002139611 | 251 |
| 59 | 3300006237 | Ga0097621_100484999 | Ga0097621_1004849992 | 251 |
| 60 | 3300009148 | Ga0105243_10336116 | Ga0105243_103361162 | 251 |
| 61 | 3300011119 | Ga0105246_10501948 | Ga0105246_105019481 | 251 |
| 62 | 3300013308 | Ga0157375_10112761 | Ga0157375_101127612 | 251 |
| 63 | 3300014325 | Ga0163163_10214567 | Ga0163163_102145672 | 251 |
| 64 | 3300014969 | Ga0157376_10019174 | Ga0157376_100191741 | 251 |
| 65 | 3300025935 | Ga0207709_10306939 | Ga0207709_103069392 | 251 |
| 66 | 3300026075 | Ga0207708_10339450 | Ga0207708_103394502 | 251 |
| 67 | 3300026121 | Ga0207683_10073252 | Ga0207683_100732523 | 251 |
| 68 | 3300046477 | Ga0495664_0400051 | Ga0495664_0400051_16_774 | 251 |
| 69 | 3300048913 | Ga0496110_0160483 | Ga0496110_0160483_986_1744 | 251 |
| 70 | 3300002987 | JGI25159J45721_1000030 | JGI25159J45721_10000306 | 252 |
| 71 | 3300003187 | JGI25151J46595_10001370 | JGI25151J46595_1000137014 | 252 |
| 72 | 3300003187 | JGI25151J46595_10002889 | JGI25151J46595_100028897 | 252 |
| 73 | 3300003214 | JGI25165J46597_1000975 | JGI25165J46597_100097514 | 252 |
| 74 | 3300003320 | rootH2_10065025 | rootH2_100650251 | 252 |
| 75 | 3300003323 | rootH1_10265325 | rootH1_102653253 | 252 |
| 76 | 3300003354 | JGI25160J50197_1000075 | JGI25160J50197_10000756 | 252 |
| 77 | 3300003354 | JGI25160J50197_1000524 | JGI25160J50197_100052420 | 252 |
| 78 | 3300003374 | JGI25161J50226_1000388 | JGI25161J50226_10003884 | 252 |
| 79 | 3300003374 | JGI25161J50226_1000593 | JGI25161J50226_10005938 | 252 |
| 80 | 3300003659 | JGI25404J52841_10000831 | JGI25404J52841_100008313 | 252 |
| 81 | 3300003771 | Ga0055526_1002008 | Ga0055526_100200815 | 252 |
| 82 | 3300003771 | Ga0055526_1008700 | Ga0055526_10087003 | 252 |
| 83 | 3300003771 | Ga0055526_1012200 | Ga0055526_10122004 | 252 |
| 84 | 3300003775 | Ga0055524_1006932 | Ga0055524_10069323 | 252 |
| 85 | 3300003781 | Ga0055536_1005974 | Ga0055536_10059744 | 252 |
| 86 | 3300003784 | Ga0055534_1004256 | Ga0055534_10042563 | 252 |
| 87 | 3300003794 | Ga0055531_10018718 | Ga0055531_100187182 | 252 |
| 88 | 3300004625 | Ga0055543_1000168 | Ga0055543_10001686 | 252 |
| 89 | 3300004625 | Ga0055543_1000449 | Ga0055543_100044923 | 252 |
| 90 | 3300005262 | Ga0065165_1000206 | Ga0065165_10002066 | 252 |
| 91 | 3300005262 | Ga0065165_1001476 | Ga0065165_100147623 | 252 |
| 92 | 3300005341 | Ga0070691_10001016 | Ga0070691_100010167 | 252 |
| 93 | 3300005353 | Ga0070669_100010500 | Ga0070669_1000105007 | 252 |
| 94 | 3300005353 | Ga0070669_100312136 | Ga0070669_1003121362 | 252 |
| 95 | 3300005355 | Ga0070671_100034409 | Ga0070671_1000344093 | 252 |
| 96 | 3300005355 | Ga0070671_100318680 | Ga0070671_1003186801 | 252 |
| 97 | 3300005364 | Ga0070673_100195956 | Ga0070673_1001959562 | 252 |
| 98 | 3300005434 | Ga0070709_10000216 | Ga0070709_1000021635 | 252 |
| 99 | 3300005434 | Ga0070709_10270246 | Ga0070709_102702462 | 252 |
| 100 | 3300005436 | Ga0070713_100050867 | Ga0070713_1000508673 | 252 |
| 101 | 3300005437 | Ga0070710_10003345 | Ga0070710_100033453 | 252 |
| 102 | 3300005437 | Ga0070710_10272384 | Ga0070710_102723841 | 252 |
| 103 | 3300005439 | Ga0070711_100014513 | Ga0070711_1000145133 | 252 |
| 104 | 3300005439 | Ga0070711_100103366 | Ga0070711_1001033662 | 252 |
| 105 | 3300005439 | Ga0070711_100190094 | Ga0070711_1001900941 | 252 |
| 106 | 3300005441 | Ga0070700_100004033 | Ga0070700_1000040333 | 252 |
| 107 | 3300005441 | Ga0070700_100194720 | Ga0070700_1001947201 | 252 |
| 108 | 3300005444 | Ga0070694_100124957 | Ga0070694_1001249571 | 252 |
| 109 | 3300005455 | Ga0070663_100151170 | Ga0070663_1001511701 | 252 |
| 110 | 3300005457 | Ga0070662_100085523 | Ga0070662_1000855232 | 252 |
| 111 | 3300005467 | Ga0070706_100201010 | Ga0070706_1002010104 | 252 |
| 112 | 3300005518 | Ga0070699_100055039 | Ga0070699_1000550396 | 252 |
| 113 | 3300005545 | Ga0070695_100000381 | Ga0070695_10000038122 | 252 |
| 114 | 3300005546 | Ga0070696_100170054 | Ga0070696_1001700542 | 252 |
| 115 | 3300005614 | Ga0068856_100115164 | Ga0068856_1001151641 | 252 |
| 116 | 3300005614 | Ga0068856_100824728 | Ga0068856_1008247281 | 252 |
| 117 | 3300005618 | Ga0068864_100482899 | Ga0068864_1004828992 | 252 |
| 118 | 3300005719 | Ga0068861_100025826 | Ga0068861_1000258262 | 252 |
| 119 | 3300005841 | Ga0068863_100684527 | Ga0068863_1006845271 | 252 |
| 120 | 3300005842 | Ga0068858_100422023 | Ga0068858_1004220232 | 252 |
| 121 | 3300005843 | Ga0068860_100271287 | Ga0068860_1002712872 | 252 |
| 122 | 3300005844 | Ga0068862_100717787 | Ga0068862_1007177871 | 252 |
| 123 | 3300005937 | Ga0081455_10015097 | Ga0081455_100150973 | 252 |
| 124 | 3300005983 | Ga0081540_1001168 | Ga0081540_10011688 | 252 |
| 125 | 3300005983 | Ga0081540_1001292 | Ga0081540_100129223 | 252 |
| 126 | 3300005983 | Ga0081540_1001561 | Ga0081540_100156121 | 252 |
| 127 | 3300005983 | Ga0081540_1004935 | Ga0081540_10049357 | 252 |
| 128 | 3300005983 | Ga0081540_1010233 | Ga0081540_10102338 | 252 |
| 129 | 3300005983 | Ga0081540_1024995 | Ga0081540_10249954 | 252 |
| 130 | 3300005983 | Ga0081540_1037124 | Ga0081540_10371241 | 252 |
| 131 | 3300005983 | Ga0081540_1046539 | Ga0081540_10465394 | 252 |
| 132 | 3300005983 | Ga0081540_1059518 | Ga0081540_10595183 | 252 |
| 133 | 3300005983 | Ga0081540_1082315 | Ga0081540_10823153 | 252 |
| 134 | 3300005983 | Ga0081540_1105346 | Ga0081540_11053462 | 252 |
| 135 | 3300006038 | Ga0075365_10080588 | Ga0075365_100805881 | 252 |
| 136 | 3300006038 | Ga0075365_10081745 | Ga0075365_100817452 | 252 |
| 137 | 3300006048 | Ga0075363_100023998 | Ga0075363_1000239984 | 252 |
| 138 | 3300006048 | Ga0075363_100114755 | Ga0075363_1001147551 | 252 |
| 139 | 3300006048 | Ga0075363_100159599 | Ga0075363_1001595992 | 252 |
| 140 | 3300006173 | Ga0070716_100011407 | Ga0070716_1000114074 | 252 |
| 141 | 3300006175 | Ga0070712_100056386 | Ga0070712_1000563864 | 252 |
| 142 | 3300006175 | Ga0070712_100174541 | Ga0070712_1001745413 | 252 |
| 143 | 3300006177 | Ga0075362_10014315 | Ga0075362_100143153 | 252 |
| 144 | 3300006177 | Ga0075362_10194877 | Ga0075362_101948771 | 252 |
| 145 | 3300006178 | Ga0075367_10009837 | Ga0075367_100098378 | 252 |
