F477393

General Info

Members Datasets Scaffolds Average Seq Length
721 373 680 255

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_003304|Ga0500595_003304_3563_4510
Length 315
Sequence MLMLRPDRRSAMLRPIAAFRAIPPAGIHAFPLHRKECQTAPAAAMGLDNIGAGAAVIASAMPEMPGLFTLAIALSGMFLIAFMKGAFGGGFAIVGIPLLSLAMDPITAGALLAPLFVVMDITALHYWRPNTWSRVDLAMLLPALVVGIGLGYFALRDLDRHAVEIVMGAVTLAFVALWFLGGGEVKPRPRSTWKAMLAGLSSGVTTMVAHSGGPPLAIYLLPLGMSKALYAGTTSLFFTVGNLLKAGPWLVLATPSKSLWILMALCVPAVPAGVWAGWRLHERLDQRALYRACYAILVVTAAKLLWDGLAGYVRA

Samples

Sample ID Description Type Environment
1 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
2 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
3 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
4 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543030 Massilia sp. GV097 Isolate Unclassified
10 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
11 2818991452 Burkholderia cepacia 561 Isolate Unclassified
12 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
13 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
14 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
15 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
16 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
17 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
20 2904699407
21 2906610324
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2928170801 Burkholderia sp. 572 Isolate Unclassified
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
43 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
45 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
46 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
116 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
117 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
147 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
213 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
215 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
216 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
235 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
296 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
346 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
347 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
348 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
349 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
350 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
351 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
352 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
353 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
356 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
360 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
365 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
366 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
367 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
368 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
369 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
370 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
371 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
372 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
373 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0
Isolates 5.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.59
Nodule 5.13
Rhizoplane 8.18
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004632 3300001989 Bacteria 5258
2 JGI25159J45721_1000030 3300002987 Bacteria 102429
3 JGI25151J46595_10001370 3300003187 Bacteria 16856
4 JGI25151J46595_10002889 3300003187 Bacteria 9851
5 JGI25406J46586_10000085 3300003203 Bacteria 42549
6 JGI25165J46597_1000975 3300003214 Bacteria 19228
7 rootH2_10065025 3300003320 Bacteria 1425
8 rootH1_10265325 3300003323 Bacteria 1805
9 JGI25160J50197_1000075 3300003354 Bacteria 102429
10 JGI25160J50197_1000524 3300003354 Bacteria 22193
11 JGI25161J50226_1000388 3300003374 Bacteria 22193
12 JGI25161J50226_1000593 3300003374 Bacteria 15214
13 JGI25404J52841_10000831 3300003659 Bacteria 4943
14 Ga0055532_1001009 3300003758 Bacteria 8826
15 Ga0055527_1000150 3300003760 Bacteria 49156
16 Ga0055535_1000202 3300003761 Bacteria 63538
17 Ga0055542_1000237 3300003762 Bacteria 63538
18 Ga0055529_1000257 3300003763 Bacteria 63538
19 Ga0055526_1002008 3300003771 Bacteria 14018
20 Ga0055526_1006673 3300003771 Bacteria 6192
21 Ga0055526_1008700 3300003771 Bacteria 5009
22 Ga0055526_1012200 3300003771 Bacteria 3774
23 Ga0055524_1000014 3300003775 Bacteria 259417