| 146 | 3300006178 | Ga0075367_10176499 | Ga0075367_101764991 | 252 |
| 147 | 3300006178 | Ga0075367_10176815 | Ga0075367_101768152 | 252 |
| 148 | 3300006186 | Ga0075369_10004647 | Ga0075369_100046474 | 252 |
| 149 | 3300006186 | Ga0075369_10071047 | Ga0075369_100710474 | 252 |
| 150 | 3300006186 | Ga0075369_10137584 | Ga0075369_101375842 | 252 |
| 151 | 3300006195 | Ga0075366_10024023 | Ga0075366_100240234 | 252 |
| 152 | 3300006237 | Ga0097621_100197921 | Ga0097621_1001979213 | 252 |
| 153 | 3300006353 | Ga0075370_10031353 | Ga0075370_100313533 | 252 |
| 154 | 3300006844 | Ga0075428_100440920 | Ga0075428_1004409202 | 252 |
| 155 | 3300006852 | Ga0075433_10007299 | Ga0075433_1000729911 | 252 |
| 156 | 3300006871 | Ga0075434_100011869 | Ga0075434_1000118693 | 252 |
| 157 | 3300006871 | Ga0075434_100187476 | Ga0075434_1001874762 | 252 |
| 158 | 3300006944 | Ga0099823_1016936 | Ga0099823_10169369 | 252 |
| 159 | 3300006944 | Ga0099823_1018785 | Ga0099823_10187859 | 252 |
| 160 | 3300006948 | Ga0099826_10000013 | Ga0099826_10000013148 | 252 |
| 161 | 3300007788 | Ga0099795_10065222 | Ga0099795_100652221 | 252 |
| 162 | 3300007788 | Ga0099795_10104886 | Ga0099795_101048862 | 252 |
| 163 | 3300009011 | Ga0105251_10021512 | Ga0105251_100215122 | 252 |
| 164 | 3300009092 | Ga0105250_10010707 | Ga0105250_100107075 | 252 |
| 165 | 3300009094 | Ga0111539_10891516 | Ga0111539_108915162 | 252 |
| 166 | 3300009098 | Ga0105245_10049804 | Ga0105245_100498042 | 252 |
| 167 | 3300009098 | Ga0105245_10230938 | Ga0105245_102309382 | 252 |
| 168 | 3300009101 | Ga0105247_10257099 | Ga0105247_102570991 | 252 |
| 169 | 3300009101 | Ga0105247_10325575 | Ga0105247_103255752 | 252 |
| 170 | 3300009147 | Ga0114129_10196308 | Ga0114129_101963084 | 252 |
| 171 | 3300009148 | Ga0105243_10179674 | Ga0105243_101796742 | 252 |
| 172 | 3300009174 | Ga0105241_10035047 | Ga0105241_100350473 | 252 |
| 173 | 3300009174 | Ga0105241_10064819 | Ga0105241_100648192 | 252 |
| 174 | 3300009177 | Ga0105248_10054096 | Ga0105248_100540963 | 252 |
| 175 | 3300009177 | Ga0105248_10194397 | Ga0105248_101943972 | 252 |
| 176 | 3300009545 | Ga0105237_10130535 | Ga0105237_101305353 | 252 |
| 177 | 3300009545 | Ga0105237_10231480 | Ga0105237_102314801 | 252 |
| 178 | 3300009545 | Ga0105237_10264745 | Ga0105237_102647452 | 252 |
| 179 | 3300009545 | Ga0105237_10518106 | Ga0105237_105181062 | 252 |
| 180 | 3300009551 | Ga0105238_10289878 | Ga0105238_102898782 | 252 |
| 181 | 3300009553 | Ga0105249_10889471 | Ga0105249_108894712 | 252 |
| 182 | 3300010159 | Ga0099796_10046893 | Ga0099796_100468932 | 252 |
| 183 | 3300010375 | Ga0105239_10011851 | Ga0105239_1001185110 | 252 |
| 184 | 3300010375 | Ga0105239_10421767 | Ga0105239_104217672 | 252 |
| 185 | 3300011119 | Ga0105246_10083115 | Ga0105246_100831152 | 252 |
| 186 | 3300013308 | Ga0157375_10422745 | Ga0157375_104227453 | 252 |
| 187 | 3300014325 | Ga0163163_10333207 | Ga0163163_103332071 | 252 |
| 188 | 3300014326 | Ga0157380_10461206 | Ga0157380_104612062 | 252 |
| 189 | 3300014745 | Ga0157377_10160862 | Ga0157377_101608621 | 252 |
| 190 | 3300014968 | Ga0157379_10780084 | Ga0157379_107800841 | 252 |
| 191 | 3300015262 | Ga0182007_10000608 | Ga0182007_100006082 | 252 |
| 192 | 3300015265 | Ga0182005_1014887 | Ga0182005_10148874 | 252 |
| 193 | 3300017792 | Ga0163161_10053658 | Ga0163161_100536584 | 252 |
| 194 | 3300017792 | Ga0163161_10207646 | Ga0163161_102076461 | 252 |
| 195 | 3300021361 | Ga0213872_10000907 | Ga0213872_1000090710 | 252 |
| 196 | 3300021361 | Ga0213872_10001086 | Ga0213872_100010868 | 252 |
| 197 | 3300021361 | Ga0213872_10001611 | Ga0213872_1000161111 | 252 |
| 198 | 3300021361 | Ga0213872_10001866 | Ga0213872_100018665 | 252 |
| 199 | 3300021361 | Ga0213872_10028434 | Ga0213872_100284341 | 252 |
| 200 | 3300021361 | Ga0213872_10104833 | Ga0213872_101048331 | 252 |
| 201 | 3300025233 | Ga0209437_100858 | Ga0209437_10085810 | 252 |
| 202 | 3300025261 | Ga0209233_1000584 | Ga0209233_100058411 | 252 |
| 203 | 3300025261 | Ga0209233_1010556 | Ga0209233_10105563 | 252 |
| 204 | 3300025263 | Ga0209565_1000201 | Ga0209565_100020141 | 252 |
| 205 | 3300025272 | Ga0209455_1002576 | Ga0209455_10025764 | 252 |
| 206 | 3300025273 | Ga0209673_1000036 | Ga0209673_1000036264 | 252 |
| 207 | 3300025284 | Ga0209130_1000154 | Ga0209130_10001546 | 252 |
| 208 | 3300025284 | Ga0209130_1000409 | Ga0209130_100040921 | 252 |
| 209 | 3300025291 | Ga0209675_1000013 | Ga0209675_1000013264 | 252 |
| 210 | 3300025291 | Ga0209675_1007498 | Ga0209675_10074983 | 252 |
| 211 | 3300025292 | Ga0209676_1005963 | Ga0209676_10059634 | 252 |
| 212 | 3300025294 | Ga0209025_1000032 | Ga0209025_1000032292 | 252 |
| 213 | 3300025294 | Ga0209025_1001002 | Ga0209025_10010028 | 252 |
| 214 | 3300025294 | Ga0209025_1008061 | Ga0209025_10080618 | 252 |
| 215 | 3300025295 | Ga0209564_1000025 | Ga0209564_1000025488 | 252 |
| 216 | 3300025295 | Ga0209564_1000240 | Ga0209564_1000240100 | 252 |
| 217 | 3300025295 | Ga0209564_1000434 | Ga0209564_100043466 | 252 |
| 218 | 3300025295 | Ga0209564_1000578 | Ga0209564_100057824 | 252 |
| 219 | 3300025295 | Ga0209564_1003386 | Ga0209564_10033863 | 252 |
| 220 | 3300025295 | Ga0209564_1019204 | Ga0209564_10192041 | 252 |
| 221 | 3300025297 | Ga0209758_1000868 | Ga0209758_100086816 | 252 |
| 222 | 3300025298 | Ga0209050_1019218 | Ga0209050_10192183 | 252 |
| 223 | 3300025299 | Ga0209256_1000052 | Ga0209256_1000052252 | 252 |
| 224 | 3300025299 | Ga0209256_1000801 | Ga0209256_100080128 | 252 |
| 225 | 3300025299 | Ga0209256_1009401 | Ga0209256_10094013 | 252 |
| 226 | 3300025302 | Ga0207426_1000269 | Ga0207426_100026921 | 252 |
| 227 | 3300025302 | Ga0207426_1000286 | Ga0207426_10002866 | 252 |
| 228 | 3300025302 | Ga0207426_1000439 | Ga0207426_100043953 | 252 |
| 229 | 3300025303 | Ga0209051_1015854 | Ga0209051_10158542 | 252 |
| 230 | 3300025304 | Ga0209257_1005525 | Ga0209257_10055252 | 252 |
| 231 | 3300025304 | Ga0209257_1012653 | Ga0209257_10126532 | 252 |
| 232 | 3300025315 | Ga0207697_10059965 | Ga0207697_100599653 | 252 |
| 233 | 3300025735 | Ga0207713_1055515 | Ga0207713_10555152 | 252 |
| 234 | 3300025898 | Ga0207692_10001498 | Ga0207692_100014988 | 252 |