24 Ga0055524_1006932 3300003775 Bacteria 4872
25 Ga0055536_1000203 3300003781 Bacteria 48522
26 Ga0055536_1005974 3300003781 Bacteria 5804
27 Ga0055534_1000660 3300003784 Bacteria 17385
28 Ga0055534_1004256 3300003784 Bacteria 4211
29 Ga0055528_1000858 3300003790 Bacteria 20639
30 Ga0055531_10018718 3300003794 Bacteria 2843
31 Ga0058692_1011333 3300003856 Bacteria 2160
32 Ga0055543_1000168 3300004625 Bacteria 54974
33 Ga0055543_1000449 3300004625 Bacteria 25002
34 Ga0065165_1000206 3300005262 Bacteria 102467
35 Ga0065165_1001476 3300005262 Bacteria 25122
36 Ga0070683_100149183 3300005329 Bacteria 2217
37 Ga0068869_100435843 3300005334 Bacteria 1084
38 Ga0068868_100105920 3300005338 Bacteria 2281
39 Ga0070691_10001016 3300005341 Bacteria 11520
40 Ga0070661_100070893 3300005344 Bacteria 2564
41 Ga0070668_100113315 3300005347 Bacteria 2160
42 Ga0070668_100311228 3300005347 Bacteria 1323
43 Ga0070669_100010500 3300005353 Bacteria 6576
44 Ga0070669_100312136 3300005353 Bacteria 1268
45 Ga0070675_100246230 3300005354 Bacteria 1563
46 Ga0070671_100034409 3300005355 Bacteria 4194
47 Ga0070671_100081155 3300005355 Bacteria 2712
48 Ga0070671_100318680 3300005355 Bacteria 1325
49 Ga0070674_100041548 3300005356 Bacteria 3118
50 Ga0070674_100597411 3300005356 Bacteria 932
51 Ga0070673_100195956 3300005364 Bacteria 1737
52 Ga0070709_10000216 3300005434 Bacteria 37230
53 Ga0070709_10270246 3300005434 Bacteria 1232
54 Ga0070713_100050867 3300005436 Bacteria 3425
55 Ga0070710_10003345 3300005437 Bacteria 7602
56 Ga0070710_10272384 3300005437 Bacteria 1095
57 Ga0070711_100014513 3300005439 Bacteria 4964
58 Ga0070711_100103366 3300005439 Bacteria 2076
59 Ga0070711_100190094 3300005439 Bacteria 1577
60 Ga0070700_100004033 3300005441 Bacteria 7642
61 Ga0070700_100106267 3300005441 Bacteria 1858
62 Ga0070700_100194720 3300005441 Bacteria 1420
63 Ga0070694_100124957 3300005444 Bacteria 1851
64 Ga0070663_100151170 3300005455 Bacteria 1780
65 Ga0070663_100292779 3300005455 Bacteria 1301
66 Ga0070678_100030921 3300005456 Bacteria 3687
67 Ga0070678_100213961 3300005456 Bacteria 1599
68 Ga0070678_100501511 3300005456 Bacteria 1071
69 Ga0070662_100085523 3300005457 Bacteria 2357
70 Ga0070681_10067376 3300005458 Bacteria 3548
71 Ga0068867_100605631 3300005459 Bacteria 956
72 Ga0070685_10148200 3300005466 Bacteria 1485
73 Ga0070706_100201010 3300005467 Bacteria 1862
74 Ga0070699_100055039 3300005518 Bacteria 3446
75 Ga0068853_100740690 3300005539 Bacteria 939
76 Ga0070695_100000381 3300005545 Bacteria 22893
77 Ga0070696_100170054 3300005546 Bacteria 1610
78 Ga0068855_100124512 3300005563 Bacteria 2948
79 Ga0068856_100115164 3300005614 Bacteria 2688
80 Ga0068856_100824728 3300005614 Bacteria 947
81 Ga0068852_100032142 3300005616 Bacteria 4341
82 Ga0068859_100249718 3300005617 Bacteria 1864
83 Ga0068864_100053213 3300005618 Bacteria 3492
84 Ga0068864_100482899 3300005618 Bacteria 1189
85 Ga0068861_100025826 3300005719 Bacteria 4265
86 Ga0068863_100684527 3300005841 Bacteria 1019
87 Ga0068858_100422023 3300005842 Bacteria 1283
88 Ga0068860_100271287 3300005843 Bacteria 1656
89 Ga0068862_100717787 3300005844 Bacteria 970
90 Ga0081455_10015097 3300005937 Bacteria 7519
91 Ga0081540_1001168 3300005983 Bacteria 23063
92 Ga0081540_1001292 3300005983 Bacteria 21853
93 Ga0081540_1001561 3300005983 Bacteria 19619
94 Ga0081540_1004935 3300005983 Bacteria 10034
95 Ga0081540_1010233 3300005983 Bacteria 6371
96 Ga0081540_1013374 3300005983 Bacteria 5340
97 Ga0081540_1024995 3300005983 Bacteria 3452
98 Ga0081540_1037124 3300005983 Bacteria 2587
99 Ga0081540_1046539 3300005983 Bacteria 2189
100 Ga0081540_1047943 3300005983 Bacteria 2144
101 Ga0081540_1059518 3300005983 Bacteria 1833
102 Ga0081540_1064159 3300005983 Bacteria 1734
103 Ga0081540_1082315 3300005983 Bacteria 1444
104 Ga0081540_1105346 3300005983 Bacteria 1205
105 Ga0081539_10000003 3300005985 Bacteria 594833
106 Ga0075365_10080588 3300006038 Bacteria 2204
107 Ga0075365_10081745 3300006038 Bacteria 2190
108 Ga0075363_100023998 3300006048 Bacteria 3097
109 Ga0075363_100114755 3300006048 Bacteria 1500
110 Ga0075363_100159599 3300006048 Bacteria 1276
111 Ga0070716_100011407 3300006173 Bacteria 4473
112 Ga0070716_100386896 3300006173 Bacteria 1001
113 Ga0070712_100056386 3300006175 Bacteria 2756
114 Ga0070712_100174541 3300006175 Bacteria 1670
115 Ga0075362_10013528 3300006177 Bacteria 3269
116 Ga0075362_10014315 3300006177 Bacteria 3198
117 Ga0075362_10194877 3300006177 Bacteria 985
118 Ga0075367_10009837 3300006178 Bacteria 5010
119 Ga0075367_10176499 3300006178 Bacteria 1331
120 Ga0075367_10176815 3300006178 Bacteria 1330
121 Ga0075369_10004647 3300006186 Bacteria 5092
122 Ga0075369_10071047 3300006186 Bacteria 1532
123 Ga0075369_10137584 3300006186 Bacteria 1112
124 Ga0075366_10024023 3300006195 Bacteria 3554
125 Ga0097621_100197921 3300006237 Bacteria 1743
126 Ga0097621_100484999 3300006237 Bacteria 1118
127 Ga0075370_10031353 3300006353 Bacteria 2967
128 Ga0075370_10283004 3300006353 Bacteria 985
129 Ga0068871_100139043 3300006358 Bacteria 2064
130 Ga0075428_100440920 3300006844 Bacteria 1395
131 Ga0075433_10007299 3300006852 Bacteria 8766
132 Ga0075434_100011869 3300006871 Bacteria 8235
133 Ga0075434_100187476 3300006871 Bacteria 2089
134 Ga0068865_100248066 3300006881 Bacteria 1404
135 Ga0068865_100341054 3300006881 Bacteria 1211
136 Ga0068865_100382044 3300006881 Bacteria 1149
137 Ga0097620_100249719 3300006931 Bacteria 1864
138 Ga0099823_1016936 3300006944 Bacteria 7127
139 Ga0099823_1018785 3300006944 Bacteria 6648
140 Ga0099826_10000013 3300006948 Bacteria 265459
141 Ga0099795_10065222 3300007788 Bacteria 1361
142 Ga0099795_10104886 3300007788 Bacteria 1113
143 Ga0105251_10016616 3300009011 Bacteria 3968
144 Ga0105251_10021512 3300009011 Bacteria 3365
145 Ga0105250_10010707 3300009092 Bacteria 3817
146 Ga0111539_10891516 3300009094 Bacteria 1035
147 Ga0105245_10049804 3300009098 Bacteria 3752
148 Ga0105245_10079949 3300009098 Bacteria 2986
149 Ga0105245_10230938 3300009098 Bacteria 1789
150 Ga0105245_10404395 3300009098 Bacteria 1365
151 Ga0105247_10257099 3300009101 Bacteria 1196
152 Ga0105247_10325575 3300009101 Bacteria 1074
153 Ga0114129_10196308 3300009147 Bacteria 2736
154 Ga0105243_10179674 3300009148 Bacteria 1839
155 Ga0105243_10336116 3300009148 Bacteria 1382
156 Ga0105243_10387330 3300009148 Bacteria 1295
157 Ga0105243_10621299 3300009148 Bacteria 1043
158 Ga0105241_10035047 3300009174 Bacteria 3774
159 Ga0105241_10064819 3300009174 Bacteria 2822
160 Ga0105242_10084686 3300009176 Bacteria 2657
161 Ga0105242_10362484 3300009176 Bacteria 1342
162 Ga0105248_10034058 3300009177 Bacteria 5693
163 Ga0105248_10054096 3300009177 Bacteria 4501
164 Ga0105248_10194397 3300009177 Bacteria 2286
165 Ga0105237_10030235 3300009545 Bacteria 5503
166 Ga0105237_10130535 3300009545 Bacteria 2507
167 Ga0105237_10231480 3300009545 Bacteria 1849
168 Ga0105237_10264745 3300009545 Bacteria 1722
169 Ga0105237_10518106 3300009545 Bacteria 1199
170 Ga0105238_10289878 3300009551 Bacteria 1619
171 Ga0105238_10874636 3300009551 Bacteria 916
172 Ga0105249_10074635 3300009553 Bacteria 3139
173 Ga0105249_10302474 3300009553 Bacteria 1605
174 Ga0105249_10889471 3300009553 Bacteria 957
175 Ga0099796_10046893 3300010159 Bacteria 1485
176 Ga0105239_10011851 3300010375 Bacteria 9727
177 Ga0105239_10012140 3300010375 Bacteria 9606
178 Ga0105239_10075944 3300010375 Bacteria 3695
179 Ga0105239_10421767 3300010375 Bacteria 1512
180 Ga0105246_10083115 3300011119 Bacteria 2287
181 Ga0105246_10098459 3300011119 Bacteria 2124
182 Ga0105246_10191172 3300011119 Bacteria 1584
183 Ga0105246_10501948 3300011119 Bacteria 1030
184 Ga0157370_10027578 3300013104 Bacteria 5599
185 Ga0157370_10168772 3300013104 Bacteria 2034
186 Ga0157374_10080954 3300013296 Bacteria 3081
187 Ga0157374_10258654 3300013296 Bacteria 1714
188 Ga0163162_10124775 3300013306 Bacteria 2680
189 Ga0163162_10141115 3300013306 Bacteria 2523
190 Ga0157375_10018732 3300013308 Bacteria 6282
191 Ga0157375_10112761 3300013308 Bacteria 2820
192 Ga0157375_10255364 3300013308 Bacteria 1914
193 Ga0157375_10422745 3300013308 Bacteria 1499
194 Ga0163163_10174349 3300014325 Bacteria 2197
195 Ga0163163_10175381 3300014325 Bacteria 2190
196 Ga0163163_10214567 3300014325 Bacteria 1974
197 Ga0163163_10333207 3300014325 Bacteria 1572
198 Ga0157380_10340015 3300014326 Bacteria 1400
199 Ga0157380_10461206 3300014326 Bacteria 1223
200 Ga0157377_10160862 3300014745 Bacteria 1396
201 Ga0157377_10203701 3300014745 Bacteria 1258
202 Ga0157379_10780084 3300014968 Bacteria 901
203 Ga0157376_10019174 3300014969 Bacteria 5264
204 Ga0157376_10143567 3300014969 Bacteria 2144
205 Ga0157376_10667290 3300014969 Bacteria 1042
206 Ga0182007_10000608 3300015262 Bacteria 20908
207 Ga0182005_1014887 3300015265 Bacteria 2174
208 Ga0163161_10053658 3300017792 Bacteria 2924
209 Ga0163161_10059876 3300017792 Bacteria 2770