| 235 | 3300025901 | Ga0207688_10060451 | Ga0207688_100604513 | 252 |
| 236 | 3300025901 | Ga0207688_10063154 | Ga0207688_100631542 | 252 |
| 237 | 3300025904 | Ga0207647_10024012 | Ga0207647_100240124 | 252 |
| 238 | 3300025904 | Ga0207647_10253591 | Ga0207647_102535911 | 252 |
| 239 | 3300025905 | Ga0207685_10104914 | Ga0207685_101049142 | 252 |
| 240 | 3300025906 | Ga0207699_10001209 | Ga0207699_1000120910 | 252 |
| 241 | 3300025906 | Ga0207699_10229295 | Ga0207699_102292952 | 252 |
| 242 | 3300025907 | Ga0207645_10081665 | Ga0207645_100816653 | 252 |
| 243 | 3300025910 | Ga0207684_10296148 | Ga0207684_102961482 | 252 |
| 244 | 3300025911 | Ga0207654_10066590 | Ga0207654_100665901 | 252 |
| 245 | 3300025914 | Ga0207671_10222242 | Ga0207671_102222422 | 252 |
| 246 | 3300025915 | Ga0207693_10021080 | Ga0207693_100210804 | 252 |
| 247 | 3300025915 | Ga0207693_10201893 | Ga0207693_102018931 | 252 |
| 248 | 3300025915 | Ga0207693_10344303 | Ga0207693_103443032 | 252 |
| 249 | 3300025916 | Ga0207663_10001932 | Ga0207663_100019323 | 252 |
| 250 | 3300025916 | Ga0207663_10124266 | Ga0207663_101242662 | 252 |
| 251 | 3300025924 | Ga0207694_10080092 | Ga0207694_100800922 | 252 |
| 252 | 3300025927 | Ga0207687_10110474 | Ga0207687_101104742 | 252 |
| 253 | 3300025928 | Ga0207700_10058522 | Ga0207700_100585223 | 252 |
| 254 | 3300025929 | Ga0207664_10050921 | Ga0207664_100509213 | 252 |
| 255 | 3300025933 | Ga0207706_10005893 | Ga0207706_1000589311 | 252 |
| 256 | 3300025934 | Ga0207686_10137816 | Ga0207686_101378162 | 252 |
| 257 | 3300025935 | Ga0207709_10116283 | Ga0207709_101162833 | 252 |
| 258 | 3300025939 | Ga0207665_10019548 | Ga0207665_100195483 | 252 |
| 259 | 3300025939 | Ga0207665_10234163 | Ga0207665_102341632 | 252 |
| 260 | 3300025941 | Ga0207711_10048075 | Ga0207711_100480752 | 252 |
| 261 | 3300025941 | Ga0207711_10141715 | Ga0207711_101417151 | 252 |
| 262 | 3300025941 | Ga0207711_10404783 | Ga0207711_104047832 | 252 |
| 263 | 3300025942 | Ga0207689_10005976 | Ga0207689_100059765 | 252 |
| 264 | 3300025942 | Ga0207689_10206622 | Ga0207689_102066222 | 252 |
| 265 | 3300025961 | Ga0207712_10256372 | Ga0207712_102563723 | 252 |
| 266 | 3300025972 | Ga0207668_10007990 | Ga0207668_100079902 | 252 |
| 267 | 3300025986 | Ga0207658_10119941 | Ga0207658_101199412 | 252 |
| 268 | 3300026035 | Ga0207703_10168249 | Ga0207703_101682491 | 252 |
| 269 | 3300026035 | Ga0207703_10231864 | Ga0207703_102318642 | 252 |
| 270 | 3300026067 | Ga0207678_10118746 | Ga0207678_101187463 | 252 |
| 271 | 3300026075 | Ga0207708_10021747 | Ga0207708_100217472 | 252 |
| 272 | 3300026088 | Ga0207641_10312969 | Ga0207641_103129692 | 252 |
| 273 | 3300026089 | Ga0207648_10659761 | Ga0207648_106597611 | 252 |
| 274 | 3300026116 | Ga0207674_10208086 | Ga0207674_102080863 | 252 |
| 275 | 3300026118 | Ga0207675_100045363 | Ga0207675_1000453634 | 252 |
| 276 | 3300026121 | Ga0207683_10088006 | Ga0207683_100880064 | 252 |
| 277 | 3300026142 | Ga0207698_10306334 | Ga0207698_103063342 | 252 |
| 278 | 3300027296 | Ga0209389_1008948 | Ga0209389_10089488 | 252 |
| 279 | 3300027296 | Ga0209389_1010024 | Ga0209389_10100248 | 252 |
| 280 | 3300027357 | Ga0209589_1000676 | Ga0209589_10006767 | 252 |
| 281 | 3300027361 | Ga0209489_100062 | Ga0209489_100062115 | 252 |
| 282 | 3300027361 | Ga0209489_111509 | Ga0209489_1115098 | 252 |
| 283 | 3300027361 | Ga0209489_111839 | Ga0209489_1118398 | 252 |
| 284 | 3300027363 | Ga0209700_110927 | Ga0209700_1109278 | 252 |
| 285 | 3300027363 | Ga0209700_111242 | Ga0209700_1112428 | 252 |
| 286 | 3300027666 | Ga0209282_1000043 | Ga0209282_100004356 | 252 |
| 287 | 3300027671 | Ga0209588_1014646 | Ga0209588_10146462 | 252 |
| 288 | 3300028379 | Ga0268266_10193947 | Ga0268266_101939471 | 252 |
| 289 | 3300028380 | Ga0268265_10005524 | Ga0268265_100055249 | 252 |
| 290 | 3300028380 | Ga0268265_10139082 | Ga0268265_101390822 | 252 |
| 291 | 3300028381 | Ga0268264_10368601 | Ga0268264_103686011 | 252 |
| 292 | 3300028794 | Ga0307515_10000160 | Ga0307515_1000016038 | 252 |
| 293 | 3300033180 | Ga0307510_10010555 | Ga0307510_100105556 | 252 |
| 294 | 3300033180 | Ga0307510_10209592 | Ga0307510_102095922 | 252 |
| 295 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006164 | 252 |
| 296 | 3300035170 | Ga0373943_0050055 | Ga0373943_0050055_312_1070 | 252 |
| 297 | 3300035691 | Ga0373931_0140751 | Ga0373931_0140751_50_808 | 252 |
| 298 | 3300035695 | Ga0373927_0005782 | Ga0373927_0005782_3260_4018 | 252 |
| 299 | 3300035695 | Ga0373927_0016306 | Ga0373927_0016306_2953_3711 | 252 |
| 300 | 3300035725 | Ga0373947_0004169 | Ga0373947_0004169_2066_2824 | 252 |
| 301 | 3300035725 | Ga0373947_0037380 | Ga0373947_0037380_48_806 | 252 |
| 302 | 3300037068 | Ga0373925_0062663 | Ga0373925_0062663_879_1637 | 252 |
| 303 | 3300037471 | Ga0395905_0031525 | Ga0395905_0031525_3237_3995 | 252 |
| 304 | 3300037471 | Ga0395905_0280648 | Ga0395905_0280648_374_1132 | 252 |
| 305 | 3300039437 | Ga0436365_0931078 | Ga0436365_0931078_1936_2694 | 252 |
| 306 | 3300039437 | Ga0436365_1178230 | Ga0436365_1178230_676_1440 | 252 |
| 307 | 3300039437 | Ga0436365_1769494 | Ga0436365_1769494_44_802 | 252 |
| 308 | 3300039438 | Ga0436360_0148226 | Ga0436360_0148226_162_920 | 252 |
| 309 | 3300039438 | Ga0436360_0731023 | Ga0436360_0731023_665_1423 | 252 |
| 310 | 3300039447 | Ga0436361_0096149 | Ga0436361_0096149_5200_5967 | 252 |
| 311 | 3300039447 | Ga0436361_0201274 | Ga0436361_0201274_1164_1931 | 252 |
| 312 | 3300039447 | Ga0436361_0262026 | Ga0436361_0262026_25428_26186 | 252 |
| 313 | 3300039447 | Ga0436361_0277135 | Ga0436361_0277135_1820_2578 | 252 |
| 314 | 3300039447 | Ga0436361_0681104 | Ga0436361_0681104_20811_21575 | 252 |
| 315 | 3300039447 | Ga0436361_0796193 | Ga0436361_0796193_199_957 | 252 |
| 316 | 3300039447 | Ga0436361_0827273 | Ga0436361_0827273_7659_8417 | 252 |
| 317 | 3300039447 | Ga0436361_1011321 | Ga0436361_1011321_351_1109 | 252 |
| 318 | 3300039447 | Ga0436361_1085489 | Ga0436361_1085489_259_1017 | 252 |
| 319 | 3300042010 | Ga0439452_033630 | Ga0439452_033630_376_1143 | 252 |
| 320 | 3300044706 | Ga0466964_0027182 | Ga0466964_0027182_533_1291 | 252 |