210 Ga0163161_10207646 3300017792 Bacteria 1512
211 Ga0214542_1027346 3300021321 Bacteria 2626
212 Ga0214543_1001580 3300021327 Bacteria 44273
213 Ga0213872_10000907 3300021361 Bacteria 21260
214 Ga0213872_10001086 3300021361 Bacteria 18698
215 Ga0213872_10001611 3300021361 Bacteria 14275
216 Ga0213872_10001866 3300021361 Bacteria 13028
217 Ga0213872_10028434 3300021361 Bacteria 2563
218 Ga0213872_10104833 3300021361 Bacteria 1258
219 Ga0209672_100035 3300025228 Bacteria 303111
220 Ga0209147_100041 3300025229 Bacteria 303111
221 Ga0209147_100156 3300025229 Bacteria 93105
222 Ga0209437_100858 3300025233 Bacteria 12861
223 Ga0209258_100063 3300025242 Bacteria 303577
224 Ga0209148_1000088 3300025254 Bacteria 258188
225 Ga0209233_1000584 3300025261 Bacteria 19289
226 Ga0209233_1001106 3300025261 Bacteria 11025
227 Ga0209233_1010556 3300025261 Bacteria 2761
228 Ga0209565_1000201 3300025263 Bacteria 71408
229 Ga0209565_1006577 3300025263 Bacteria 3245
230 Ga0209455_1000075 3300025272 Bacteria 285430
231 Ga0209455_1002576 3300025272 Bacteria 6913
232 Ga0209673_1000036 3300025273 Bacteria 323162
233 Ga0209673_1000061 3300025273 Bacteria 262274
234 Ga0209130_1000154 3300025284 Bacteria 102645
235 Ga0209130_1000409 3300025284 Bacteria 46757
236 Ga0209130_1006540 3300025284 Bacteria 3766
237 Ga0209675_1000013 3300025291 Bacteria 448220
238 Ga0209675_1000167 3300025291 Bacteria 79477
239 Ga0209675_1007498 3300025291 Bacteria 4174
240 Ga0209676_1000121 3300025292 Bacteria 198920
241 Ga0209676_1005963 3300025292 Bacteria 6163
242 Ga0209025_1000032 3300025294 Bacteria 416141
243 Ga0209025_1000051 3300025294 Bacteria 330080
244 Ga0209025_1001002 3300025294 Bacteria 41890
245 Ga0209025_1008061 3300025294 Bacteria 7670
246 Ga0209564_1000025 3300025295 Bacteria 520535
247 Ga0209564_1000133 3300025295 Bacteria 189140
248 Ga0209564_1000240 3300025295 Bacteria 118922
249 Ga0209564_1000434 3300025295 Bacteria 72534
250 Ga0209564_1000578 3300025295 Bacteria 58027
251 Ga0209564_1003386 3300025295 Bacteria 10994
252 Ga0209564_1004064 3300025295 Bacteria 9225
253 Ga0209564_1019204 3300025295 Bacteria 2566
254 Ga0209758_1000868 3300025297 Bacteria 41599
255 Ga0209050_1019218 3300025298 Bacteria 2608
256 Ga0209256_1000052 3300025299 Bacteria 299374
257 Ga0209256_1000801 3300025299 Bacteria 40223
258 Ga0209256_1009401 3300025299 Bacteria 4296
259 Ga0207426_1000269 3300025302 Bacteria 109050
260 Ga0207426_1000286 3300025302 Bacteria 102853
261 Ga0207426_1000439 3300025302 Bacteria 67107
262 Ga0209051_1015854 3300025303 Bacteria 3449
263 Ga0209257_1005525 3300025304 Bacteria 8814
264 Ga0209257_1012653 3300025304 Bacteria 3867
265 Ga0207697_10053949 3300025315 Bacteria 1665
266 Ga0207697_10059965 3300025315 Bacteria 1582
267 Ga0207713_1055515 3300025735 Bacteria 1545
268 Ga0207692_10001498 3300025898 Bacteria 8769
269 Ga0207688_10060451 3300025901 Bacteria 2134
270 Ga0207688_10063154 3300025901 Bacteria 2089
271 Ga0207688_10078029 3300025901 Bacteria 1888
272 Ga0207647_10024012 3300025904 Bacteria 4023
273 Ga0207647_10253591 3300025904 Bacteria 1008
274 Ga0207685_10104914 3300025905 Bacteria 1215
275 Ga0207699_10001209 3300025906 Bacteria 12241
276 Ga0207699_10229295 3300025906 Bacteria 1271
277 Ga0207645_10081665 3300025907 Bacteria 2072
278 Ga0207684_10296148 3300025910 Bacteria 1395
279 Ga0207654_10066590 3300025911 Bacteria 2125
280 Ga0207707_10162591 3300025912 Bacteria 1952
281 Ga0207695_10154144 3300025913 Bacteria 2233
282 Ga0207671_10222242 3300025914 Bacteria 1480
283 Ga0207693_10021080 3300025915 Bacteria 5180
284 Ga0207693_10032038 3300025915 Bacteria 4151
285 Ga0207693_10174175 3300025915 Bacteria 1693
286 Ga0207693_10201893 3300025915 Bacteria 1563
287 Ga0207693_10344303 3300025915 Bacteria 1167
288 Ga0207663_10001932 3300025916 Bacteria 9814
289 Ga0207663_10124266 3300025916 Bacteria 1772
290 Ga0207649_10093549 3300025920 Bacteria 1973
291 Ga0207694_10080092 3300025924 Bacteria 2563
292 Ga0207650_10479750 3300025925 Bacteria 1038
293 Ga0207687_10025333 3300025927 Bacteria 3970
294 Ga0207687_10110474 3300025927 Bacteria 2039
295 Ga0207687_10221890 3300025927 Bacteria 1489
296 Ga0207700_10058522 3300025928 Bacteria 2911
297 Ga0207664_10050921 3300025929 Bacteria 3268
298 Ga0207644_10126042 3300025931 Bacteria 1955
299 Ga0207706_10005893 3300025933 Bacteria 11399
300 Ga0207686_10137816 3300025934 Bacteria 1682
301 Ga0207686_10299409 3300025934 Bacteria 1194
302 Ga0207709_10116283 3300025935 Bacteria 1798