| 321 | 3300045976 | Ga0466967_0312108 | Ga0466967_0312108_330_1088 | 252 |
| 322 | 3300046455 | Ga0495603_0006194 | Ga0495603_0006194_2254_3012 | 252 |
| 323 | 3300046455 | Ga0495603_0177132 | Ga0495603_0177132_288_1046 | 252 |
| 324 | 3300046460 | Ga0495638_0007874 | Ga0495638_0007874_2800_3558 | 252 |
| 325 | 3300046472 | Ga0495580_0262535 | Ga0495580_0262535_48_806 | 252 |
| 326 | 3300046474 | Ga0495605_0031954 | Ga0495605_0031954_524_1282 | 252 |
| 327 | 3300046474 | Ga0495605_0047792 | Ga0495605_0047792_974_1732 | 252 |
| 328 | 3300046491 | Ga0495584_0000007 | Ga0495584_0000007_75700_76458 | 252 |
| 329 | 3300046491 | Ga0495584_0000901 | Ga0495584_0000901_10190_10948 | 252 |
| 330 | 3300046492 | Ga0495585_0000003 | Ga0495585_0000003_50330_51088 | 252 |
| 331 | 3300046492 | Ga0495585_0000264 | Ga0495585_0000264_28239_28997 | 252 |
| 332 | 3300046492 | Ga0495585_0006146 | Ga0495585_0006146_5223_5981 | 252 |
| 333 | 3300046500 | Ga0495596_0001236 | Ga0495596_0001236_8156_8914 | 252 |
| 334 | 3300046500 | Ga0495596_0005439 | Ga0495596_0005439_1744_2502 | 252 |
| 335 | 3300046500 | Ga0495596_0077643 | Ga0495596_0077643_396_1154 | 252 |
| 336 | 3300046501 | Ga0495607_0007789 | Ga0495607_0007789_3130_3888 | 252 |
| 337 | 3300046506 | Ga0495583_0001238 | Ga0495583_0001238_4895_5653 | 252 |
| 338 | 3300046506 | Ga0495583_0039461 | Ga0495583_0039461_86_844 | 252 |
| 339 | 3300046507 | Ga0495606_0002146 | Ga0495606_0002146_6337_7095 | 252 |
| 340 | 3300046507 | Ga0495606_0036483 | Ga0495606_0036483_1139_1906 | 252 |
| 341 | 3300046507 | Ga0495606_0042940 | Ga0495606_0042940_370_1128 | 252 |
| 342 | 3300046507 | Ga0495606_0063805 | Ga0495606_0063805_227_985 | 252 |
| 343 | 3300046513 | Ga0495616_0000228 | Ga0495616_0000228_22484_23242 | 252 |
| 344 | 3300046513 | Ga0495616_0003675 | Ga0495616_0003675_4258_5016 | 252 |
| 345 | 3300046513 | Ga0495616_0015489 | Ga0495616_0015489_2695_3453 | 252 |
| 346 | 3300046513 | Ga0495616_0034720 | Ga0495616_0034720_1840_2598 | 252 |
| 347 | 3300046515 | Ga0495620_0001264 | Ga0495620_0001264_8513_9271 | 252 |
| 348 | 3300046517 | Ga0495630_0122386 | Ga0495630_0122386_165_923 | 252 |
| 349 | 3300046518 | Ga0495631_0000090 | Ga0495631_0000090_51953_52711 | 252 |
| 350 | 3300046519 | Ga0495632_0169762 | Ga0495632_0169762_186_944 | 252 |
| 351 | 3300046522 | Ga0495643_0013974 | Ga0495643_0013974_3408_4166 | 252 |
| 352 | 3300046522 | Ga0495643_0037229 | Ga0495643_0037229_224_982 | 252 |
| 353 | 3300046522 | Ga0495643_0063433 | Ga0495643_0063433_543_1310 | 252 |
| 354 | 3300046524 | Ga0495648_0000171 | Ga0495648_0000171_50585_51343 | 252 |
| 355 | 3300046524 | Ga0495648_0005173 | Ga0495648_0005173_9106_9864 | 252 |
| 356 | 3300046524 | Ga0495648_0029940 | Ga0495648_0029940_1768_2526 | 252 |
| 357 | 3300046524 | Ga0495648_0078434 | Ga0495648_0078434_1022_1780 | 252 |
| 358 | 3300046524 | Ga0495648_0083356 | Ga0495648_0083356_562_1320 | 252 |
| 359 | 3300046528 | Ga0495642_0003682 | Ga0495642_0003682_1631_2389 | 252 |
| 360 | 3300046530 | Ga0495654_0007039 | Ga0495654_0007039_3407_4165 | 252 |
| 361 | 3300046538 | Ga0495609_0000566 | Ga0495609_0000566_15340_16098 | 252 |
| 362 | 3300046538 | Ga0495609_0020794 | Ga0495609_0020794_1265_2023 | 252 |
| 363 | 3300046538 | Ga0495609_0034901 | Ga0495609_0034901_82_840 | 252 |
| 364 | 3300046542 | Ga0495597_0008221 | Ga0495597_0008221_2933_3703 | 252 |
| 365 | 3300046557 | Ga0495622_0085362 | Ga0495622_0085362_647_1405 | 252 |
| 366 | 3300046558 | Ga0495633_0000702 | Ga0495633_0000702_9894_10652 | 252 |
| 367 | 3300046558 | Ga0495633_0013203 | Ga0495633_0013203_3255_4013 | 252 |
| 368 | 3300046616 | Ga0495668_0000094 | Ga0495668_0000094_82943_83701 | 252 |
| 369 | 3300046616 | Ga0495668_0000129 | Ga0495668_0000129_9656_10414 | 252 |
| 370 | 3300046616 | Ga0495668_0007639 | Ga0495668_0007639_1278_2036 | 252 |
| 371 | 3300046616 | Ga0495668_0145382 | Ga0495668_0145382_433_1191 | 252 |
| 372 | 3300046648 | Ga0495611_0013495 | Ga0495611_0013495_2420_3178 | 252 |
| 373 | 3300046648 | Ga0495611_0077769 | Ga0495611_0077769_158_916 | 252 |
| 374 | 3300046648 | Ga0495611_0185090 | Ga0495611_0185090_47_805 | 252 |
| 375 | 3300046660 | Ga0495625_0003017 | Ga0495625_0003017_6505_7275 | 252 |
| 376 | 3300046660 | Ga0495625_0007263 | Ga0495625_0007263_7260_8018 | 252 |
| 377 | 3300046660 | Ga0495625_0128561 | Ga0495625_0128561_637_1395 | 252 |
| 378 | 3300046664 | Ga0495659_0077495 | Ga0495659_0077495_272_1030 | 252 |
| 379 | 3300046665 | Ga0495661_0011409 | Ga0495661_0011409_41_799 | 252 |
| 380 | 3300046665 | Ga0495661_0037066 | Ga0495661_0037066_2023_2781 | 252 |
| 381 | 3300046665 | Ga0495661_0081364 | Ga0495661_0081364_934_1692 | 252 |
| 382 | 3300046674 | Ga0495588_0316572 | Ga0495588_0316572_20_778 | 252 |
| 383 | 3300046692 | Ga0495671_0004568 | Ga0495671_0004568_1758_2516 | 252 |
| 384 | 3300046692 | Ga0495671_0036772 | Ga0495671_0036772_672_1430 | 252 |
| 385 | 3300046692 | Ga0495671_0270782 | Ga0495671_0270782_50_808 | 252 |
| 386 | 3300046694 | Ga0495649_0003412 | Ga0495649_0003412_2841_3599 | 252 |
| 387 | 3300046694 | Ga0495649_0026960 | Ga0495649_0026960_2226_2993 | 252 |
| 388 | 3300046794 | Ga0495589_0000033 | Ga0495589_0000033_94563_95336 | 252 |
| 389 | 3300046810 | Ga0495660_0025127 | Ga0495660_0025127_50_808 | 252 |
| 390 | 3300046810 | Ga0495660_0169777 | Ga0495660_0169777_84_842 | 252 |
| 391 | 3300047319 | Ga0495674_0264219 | Ga0495674_0264219_433_1191 | 252 |
| 392 | 3300047320 | Ga0495672_0011421 | Ga0495672_0011421_1833_2591 | 252 |
| 393 | 3300047321 | Ga0495676_0119583 | Ga0495676_0119583_955_1713 | 252 |
| 394 | 3300047323 | Ga0495683_0000083 | Ga0495683_0000083_85838_86596 | 252 |
| 395 | 3300047323 | Ga0495683_0001589 | Ga0495683_0001589_1532_2299 | 252 |
| 396 | 3300047323 | Ga0495683_0005834 | Ga0495683_0005834_5711_6469 | 252 |
| 397 | 3300047323 | Ga0495683_0018287 | Ga0495683_0018287_91_849 | 252 |
| 398 | 3300047323 | Ga0495683_0087202 | Ga0495683_0087202_283_1041 | 252 |
| 399 | 3300047323 | Ga0495683_0215841 | Ga0495683_0215841_42_800 | 252 |
| 400 | 3300047443 | Ga0495687_000017 | Ga0495687_000017_280877_281635 | 252 |
| 401 | 3300047443 | Ga0495687_009263 | Ga0495687_009263_3623_4390 | 252 |
| 402 | 3300047443 | Ga0495687_084482 | Ga0495687_084482_281_1039 | 252 |
| 403 | 3300047446 | Ga0495679_007526 | Ga0495679_007526_3148_3906 | 252 |
| 404 | 3300047447 | Ga0495685_000938 | Ga0495685_000938_4612_5370 | 252 |
| 405 | 3300047447 | Ga0495685_004641 | Ga0495685_004641_2930_3688 | 252 |
| 406 | 3300047469 | Ga0495673_0177686 | Ga0495673_0177686_37_795 | 252 |
| 407 | 3300047470 | Ga0495681_0005657 | Ga0495681_0005657_3481_4239 | 252 |
| 408 | 3300047471 | Ga0495684_0329700 | Ga0495684_0329700_230_988 | 252 |
| 409 | 3300047673 | Ga0495593_0044363 | Ga0495593_0044363_622_1380 | 252 |
| 410 | 3300048903 | Ga0496100_0151990 | Ga0496100_0151990_219_977 | 252 |
| 411 | 3300048905 | Ga0496102_0210877 | Ga0496102_0210877_896_1654 | 252 |
| 412 | 3300048905 | Ga0496102_0558935 | Ga0496102_0558935_91_849 | 252 |
| 413 | 3300048906 | Ga0496103_0038267 | Ga0496103_0038267_727_1485 | 252 |
| 414 | 3300048906 | Ga0496103_0050426 | Ga0496103_0050426_777_1535 | 252 |
| 415 | 3300048907 | Ga0496104_0004902 | Ga0496104_0004902_2861_3619 | 252 |
| 416 | 3300048908 | Ga0496105_0009330 | Ga0496105_0009330_3216_3974 | 252 |
| 417 | 3300048908 | Ga0496105_0287710 | Ga0496105_0287710_29_787 | 252 |
| 418 | 3300048909 | Ga0496106_0039933 | Ga0496106_0039933_41_799 | 252 |
| 419 | 3300048911 | Ga0496108_0137938 | Ga0496108_0137938_211_969 | 252 |
| 420 | 3300048911 | Ga0496108_0429783 | Ga0496108_0429783_321_1079 | 252 |
| 421 | 3300048912 | Ga0496109_0034401 | Ga0496109_0034401_581_1339 | 252 |
| 422 | 3300048912 | Ga0496109_0165578 | Ga0496109_0165578_524_1282 | 252 |
| 423 | 3300048912 | Ga0496109_0258248 | Ga0496109_0258248_640_1398 | 252 |
| 424 | 3300048915 | Ga0496112_0339272 | Ga0496112_0339272_573_1331 | 252 |
| 425 | 3300048916 | Ga0496113_0191469 | Ga0496113_0191469_225_983 | 252 |
| 426 | 3300048917 | Ga0496114_0179980 | Ga0496114_0179980_313_1071 | 252 |
| 427 | 3300048917 | Ga0496114_0557354 | Ga0496114_0557354_22_780 | 252 |
| 428 | 3300048918 | Ga0496115_0089701 | Ga0496115_0089701_293_1051 | 252 |
| 429 | 3300048919 | Ga0496116_0004369 | Ga0496116_0004369_2945_3703 | 252 |
| 430 | 3300048919 | Ga0496116_0105368 | Ga0496116_0105368_77_835 | 252 |
| 431 | 3300048919 | Ga0496116_0244197 | Ga0496116_0244197_75_833 | 252 |
| 432 | 3300048920 | Ga0496117_0055074 | Ga0496117_0055074_1691_2449 | 252 |
| 433 | 3300048920 | Ga0496117_0141950 | Ga0496117_0141950_329_1087 | 252 |
| 434 | 3300048921 | Ga0496118_0031253 | Ga0496118_0031253_75_833 | 252 |
| 435 | 3300048921 | Ga0496118_0054891 | Ga0496118_0054891_138_896 | 252 |
| 436 | 3300048921 | Ga0496118_0104009 | Ga0496118_0104009_555_1313 | 252 |
| 437 | 3300048922 | Ga0496119_0016165 | Ga0496119_0016165_1905_2669 | 252 |
| 438 | 3300048922 | Ga0496119_0023355 | Ga0496119_0023355_1955_2713 | 252 |
| 439 | 3300048923 | Ga0496120_0013451 | Ga0496120_0013451_2240_3004 | 252 |
| 440 | 3300048924 | Ga0496121_0002217 | Ga0496121_0002217_520_1278 | 252 |
| 441 | 3300048924 | Ga0496121_0015838 | Ga0496121_0015838_868_1626 | 252 |
| 442 | 3300048924 | Ga0496121_0262874 | Ga0496121_0262874_221_979 | 252 |
| 443 | 3300048924 | Ga0496121_0317503 | Ga0496121_0317503_19_777 | 252 |
| 444 | 3300048925 | Ga0496122_0000043 | Ga0496122_0000043_235411_236169 | 252 |
| 445 | 3300048925 | Ga0496122_0000908 | Ga0496122_0000908_3747_4505 | 252 |
| 446 | 3300048926 | Ga0496123_0000090 | Ga0496123_0000090_44158_44916 | 252 |
| 447 | 3300048926 | Ga0496123_0000412 | Ga0496123_0000412_30585_31343 | 252 |
| 448 | 3300048926 | Ga0496123_0020702 | Ga0496123_0020702_2243_3007 | 252 |
| 449 | 3300048927 | Ga0496124_0180048 | Ga0496124_0180048_702_1466 | 252 |
| 450 | 3300048928 | Ga0496125_0000051 | Ga0496125_0000051_270144_270908 | 252 |
| 451 | 3300048928 | Ga0496125_0311741 | Ga0496125_0311741_151_909 | 252 |
| 452 | 3300048929 | Ga0496126_0007725 | Ga0496126_0007725_10145_10903 | 252 |
| 453 | 3300048929 | Ga0496126_0022164 | Ga0496126_0022164_5076_5834 | 252 |
| 454 | 3300048929 | Ga0496126_0143739 | Ga0496126_0143739_900_1658 | 252 |
| 455 | 3300050490 | nmdc:mga03n38_276029_c1 | nmdc:mga03n38_276029_c1_11_769 | 252 |
| 456 | 3300050490 | nmdc:mga03n38_45650_c1 | nmdc:mga03n38_45650_c1_768_1526 | 252 |
| 457 | 3300050491 | nmdc:mga00v17_62136_c1 | nmdc:mga00v17_62136_c1_1181_1939 | 252 |
| 458 | 3300050493 | nmdc:mga0k408_154697_c1 | nmdc:mga0k408_154697_c1_307_1065 | 252 |
| 459 | 3300050494 | nmdc:mga06z11_158517_c1 | nmdc:mga06z11_158517_c1_467_1225 | 252 |
| 460 | 3300050494 | nmdc:mga06z11_21857_c1 | nmdc:mga06z11_21857_c1_38_796 | 252 |
| 461 | 3300050494 | nmdc:mga06z11_357388_c1 | nmdc:mga06z11_357388_c1_89_847 | 252 |
| 462 | 3300050494 | nmdc:mga06z11_61061_c1 | nmdc:mga06z11_61061_c1_245_1003 | 252 |
| 463 | 3300050495 | nmdc:mga04h51_4538_c1 | nmdc:mga04h51_4538_c1_604_1362 | 252 |
| 464 | 3300050496 | nmdc:mga07m45_5932_c1 | nmdc:mga07m45_5932_c1_3916_4674 | 252 |
| 465 | 3300050507 | nmdc:mga05p37_705158_c1 | nmdc:mga05p37_705158_c1_146_904 | 252 |
| 466 | 3300050511 | nmdc:mga08y16_34670_c1 | nmdc:mga08y16_34670_c1_240_998 | 252 |
| 467 | 3300050512 | nmdc:mga0n895_182164_c1 | nmdc:mga0n895_182164_c1_699_1457 | 252 |
| 468 | 3300050512 | nmdc:mga0n895_502_c1 | nmdc:mga0n895_502_c1_12468_13226 | 252 |
| 469 | 3300050515 | nmdc:mga0a205_4465_c1 | nmdc:mga0a205_4465_c1_8648_9406 | 252 |
| 470 | 3300050516 | nmdc:mga0sz30_32577_c1 | nmdc:mga0sz30_32577_c1_213_971 | 252 |
| 471 | 3300050516 | nmdc:mga0sz30_53526_c2 | nmdc:mga0sz30_53526_c2_158_916 | 252 |
| 472 | 3300050516 | nmdc:mga0sz30_84720_c1 | nmdc:mga0sz30_84720_c1_151_909 | 252 |
| 473 | 3300053080 | Ga0500635_0037167 | Ga0500635_0037167_689_1447 | 252 |
| 474 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_179002_179760 | 252 |
| 475 | 3300053103 | Ga0500555_009621 | Ga0500555_009621_1122_1880 | 252 |
| 476 | 3300053104 | Ga0500556_0006082 | Ga0500556_0006082_385_1143 | 252 |
| 477 | 3300053104 | Ga0500556_0044133 | Ga0500556_0044133_195_953 | 252 |
| 478 | 3300053108 | Ga0500562_003619 | Ga0500562_003619_1950_2708 | 252 |
| 479 | 3300053109 | Ga0500569_004065 | Ga0500569_004065_122_880 | 252 |
| 480 | 3300053116 | Ga0500592_005045 | Ga0500592_005045_1202_1960 | 252 |