303 Ga0207709_10306939 3300025935 Bacteria 1182
304 Ga0207665_10019548 3300025939 Bacteria 4454
305 Ga0207665_10234163 3300025939 Bacteria 1351
306 Ga0207691_10227241 3300025940 Bacteria 1617
307 Ga0207691_10312468 3300025940 Bacteria 1348
308 Ga0207711_10048075 3300025941 Bacteria 3649
309 Ga0207711_10141715 3300025941 Bacteria 2163
310 Ga0207711_10404783 3300025941 Bacteria 1268
311 Ga0207689_10005976 3300025942 Bacteria 10768
312 Ga0207689_10204640 3300025942 Bacteria 1630
313 Ga0207689_10206622 3300025942 Bacteria 1622
314 Ga0207667_10061099 3300025949 Bacteria 3943
315 Ga0207712_10256372 3300025961 Bacteria 1416
316 Ga0207712_10441389 3300025961 Bacteria 1102
317 Ga0207668_10007990 3300025972 Bacteria 6296
318 Ga0207668_10123377 3300025972 Bacteria 1965
319 Ga0207668_10206681 3300025972 Bacteria 1567
320 Ga0207658_10119941 3300025986 Bacteria 2095
321 Ga0207703_10166302 3300026035 Bacteria 1936
322 Ga0207703_10168249 3300026035 Bacteria 1926
323 Ga0207703_10231864 3300026035 Bacteria 1655
324 Ga0207678_10053206 3300026067 Bacteria 3490
325 Ga0207678_10118746 3300026067 Bacteria 2257
326 Ga0207678_10288341 3300026067 Bacteria 1410
327 Ga0207708_10005744 3300026075 Bacteria 9168
328 Ga0207708_10021747 3300026075 Bacteria 4840
329 Ga0207708_10145077 3300026075 Bacteria 1865
330 Ga0207708_10339450 3300026075 Bacteria 1230
331 Ga0207641_10312969 3300026088 Bacteria 1487
332 Ga0207641_10420258 3300026088 Bacteria 1287
333 Ga0207648_10598162 3300026089 Bacteria 1016
334 Ga0207648_10659761 3300026089 Bacteria 967
335 Ga0207676_10264548 3300026095 Bacteria 1554
336 Ga0207674_10208086 3300026116 Bacteria 1905
337 Ga0207675_100045363 3300026118 Bacteria 4107
338 Ga0207675_100115548 3300026118 Bacteria 2536
339 Ga0207683_10073252 3300026121 Bacteria 3030
340 Ga0207683_10088006 3300026121 Bacteria 2763
341 Ga0207683_10090469 3300026121 Bacteria 2725
342 Ga0207683_10121405 3300026121 Bacteria 2346
343 Ga0207698_10306334 3300026142 Bacteria 1481
344 Ga0209389_1008948 3300027296 Bacteria 8938
345 Ga0209389_1010024 3300027296 Bacteria 8516
346 Ga0209371_1000179 3300027312 Bacteria 93861
347 Ga0209589_1000676 3300027357 Bacteria 49982
348 Ga0209489_100062 3300027361 Bacteria 145478
349 Ga0209489_111509 3300027361 Bacteria 8938
350 Ga0209489_111839 3300027361 Bacteria 8516
351 Ga0209700_110927 3300027363 Bacteria 8938
352 Ga0209700_111242 3300027363 Bacteria 8516
353 Ga0209282_1000043 3300027666 Bacteria 119260
354 Ga0209588_1014646 3300027671 Bacteria 2403
355 Ga0268266_10009304 3300028379 Bacteria 8665
356 Ga0268266_10193947 3300028379 Bacteria 1856
357 Ga0268265_10005524 3300028380 Bacteria 8627
358 Ga0268265_10139082 3300028380 Bacteria 2030
359 Ga0268265_10243572 3300028380 Bacteria 1588
360 Ga0268264_10367337 3300028381 Bacteria 1374
361 Ga0268264_10368601 3300028381 Bacteria 1372
362 Ga0307515_10000160 3300028794 Bacteria 164789
363 Ga0268256_1000149 3300030500 Bacteria 93861
364 Ga0307513_10326741 3300031456 Bacteria 1290
365 Ga0307516_10310350 3300031730 Bacteria 1251
366 Ga0307510_10010555 3300033180 Bacteria 10973
367 Ga0307510_10052806 3300033180 Bacteria 4279
368 Ga0307510_10209592 3300033180 Bacteria 1473
369 Ga0315911_1000006 3300033442 Bacteria 414563
370 Ga0315911_1000010 3300033442 Bacteria 322197
371 Ga0373940_0014228 3300035088 Bacteria 1938
372 Ga0373952_0009842 3300035092 Bacteria 1838
373 Ga0373932_0041064 3300035112 Bacteria 1335
374 Ga0373945_0098173 3300035116 Bacteria 1143
375 Ga0373960_0004154 3300035121 Bacteria 3308
376 Ga0373943_0050055 3300035170 Bacteria 2052
377 Ga0373942_0053073 3300035207 Bacteria 1142
378 Ga0373961_0076659 3300035241 Bacteria 1044
379 Ga0373931_0002876 3300035691 Bacteria 7672
380 Ga0373931_0140751 3300035691 Bacteria 1397
381 Ga0373927_0005782 3300035695 Bacteria 8489
382 Ga0373927_0016306 3300035695 Bacteria 4902
383 Ga0373947_0004169 3300035725 Bacteria 8492
384 Ga0373947_0037380 3300035725 Bacteria 2881
385 Ga0373925_0062663 3300037068 Bacteria 2797
386 Ga0395905_0031525 3300037471 Bacteria 4991
387 Ga0395905_0280648 3300037471 Bacteria 1552
388 Ga0436365_0913976 3300039437 Bacteria 2063
389 Ga0436365_0931078 3300039437 Bacteria 2910
390 Ga0436365_1178230 3300039437 Bacteria 1949
391 Ga0436365_1769494 3300039437 Bacteria 1192
392 Ga0436360_0148226 3300039438 Bacteria 1326
393 Ga0436360_0731023 3300039438 Bacteria 1774
394 Ga0436360_1020232 3300039438 Bacteria 2296
395 Ga0436361_0082970 3300039447 Bacteria 8400
396 Ga0436361_0091951 3300039447 Bacteria 10819