| 481 | 3300053130 | Ga0500642_0078492 | Ga0500642_0078492_411_1169 | 252 |
| 482 | 3300053138 | Ga0500564_093306 | Ga0500564_093306_416_1174 | 252 |
| 483 | 3300053142 | Ga0500577_0140046 | Ga0500577_0140046_198_956 | 252 |
| 484 | 3300053153 | Ga0500616_0013901 | Ga0500616_0013901_3675_4433 | 252 |
| 485 | 3300053154 | Ga0500619_036813 | Ga0500619_036813_348_1106 | 252 |
| 486 | 3300053155 | Ga0500620_021597 | Ga0500620_021597_596_1354 | 252 |
| 487 | 3300053156 | Ga0500622_0025216 | Ga0500622_0025216_2220_2978 | 252 |
| 488 | 3300053160 | Ga0500633_0013380 | Ga0500633_0013380_1229_1987 | 252 |
| 489 | 3300053162 | Ga0500638_176194 | Ga0500638_176194_119_877 | 252 |
| 490 | 3300053177 | Ga0500636_0000206 | Ga0500636_0000206_15833_16591 | 252 |
| 491 | 3300053177 | Ga0500636_0155931 | Ga0500636_0155931_434_1192 | 252 |
| 492 | 3300053178 | Ga0500637_0125989 | Ga0500637_0125989_578_1336 | 252 |
| 493 | 3300053730 | Ga0500645_016121 | Ga0500645_016121_1585_2343 | 252 |
| 494 | 3300053736 | Ga0500599_000862 | Ga0500599_000862_2396_3154 | 252 |
| 495 | 3300053737 | Ga0500601_000281 | Ga0500601_000281_5242_6000 | 252 |
| 496 | 3300055283 | Ga0500661_007848 | Ga0500661_007848_1111_1869 | 252 |
| 497 | iso_pu_bacteria | 2738541300 | 2738846719 | 252 |
| 498 | iso_pu_bacteria | 2738543018 | 2739277623 | 252 |
| 499 | iso_pu_bacteria | 2738543030 | 2739346692 | 252 |
| 500 | 3300009011 | Ga0105251_10016616 | Ga0105251_100166162 | 253 |
| 501 | 3300031456 | Ga0307513_10326741 | Ga0307513_103267411 | 253 |
| 502 | 3300048905 | Ga0496102_0006087 | Ga0496102_0006087_8915_9676 | 253 |
| 503 | 3300048916 | Ga0496113_0191174 | Ga0496113_0191174_316_1077 | 253 |
| 504 | 3300053158 | Ga0500627_0038138 | Ga0500627_0038138_624_1391 | 253 |
| 505 | 3300005329 | Ga0070683_100149183 | Ga0070683_1001491832 | 254 |
| 506 | 3300005338 | Ga0068868_100105920 | Ga0068868_1001059204 | 254 |
| 507 | 3300005344 | Ga0070661_100070893 | Ga0070661_1000708933 | 254 |
| 508 | 3300005354 | Ga0070675_100246230 | Ga0070675_1002462303 | 254 |
| 509 | 3300005355 | Ga0070671_100081155 | Ga0070671_1000811552 | 254 |
| 510 | 3300005456 | Ga0070678_100030921 | Ga0070678_1000309212 | 254 |
| 511 | 3300005539 | Ga0068853_100740690 | Ga0068853_1007406901 | 254 |
| 512 | 3300005616 | Ga0068852_100032142 | Ga0068852_1000321425 | 254 |
| 513 | 3300005618 | Ga0068864_100053213 | Ga0068864_1000532132 | 254 |
| 514 | 3300006353 | Ga0075370_10283004 | Ga0075370_102830041 | 254 |
| 515 | 3300006358 | Ga0068871_100139043 | Ga0068871_1001390432 | 254 |
| 516 | 3300006881 | Ga0068865_100248066 | Ga0068865_1002480663 | 254 |
| 517 | 3300009098 | Ga0105245_10079949 | Ga0105245_100799492 | 254 |
| 518 | 3300010375 | Ga0105239_10075944 | Ga0105239_100759442 | 254 |
| 519 | 3300011119 | Ga0105246_10098459 | Ga0105246_100984592 | 254 |
| 520 | 3300013296 | Ga0157374_10080954 | Ga0157374_100809543 | 254 |
| 521 | 3300013306 | Ga0163162_10124775 | Ga0163162_101247752 | 254 |
| 522 | 3300013308 | Ga0157375_10018732 | Ga0157375_100187322 | 254 |
| 523 | 3300014325 | Ga0163163_10175381 | Ga0163163_101753812 | 254 |
| 524 | 3300014745 | Ga0157377_10203701 | Ga0157377_102037013 | 254 |
| 525 | 3300014969 | Ga0157376_10143567 | Ga0157376_101435672 | 254 |
| 526 | 3300025315 | Ga0207697_10053949 | Ga0207697_100539492 | 254 |
| 527 | 3300025901 | Ga0207688_10078029 | Ga0207688_100780293 | 254 |
| 528 | 3300025920 | Ga0207649_10093549 | Ga0207649_100935493 | 254 |
| 529 | 3300025927 | Ga0207687_10025333 | Ga0207687_100253332 | 254 |
| 530 | 3300026067 | Ga0207678_10053206 | Ga0207678_100532064 | 254 |
| 531 | 3300026095 | Ga0207676_10264548 | Ga0207676_102645482 | 254 |
| 532 | 3300026121 | Ga0207683_10090469 | Ga0207683_100904694 | 254 |
| 533 | 3300046458 | Ga0495591_000251 | Ga0495591_000251_34282_35046 | 254 |
| 534 | 3300046474 | Ga0495605_0018977 | Ga0495605_0018977_2663_3427 | 254 |
| 535 | 3300046492 | Ga0495585_0001279 | Ga0495585_0001279_10679_11443 | 254 |
| 536 | 3300046501 | Ga0495607_0030451 | Ga0495607_0030451_473_1237 | 254 |
| 537 | 3300046506 | Ga0495583_0004255 | Ga0495583_0004255_9213_9977 | 254 |
| 538 | 3300046507 | Ga0495606_0001356 | Ga0495606_0001356_7522_8286 | 254 |
| 539 | 3300046513 | Ga0495616_0003233 | Ga0495616_0003233_471_1235 | 254 |
| 540 | 3300046519 | Ga0495632_0000681 | Ga0495632_0000681_28558_29322 | 254 |
| 541 | 3300046524 | Ga0495648_0003560 | Ga0495648_0003560_12355_13119 | 254 |
| 542 | 3300046524 | Ga0495648_0010240 | Ga0495648_0010240_4106_4870 | 254 |
| 543 | 3300046660 | Ga0495625_0026997 | Ga0495625_0026997_1227_1991 | 254 |
| 544 | 3300046664 | Ga0495659_0008109 | Ga0495659_0008109_236_1000 | 254 |
| 545 | 3300046691 | Ga0495670_0000770 | Ga0495670_0000770_2120_2884 | 254 |
| 546 | 3300046692 | Ga0495671_0011654 | Ga0495671_0011654_4021_4785 | 254 |
| 547 | 3300046692 | Ga0495671_0013199 | Ga0495671_0013199_1095_1859 | 254 |
| 548 | 3300046810 | Ga0495660_0001774 | Ga0495660_0001774_3097_3861 | 254 |
| 549 | 3300047320 | Ga0495672_0050386 | Ga0495672_0050386_1143_1907 | 254 |
| 550 | 3300047323 | Ga0495683_0002730 | Ga0495683_0002730_731_1495 | 254 |
| 551 | 3300047469 | Ga0495673_0003848 | Ga0495673_0003848_7251_8015 | 254 |
| 552 | 3300047469 | Ga0495673_0005900 | Ga0495673_0005900_3318_4082 | 254 |
| 553 | 3300047469 | Ga0495673_0028679 | Ga0495673_0028679_444_1208 | 254 |
| 554 | 3300048091 | Ga0495626_0001391 | Ga0495626_0001391_16845_17609 | 254 |
| 555 | 3300048903 | Ga0496100_0036374 | Ga0496100_0036374_1422_2189 | 254 |
| 556 | 3300048904 | Ga0496101_0242695 | Ga0496101_0242695_295_1062 | 254 |
| 557 | 3300048905 | Ga0496102_0006237 | Ga0496102_0006237_5518_6285 | 254 |
| 558 | 3300048906 | Ga0496103_0094082 | Ga0496103_0094082_864_1631 | 254 |
| 559 | 3300048907 | Ga0496104_0083602 | Ga0496104_0083602_1743_2510 | 254 |
| 560 | 3300048908 | Ga0496105_0017517 | Ga0496105_0017517_1597_2364 | 254 |
| 561 | 3300048909 | Ga0496106_0026512 | Ga0496106_0026512_1382_2149 | 254 |
| 562 | 3300048910 | Ga0496107_0003592 | Ga0496107_0003592_3341_4108 | 254 |
| 563 | 3300048912 | Ga0496109_0143239 | Ga0496109_0143239_928_1695 | 254 |
| 564 | 3300048913 | Ga0496110_0046958 | Ga0496110_0046958_2674_3441 | 254 |