397 Ga0436361_0096149 3300039447 Bacteria 15910
398 Ga0436361_0201274 3300039447 Bacteria 3163
399 Ga0436361_0204659 3300039447 Bacteria 10676
400 Ga0436361_0262026 3300039447 Bacteria 30890
401 Ga0436361_0277135 3300039447 Bacteria 3682
402 Ga0436361_0681104 3300039447 Bacteria 24321
403 Ga0436361_0796193 3300039447 Bacteria 1244
404 Ga0436361_0827273 3300039447 Bacteria 14015
405 Ga0436361_1011321 3300039447 Bacteria 1200
406 Ga0436361_1085489 3300039447 Bacteria 1823
407 Ga0436363_0540076 3300039450 Bacteria 1167
408 Ga0436362_0514368 3300039453 Bacteria 2928
409 Ga0439452_033630 3300042010 Bacteria 1244
410 Ga0466964_0027182 3300044706 Bacteria 2245
411 Ga0466960_0055738 3300044901 Bacteria 1923
412 Ga0466967_0312108 3300045976 Bacteria 1515
413 Ga0495603_0006194 3300046455 Bacteria 7154
414 Ga0495603_0177132 3300046455 Bacteria 1234
415 Ga0495591_000251 3300046458 Bacteria 51890
416 Ga0495638_0007874 3300046460 Bacteria 7603
417 Ga0495641_0034815 3300046461 Bacteria 2378
418 Ga0495650_0051104 3300046471 Bacteria 1705
419 Ga0495580_0262535 3300046472 Bacteria 1181
420 Ga0495605_0018977 3300046474 Bacteria 3680
421 Ga0495605_0031954 3300046474 Bacteria 2684
422 Ga0495605_0047395 3300046474 Bacteria 2108
423 Ga0495605_0047792 3300046474 Unclassified 2097
424 Ga0495664_0400051 3300046477 Bacteria 825
425 Ga0495584_0000007 3300046491 Bacteria 294820
426 Ga0495584_0000018 3300046491 Bacteria 142382
427 Ga0495584_0000901 3300046491 Bacteria 19022
428 Ga0495585_0000003 3300046492 Bacteria 406344
429 Ga0495585_0000264 3300046492 Bacteria 52455
430 Ga0495585_0001279 3300046492 Bacteria 20094
431 Ga0495585_0006146 3300046492 Bacteria 7492
432 Ga0495585_0020057 3300046492 Bacteria 3846
433 Ga0495596_0001236 3300046500 Bacteria 14883
434 Ga0495596_0005439 3300046500 Bacteria 6016
435 Ga0495596_0077643 3300046500 Bacteria 1289
436 Ga0495607_0007789 3300046501 Bacteria 7373
437 Ga0495607_0030451 3300046501 Bacteria 3313
438 Ga0495583_0001238 3300046506 Bacteria 27122
439 Ga0495583_0004255 3300046506 Bacteria 10381
440 Ga0495583_0008979 3300046506 Bacteria 6028
441 Ga0495583_0039461 3300046506 Bacteria 2224
442 Ga0495606_0001356 3300046507 Bacteria 33234
443 Ga0495606_0002146 3300046507 Bacteria 23772
444 Ga0495606_0036483 3300046507 Bacteria 3347
445 Ga0495606_0042940 3300046507 Bacteria 3020
446 Ga0495606_0063805 3300046507 Bacteria 2347
447 Ga0495616_0000228 3300046513 Bacteria 46105
448 Ga0495616_0003233 3300046513 Bacteria 10486
449 Ga0495616_0003675 3300046513 Bacteria 9798
450 Ga0495616_0015489 3300046513 Bacteria 4240
451 Ga0495616_0034720 3300046513 Bacteria 2616
452 Ga0495620_0001264 3300046515 Bacteria 15433
453 Ga0495630_0122386 3300046517 Bacteria 1974
454 Ga0495631_0000090 3300046518 Bacteria 59264
455 Ga0495632_0000681 3300046519 Bacteria 31033
456 Ga0495632_0169762 3300046519 Bacteria 1003
457 Ga0495643_0013974 3300046522 Bacteria 4786
458 Ga0495643_0037229 3300046522 Bacteria 2670
459 Ga0495643_0063433 3300046522 Bacteria 1954
460 Ga0495643_0151802 3300046522 Bacteria 1147
461 Ga0495648_0000171 3300046524 Bacteria 74494
462 Ga0495648_0003560 3300046524 Bacteria 13627
463 Ga0495648_0005173 3300046524 Bacteria 10916
464 Ga0495648_0010240 3300046524 Bacteria 7161
465 Ga0495648_0029940 3300046524 Bacteria 3606
466 Ga0495648_0078434 3300046524 Unclassified 1888
467 Ga0495648_0083356 3300046524 Bacteria 1812
468 Ga0495642_0003682 3300046528 Bacteria 6015
469 Ga0495654_0007039 3300046530 Bacteria 6331
470 Ga0495609_0000566 3300046538 Bacteria 29042
471 Ga0495609_0020794 3300046538 Bacteria 3029
472 Ga0495609_0034901 3300046538 Unclassified 2278
473 Ga0495609_0038300 3300046538 Bacteria 2162
474 Ga0495597_0008221 3300046542 Bacteria 5244
475 Ga0495622_0069563 3300046557 Bacteria 1625
476 Ga0495622_0085362 3300046557 Bacteria 1452
477 Ga0495633_0000702 3300046558 Bacteria 30531
478 Ga0495633_0013203 3300046558 Bacteria 4362
479 Ga0495633_0031351 3300046558 Bacteria 2578
480 Ga0495656_0054638 3300046615 Bacteria 1719
481 Ga0495668_0000094 3300046616 Bacteria 141412
482 Ga0495668_0000129 3300046616 Bacteria 113044
483 Ga0495668_0007639 3300046616 Bacteria 6883
484 Ga0495668_0009157 3300046616 Bacteria 6101
485 Ga0495668_0145382 3300046616 Bacteria 1298
486 Ga0495611_0013495 3300046648 Bacteria 3479
487 Ga0495611_0077769 3300046648 Bacteria 1522
488 Ga0495611_0185090 3300046648 Bacteria 973
489 Ga0495625_0003017 3300046660 Bacteria 17334
490 Ga0495625_0007263 3300046660 Bacteria 9691
491 Ga0495625_0026997 3300046660 Bacteria 4329
492 Ga0495625_0128561 3300046660 Bacteria 1718
493 Ga0495659_0008109 3300046664 Bacteria 3338
494 Ga0495659_0077495 3300046664 Bacteria 1256
495 Ga0495661_0011409 3300046665 Bacteria 6032
496 Ga0495661_0037066 3300046665 Bacteria 3046
497 Ga0495661_0081364 3300046665 Bacteria 1866
498 Ga0495588_0316572 3300046674 Bacteria 821
499 Ga0495669_0035469 3300046684 Bacteria 2202
500 Ga0495670_0000770 3300046691 Bacteria 15357
501 Ga0495671_0004568 3300046692 Bacteria 8237
502 Ga0495671_0011654 3300046692 Bacteria 4824
503 Ga0495671_0013199 3300046692 Bacteria 4484
504 Ga0495671_0036772 3300046692 Bacteria 2479
505 Ga0495671_0270782 3300046692 Bacteria 819
506 Ga0495649_0003412 3300046694 Bacteria 10738
507 Ga0495649_0026960 3300046694 Bacteria 3190
508 Ga0495589_0000033 3300046794 Bacteria 162794
509 Ga0495660_0001774 3300046810 Bacteria 14278
510 Ga0495660_0002528 3300046810 Bacteria 11661
511 Ga0495660_0025127 3300046810 Bacteria 3385
512 Ga0495660_0169777 3300046810 Bacteria 1063
513 Ga0495674_0264219 3300047319 Bacteria 1413
514 Ga0495672_0011421 3300047320 Bacteria 6269
515 Ga0495672_0050386 3300047320 Bacteria 2457
516 Ga0495676_0119583 3300047321 Bacteria 1919
517 Ga0495683_0000083 3300047323 Bacteria 93743
518 Ga0495683_0001589 3300047323 Bacteria 14641
519 Ga0495683_0002730 3300047323 Bacteria 10522
520 Ga0495683_0005834 3300047323 Bacteria 6775
521 Ga0495683_0009551 3300047323 Bacteria 5167
522 Ga0495683_0018287 3300047323 Bacteria 3626
523 Ga0495683_0066995 3300047323 Bacteria 1768
524 Ga0495683_0087202 3300047323 Bacteria 1516
525 Ga0495683_0215841 3300047323 Bacteria 858
526 Ga0495687_000017 3300047443 Bacteria 350429
527 Ga0495687_009263 3300047443 Bacteria 5528
528 Ga0495687_084482 3300047443 Bacteria 1234
529 Ga0495679_007526 3300047446 Bacteria 4526
530 Ga0495679_043286 3300047446 Bacteria 1385
531 Ga0495685_000938 3300047447 Bacteria 8820
532 Ga0495685_004641 3300047447 Bacteria 4454
533 Ga0495673_0003848 3300047469 Bacteria 9682
534 Ga0495673_0005900 3300047469 Bacteria 7314
535 Ga0495673_0028679 3300047469 Bacteria 2634
536 Ga0495673_0177686 3300047469 Bacteria 808
537 Ga0495681_0005657 3300047470 Bacteria 8326
538 Ga0495684_0329700 3300047471 Bacteria 1089
539 Ga0495593_0044363 3300047673 Bacteria 2379
540 Ga0495626_0001391 3300048091 Bacteria 19406
541 Ga0496100_0021982 3300048903 Bacteria 3852
542 Ga0496100_0036374 3300048903 Bacteria 3105
543 Ga0496100_0151990 3300048903 Bacteria 1652
544 Ga0496101_0009247 3300048904 Bacteria 6471
545 Ga0496101_0242695 3300048904 Bacteria 1402
546 Ga0496102_0006087 3300048905 Bacteria 10289
547 Ga0496102_0006237 3300048905 Bacteria 10164
548 Ga0496102_0018498 3300048905 Bacteria 6124
549 Ga0496102_0210877 3300048905 Bacteria 1831
550 Ga0496102_0558935 3300048905 Bacteria 1067
551 Ga0496103_0038267 3300048906 Bacteria 2942
552 Ga0496103_0050426 3300048906 Bacteria 2575
553 Ga0496103_0094082 3300048906 Bacteria 1893
554 Ga0496104_0004902 3300048907 Bacteria 11673
555 Ga0496104_0048949 3300048907 Bacteria 3985
556 Ga0496104_0056150 3300048907 Bacteria 3723
557 Ga0496104_0083602 3300048907 Bacteria 3044
558 Ga0496105_0000318 3300048908 Bacteria 31631
559 Ga0496105_0009330 3300048908 Bacteria 7670
560 Ga0496105_0017517 3300048908 Bacteria 5746
561 Ga0496105_0038302 3300048908 Bacteria 3950
562 Ga0496105_0287710 3300048908 Bacteria 1324
563 Ga0496106_0016217 3300048909 Bacteria 5511
564 Ga0496106_0026512 3300048909 Bacteria 4316
565 Ga0496106_0039933 3300048909 Bacteria 3514
566 Ga0496106_0065252 3300048909 Bacteria 2772
567 Ga0496106_0298450 3300048909 Bacteria 1292
568 Ga0496107_0002391 3300048910 Bacteria 12143
569 Ga0496107_0003592 3300048910 Bacteria 10401
570 Ga0496108_0137938 3300048911 Bacteria 2100
571 Ga0496108_0429783 3300048911 Bacteria 1153
572 Ga0496109_0034401 3300048912 Bacteria 4563
573 Ga0496109_0060185 3300048912 Bacteria 3470
574 Ga0496109_0143239 3300048912 Bacteria 2235
575 Ga0496109_0165578 3300048912 Bacteria 2072
576 Ga0496109_0198344 3300048912 Bacteria 1887
577 Ga0496109_0258248 3300048912 Bacteria 1641
578 Ga0496110_0046958 3300048913 Bacteria 3779
579 Ga0496110_0123808 3300048913 Bacteria 2331
580 Ga0496110_0160483 3300048913 Bacteria 2038
581 Ga0496110_0319451 3300048913 Bacteria 1414
582 Ga0496111_0045682 3300048914 Bacteria 3152
583 Ga0496111_0078950 3300048914 Bacteria 2400
584 Ga0496112_0052196 3300048915 Bacteria 4012
585 Ga0496112_0138190 3300048915 Bacteria 2406