| 565 | 3300048914 | Ga0496111_0045682 | Ga0496111_0045682_643_1410 | 254 |
| 566 | 3300048915 | Ga0496112_0138190 | Ga0496112_0138190_483_1250 | 254 |
| 567 | 3300048916 | Ga0496113_0088444 | Ga0496113_0088444_1454_2221 | 254 |
| 568 | 3300048918 | Ga0496115_0013677 | Ga0496115_0013677_1018_1785 | 254 |
| 569 | 3300049460 | Ga0495682_0001062 | Ga0495682_0001062_3038_3802 | 254 |
| 570 | 3300049460 | Ga0495682_0007135 | Ga0495682_0007135_3009_3773 | 254 |
| 571 | 3300050496 | nmdc:mga07m45_242283_c1 | nmdc:mga07m45_242283_c1_171_941 | 254 |
| 572 | iso_pu_bacteria | 2775506901 | 2776259366 | 254 |
| 573 | iso_pu_bacteria | 2775506901 | 2776266308 | 254 |
| 574 | iso_pu_bacteria | 2840764183 | 2840764674 | 254 |
| 575 | iso_pu_bacteria | 2903748898 | 2903752999 | 254 |
| 576 | iso_pu_bacteria | 2904690495 | 2904697780 | 254 |
| 577 | iso_pu_bacteria | 2904699407 | 2904705941 | 254 |
| 578 | iso_pu_bacteria | 2906610324 | 2906611517 | 254 |
| 579 | iso_pu_bacteria | 2908756301 | 2908757123 | 254 |
| 580 | iso_pu_bacteria | 8006933436 | 8006933685 | 254 |
| 581 | iso_pu_bacteria | 8006973647 | 8006983357 | 254 |
| 582 | 3300003203 | JGI25406J46586_10000085 | JGI25406J46586_100000857 | 255 |
| 583 | 3300005985 | Ga0081539_10000003 | Ga0081539_1000000340 | 255 |
| 584 | 3300006173 | Ga0070716_100386896 | Ga0070716_1003868961 | 255 |
| 585 | 3300039438 | Ga0436360_1020232 | Ga0436360_1020232_1438_2250 | 255 |
| 586 | 3300046491 | Ga0495584_0000018 | Ga0495584_0000018_132758_133525 | 255 |
| 587 | 3300046506 | Ga0495583_0008979 | Ga0495583_0008979_3435_4202 | 255 |
| 588 | 3300046810 | Ga0495660_0002528 | Ga0495660_0002528_4385_5152 | 255 |
| 589 | 3300049459 | Ga0495678_003182 | Ga0495678_003182_6612_7379 | 255 |
| 590 | iso_pu_bacteria | 2513237146 | 2513924695 | 255 |
| 591 | iso_pu_bacteria | 2524023228 | 2524534551 | 255 |
| 592 | iso_pu_bacteria | 2599185170 | 2599416248 | 255 |
| 593 | iso_pu_bacteria | 2838035591 | 2838036372 | 255 |
| 594 | iso_pu_bacteria | 2842341865 | 2842342157 | 255 |
| 595 | iso_pu_bacteria | 2842363717 | 2842365867 | 255 |
| 596 | iso_pu_bacteria | 2941499720 | 2941505716 | 255 |
| 597 | 3300039447 | Ga0436361_0204659 | Ga0436361_0204659_698_1471 | 256 |
| 598 | 3300009177 | Ga0105248_10034058 | Ga0105248_100340586 | 257 |
| 599 | 3300009545 | Ga0105237_10030235 | Ga0105237_100302356 | 257 |
| 600 | 3300013104 | Ga0157370_10168772 | Ga0157370_101687721 | 257 |
| 601 | 3300014969 | Ga0157376_10667290 | Ga0157376_106672902 | 257 |
| 602 | iso_pu_bacteria | 2599185239 | 2599738877 | 257 |
| 603 | iso_pu_bacteria | 2818991452 | 2819631450 | 257 |
| 604 | iso_pu_bacteria | 2928170801 | 2928176080 | 257 |
| 605 | iso_pu_bacteria | 2981990288 | 2981996562 | 257 |
| 606 | iso_pu_bacteria | 641736154 | 642414425 | 257 |
| 607 | iso_pu_bacteria | 8018845410 | 8018851116 | 257 |
| 608 | iso_pu_bacteria | 8021120328 | 8021126097 | 257 |
| 609 | 3300005441 | Ga0070700_100106267 | Ga0070700_1001062672 | 258 |
| 610 | 3300005458 | Ga0070681_10067376 | Ga0070681_100673762 | 258 |
| 611 | 3300005459 | Ga0068867_100605631 | Ga0068867_1006056311 | 258 |
| 612 | 3300005983 | Ga0081540_1047943 | Ga0081540_10479432 | 258 |
| 613 | 3300005983 | Ga0081540_1064159 | Ga0081540_10641592 | 258 |
| 614 | 3300006881 | Ga0068865_100382044 | Ga0068865_1003820441 | 258 |
| 615 | 3300009148 | Ga0105243_10621299 | Ga0105243_106212992 | 258 |
| 616 | 3300009176 | Ga0105242_10362484 | Ga0105242_103624842 | 258 |
| 617 | 3300009551 | Ga0105238_10874636 | Ga0105238_108746361 | 258 |
| 618 | 3300021321 | Ga0214542_1027346 | Ga0214542_10273462 | 258 |
| 619 | 3300021327 | Ga0214543_1001580 | Ga0214543_100158021 | 258 |
| 620 | 3300025912 | Ga0207707_10162591 | Ga0207707_101625914 | 258 |
| 621 | 3300025915 | Ga0207693_10032038 | Ga0207693_100320382 | 258 |
| 622 | 3300025931 | Ga0207644_10126042 | Ga0207644_101260422 | 258 |
| 623 | 3300025934 | Ga0207686_10299409 | Ga0207686_102994092 | 258 |
| 624 | 3300025940 | Ga0207691_10227241 | Ga0207691_102272412 | 258 |
| 625 | 3300026075 | Ga0207708_10145077 | Ga0207708_101450773 | 258 |
| 626 | 3300026089 | Ga0207648_10598162 | Ga0207648_105981622 | 258 |
| 627 | 3300031730 | Ga0307516_10310350 | Ga0307516_103103502 | 258 |
| 628 | 3300033180 | Ga0307510_10052806 | Ga0307510_100528061 | 258 |
| 629 | 3300033442 | Ga0315911_1000010 | Ga0315911_100001098 | 258 |
| 630 | 3300039437 | Ga0436365_0913976 | Ga0436365_0913976_59_835 | 258 |
| 631 | 3300039447 | Ga0436361_0082970 | Ga0436361_0082970_4455_5231 | 258 |
| 632 | 3300039447 | Ga0436361_0091951 | Ga0436361_0091951_9868_10644 | 258 |
| 633 | 3300046461 | Ga0495641_0034815 | Ga0495641_0034815_818_1600 | 258 |
| 634 | 3300046557 | Ga0495622_0069563 | Ga0495622_0069563_472_1254 | 258 |
| 635 | 3300048924 | Ga0496121_0137735 | Ga0496121_0137735_339_1121 | 258 |
| 636 | 3300009176 | Ga0105242_10084686 | Ga0105242_100846861 | 259 |
| 637 | 3300010375 | Ga0105239_10012140 | Ga0105239_100121402 | 259 |
| 638 | 3300025261 | Ga0209233_1001106 | Ga0209233_10011067 | 259 |
| 639 | 3300025915 | Ga0207693_10174175 | Ga0207693_101741753 | 259 |
| 640 | 3300035116 | Ga0373945_0098173 | Ga0373945_0098173_312_1097 | 259 |
| 641 | 3300035691 | Ga0373931_0002876 | Ga0373931_0002876_5855_6640 | 259 |
| 642 | 3300039450 | Ga0436363_0540076 | Ga0436363_0540076_233_1024 | 259 |
| 643 | 3300039453 | Ga0436362_0514368 | Ga0436362_0514368_1314_2108 | 259 |
| 644 | 3300048903 | Ga0496100_0021982 | Ga0496100_0021982_2717_3502 | 259 |
| 645 | 3300048904 | Ga0496101_0009247 | Ga0496101_0009247_1073_1858 | 259 |
| 646 | 3300048905 | Ga0496102_0018498 | Ga0496102_0018498_274_1059 | 259 |
| 647 | 3300048907 | Ga0496104_0048949 | Ga0496104_0048949_1414_2199 | 259 |
| 648 | 3300048908 | Ga0496105_0038302 | Ga0496105_0038302_1448_2233 | 259 |
| 649 | 3300048909 | Ga0496106_0016217 | Ga0496106_0016217_3930_4715 | 259 |
| 650 | 3300048909 | Ga0496106_0065252 | Ga0496106_0065252_234_1019 | 259 |
| 651 | 3300048910 | Ga0496107_0002391 | Ga0496107_0002391_1610_2395 | 259 |
| 652 | 3300048912 | Ga0496109_0060185 | Ga0496109_0060185_1211_1996 | 259 |
| 653 | 3300048913 | Ga0496110_0123808 | Ga0496110_0123808_620_1405 | 259 |