586 Ga0496112_0339272 3300048915 Bacteria 1446
587 Ga0496113_0003901 3300048916 Bacteria 9039
588 Ga0496113_0088444 3300048916 Bacteria 2383
589 Ga0496113_0191174 3300048916 Bacteria 1625
590 Ga0496113_0191469 3300048916 Bacteria 1623
591 Ga0496114_0017140 3300048917 Bacteria 5842
592 Ga0496114_0179980 3300048917 Bacteria 1846
593 Ga0496114_0557354 3300048917 Bacteria 1012
594 Ga0496115_0013677 3300048918 Bacteria 6144
595 Ga0496115_0073868 3300048918 Bacteria 2768
596 Ga0496115_0089701 3300048918 Bacteria 2511
597 Ga0496115_0095385 3300048918 Bacteria 2435
598 Ga0496116_0004369 3300048919 Bacteria 13514
599 Ga0496116_0105368 3300048919 Bacteria 1673
600 Ga0496116_0244197 3300048919 Bacteria 899
601 Ga0496117_0002629 3300048920 Bacteria 22276
602 Ga0496117_0055074 3300048920 Bacteria 2782
603 Ga0496117_0094433 3300048920 Bacteria 1914
604 Ga0496117_0141950 3300048920 Bacteria 1437
605 Ga0496118_0000966 3300048921 Bacteria 44919
606 Ga0496118_0031253 3300048921 Bacteria 4419
607 Ga0496118_0044513 3300048921 Bacteria 3475
608 Ga0496118_0054891 3300048921 Bacteria 3013
609 Ga0496118_0104009 3300048921 Bacteria 1908
610 Ga0496119_0016165 3300048922 Bacteria 5698
611 Ga0496119_0023355 3300048922 Bacteria 4390
612 Ga0496120_0013451 3300048923 Bacteria 5506
613 Ga0496121_0002217 3300048924 Bacteria 30352
614 Ga0496121_0015838 3300048924 Bacteria 7843
615 Ga0496121_0137735 3300048924 Bacteria 1816
616 Ga0496121_0262874 3300048924 Bacteria 1190
617 Ga0496121_0317503 3300048924 Bacteria 1050
618 Ga0496122_0000043 3300048925 Bacteria 280333
619 Ga0496122_0000908 3300048925 Bacteria 54441
620 Ga0496123_0000090 3300048926 Bacteria 179735
621 Ga0496123_0000412 3300048926 Bacteria 78170
622 Ga0496123_0020702 3300048926 Bacteria 5138
623 Ga0496123_0096315 3300048926 Bacteria 1738
624 Ga0496124_0180048 3300048927 Bacteria 1627
625 Ga0496125_0000051 3300048928 Bacteria 285754
626 Ga0496125_0311741 3300048928 Bacteria 958
627 Ga0496126_0007725 3300048929 Bacteria 11734
628 Ga0496126_0022164 3300048929 Bacteria 6187
629 Ga0496126_0143739 3300048929 Bacteria 2051
630 Ga0495678_003182 3300049459 Bacteria 10343
631 Ga0495682_0001062 3300049460 Bacteria 16167
632 Ga0495682_0007135 3300049460 Bacteria 4465
633 nmdc:mga03n38_276029_c1 3300050490 Bacteria 896
634 nmdc:mga03n38_45650_c1 3300050490 Bacteria 1930
635 nmdc:mga00v17_62136_c1 3300050491 Bacteria 2297
636 nmdc:mga0k408_154697_c1 3300050493 Bacteria 1366
637 nmdc:mga06z11_158517_c1 3300050494 Bacteria 1292
638 nmdc:mga06z11_21857_c1 3300050494 Bacteria 2979
639 nmdc:mga06z11_357388_c1 3300050494 Bacteria 875
640 nmdc:mga06z11_61061_c1 3300050494 Bacteria 1965
641 nmdc:mga04h51_4538_c1 3300050495 Bacteria 3466
642 nmdc:mga07m45_242283_c1 3300050496 Bacteria 1049
643 nmdc:mga07m45_5932_c1 3300050496 Bacteria 6131
644 nmdc:mga05p37_705158_c1 3300050507 Bacteria 1120
645 nmdc:mga05p37_72341_c1 3300050507 Bacteria 4242
646 nmdc:mga08y16_34670_c1 3300050511 Bacteria 5302
647 nmdc:mga0n895_182164_c1 3300050512 Bacteria 2132
648 nmdc:mga0n895_502_c1 3300050512 Bacteria 26508
649 nmdc:mga0a205_4465_c1 3300050515 Bacteria 12556
650 nmdc:mga0sz30_32577_c1 3300050516 Bacteria 2162
651 nmdc:mga0sz30_53526_c2 3300050516 Bacteria 1155
652 nmdc:mga0sz30_84720_c1 3300050516 Bacteria 1375
653 Ga0500635_0037167 3300053080 Bacteria 1609
654 Ga0500643_000015 3300053087 Bacteria 310312
655 Ga0500555_009621 3300053103 Bacteria 2765
656 Ga0500556_0006082 3300053104 Bacteria 3421
657 Ga0500556_0044133 3300053104 Bacteria 1585
658 Ga0500562_003619 3300053108 Bacteria 3879
659 Ga0500569_004065 3300053109 Bacteria 3047
660 Ga0500592_005045 3300053116 Bacteria 2098
661 Ga0500594_0020507 3300053118 Bacteria 1650
662 Ga0500595_003304 3300053119 Bacteria 7595
663 Ga0500642_0078492 3300053130 Bacteria 1513
664 Ga0500564_093306 3300053138 Bacteria 1338
665 Ga0500577_0140046 3300053142 Bacteria 1020
666 Ga0500616_0013901 3300053153 Bacteria 4647
667 Ga0500619_036813 3300053154 Bacteria 1525
668 Ga0500620_021597 3300053155 Bacteria 1926
669 Ga0500622_0025216 3300053156 Bacteria 3142
670 Ga0500627_0038138 3300053158 Bacteria 2053
671 Ga0500633_0013380 3300053160 Bacteria 2298
672 Ga0500638_052038 3300053162 Bacteria 1979
673 Ga0500638_176194 3300053162 Bacteria 927
674 Ga0500636_0000206 3300053177 Bacteria 31849
675 Ga0500636_0155931 3300053177 Bacteria 1250
676 Ga0500637_0125989 3300053178 Bacteria 1485
677 Ga0500645_016121 3300053730 Bacteria 2358
678 Ga0500599_000862