| 654 | 3300048914 | Ga0496111_0078950 | Ga0496111_0078950_1296_2081 | 259 |
| 655 | 3300048915 | Ga0496112_0052196 | Ga0496112_0052196_1065_1850 | 259 |
| 656 | 3300048916 | Ga0496113_0003901 | Ga0496113_0003901_4478_5263 | 259 |
| 657 | 3300048917 | Ga0496114_0017140 | Ga0496114_0017140_1173_1958 | 259 |
| 658 | 3300048918 | Ga0496115_0073868 | Ga0496115_0073868_1771_2556 | 259 |
| 659 | 3300053119 | Ga0500595_003304 | Ga0500595_003304_3563_4510 | 259 |
| 660 | 3300053162 | Ga0500638_052038 | Ga0500638_052038_743_1690 | 259 |
| 661 | iso_pu_bacteria | 2513237145 | 2513915899 | 259 |
| 662 | iso_pu_bacteria | 2667528175 | 2671119212 | 259 |
| 663 | iso_pu_bacteria | 2906635258 | 2906642441 | 259 |
| 664 | iso_pu_bacteria | 2906660503 | 2906660748 | 259 |
| 665 | iso_pu_bacteria | 2908739725 | 2908745101 | 259 |
| 666 | iso_pu_bacteria | 2935630451 | 2935632226 | 259 |
| 667 | iso_pu_bacteria | 2941507105 | 2941508174 | 259 |
| 668 | iso_pu_bacteria | 2941515067 | 2941515321 | 259 |
| 669 | iso_pu_bacteria | 2941523033 | 2941524104 | 259 |
| 670 | iso_pu_bacteria | 3005474847 | 3005477550 | 259 |
| 671 | iso_pu_bacteria | 8019555841 | 8019559615 | 259 |
| 672 | iso_pu_bacteria | 8019565922 | 8019569718 | 259 |
| 673 | 3300003760 | Ga0055527_1000150 | Ga0055527_100015044 | 260 |
| 674 | 3300003761 | Ga0055535_1000202 | Ga0055535_100020244 | 260 |
| 675 | 3300003762 | Ga0055542_1000237 | Ga0055542_100023744 | 260 |
| 676 | 3300003763 | Ga0055529_1000257 | Ga0055529_100025744 | 260 |
| 677 | 3300003771 | Ga0055526_1006673 | Ga0055526_10066739 | 260 |
| 678 | 3300003781 | Ga0055536_1000203 | Ga0055536_100020310 | 260 |
| 679 | 3300003784 | Ga0055534_1000660 | Ga0055534_10006608 | 260 |
| 680 | 3300003790 | Ga0055528_1000858 | Ga0055528_100085813 | 260 |
| 681 | 3300003856 | Ga0058692_1011333 | Ga0058692_10113332 | 260 |
| 682 | 3300005983 | Ga0081540_1013374 | Ga0081540_10133743 | 260 |
| 683 | 3300013104 | Ga0157370_10027578 | Ga0157370_100275784 | 260 |
| 684 | 3300025228 | Ga0209672_100035 | Ga0209672_10003566 | 260 |
| 685 | 3300025229 | Ga0209147_100041 | Ga0209147_10004166 | 260 |
| 686 | 3300025242 | Ga0209258_100063 | Ga0209258_10006368 | 260 |
| 687 | 3300025254 | Ga0209148_1000088 | Ga0209148_100008866 | 260 |
| 688 | 3300025263 | Ga0209565_1006577 | Ga0209565_10065771 | 260 |
| 689 | 3300025272 | Ga0209455_1000075 | Ga0209455_1000075200 | 260 |
| 690 | 3300025273 | Ga0209673_1000061 | Ga0209673_100006166 | 260 |
| 691 | 3300025284 | Ga0209130_1006540 | Ga0209130_10065406 | 260 |
| 692 | 3300025291 | Ga0209675_1000167 | Ga0209675_100016754 | 260 |
| 693 | 3300025292 | Ga0209676_1000121 | Ga0209676_100012136 | 260 |
| 694 | 3300025294 | Ga0209025_1000051 | Ga0209025_1000051152 | 260 |
| 695 | 3300025295 | Ga0209564_1000133 | Ga0209564_100013331 | 260 |
| 696 | 3300025295 | Ga0209564_1004064 | Ga0209564_10040647 | 260 |
| 697 | 3300026075 | Ga0207708_10005744 | Ga0207708_1000574411 | 260 |
| 698 | 3300026118 | Ga0207675_100115548 | Ga0207675_1001155482 | 260 |
| 699 | 3300027312 | Ga0209371_1000179 | Ga0209371_100017944 | 260 |
| 700 | 3300030500 | Ga0268256_1000149 | Ga0268256_100014943 | 260 |
| 701 | 3300050507 | nmdc:mga05p37_72341_c1 | nmdc:mga05p37_72341_c1_2253_3044 | 260 |
| 702 | 3300001989 | JGI24739J22299_10004632 | JGI24739J22299_100046321 | 261 |
| 703 | 3300003758 | Ga0055532_1001009 | Ga0055532_10010094 | 261 |
| 704 | 3300005563 | Ga0068855_100124512 | Ga0068855_1001245123 | 261 |
| 705 | 3300025229 | Ga0209147_100156 | Ga0209147_10015648 | 261 |
| 706 | 3300025913 | Ga0207695_10154144 | Ga0207695_101541443 | 261 |
| 707 | 3300025949 | Ga0207667_10061099 | Ga0207667_100610994 | 261 |
| 708 | 3300035088 | Ga0373940_0014228 | Ga0373940_0014228_735_1544 | 261 |
| 709 | 3300035092 | Ga0373952_0009842 | Ga0373952_0009842_693_1502 | 261 |
| 710 | 3300035112 | Ga0373932_0041064 | Ga0373932_0041064_160_969 | 261 |
| 711 | 3300035121 | Ga0373960_0004154 | Ga0373960_0004154_2050_2859 | 261 |
| 712 | 3300035207 | Ga0373942_0053073 | Ga0373942_0053073_110_919 | 261 |
| 713 | 3300035241 | Ga0373961_0076659 | Ga0373961_0076659_37_846 | 261 |
| 714 | 3300047323 | Ga0495683_0009551 | Ga0495683_0009551_801_1673 | 261 |
| 715 | 3300048907 | Ga0496104_0056150 | Ga0496104_0056150_2219_3091 | 261 |
| 716 | 3300048908 | Ga0496105_0000318 | Ga0496105_0000318_8927_9799 | 261 |
| 717 | 3300048920 | Ga0496117_0094433 | Ga0496117_0094433_459_1352 | 261 |
| 718 | 3300048921 | Ga0496118_0044513 | Ga0496118_0044513_592_1485 | 261 |
| 719 | 3300048926 | Ga0496123_0096315 | Ga0496123_0096315_694_1587 | 261 |
| 720 | iso_pu_bacteria | 2842475841 | 2842477436 | 261 |
| 721 | iso_pu_bacteria | 2842502639 | 2842504232 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.6005 | 14 | 251 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5589 | 14 | 251 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5462 | 14 | 251 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5191 | 14 | 251 |
| 7xq0-assembly1.cif.gz_A | structure of hslc19a1+3'3'-cda | 0.4053 | 21 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54E81_92_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4859 | 51 | 259 | 1.20.1250.20 |
| af_Q22089_196_351_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4719 | 81 | 252 | 1.20.1250.20 |
| af_Q54E81_92_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4712 | 51 | 259 | 1.20.1250.20 |
| af_Q2G1R0_213_401_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4547 | 53 | 253 | 1.20.1250.20 |
| af_A4IA48_423_647_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.451 | 52 | 256 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2LV15-F1-model_v4 | Probable membrane transporter protein | 0.9604 | 2 | 261 |
GO:0005886
|
| AF-A0A6P2LV15-F1-model_v4 | Probable membrane transporter protein | 0.9533 | 2 | 261 |
GO:0005886
|
| AF-A0A1H8LSJ1-F1-model_v4 | Probable membrane transporter protein | 0.9105 | 11 | 226 |
GO:0005886
|
| AF-A0A1Y5TKU4-F1-model_v4 | Probable membrane transporter protein | 0.9087 | 11 | 256 |
GO:0005886
|
| AF-A0A7X6XQX7-F1-model_v4 | Probable membrane transporter protein | 0.8966 | 14 | 252 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar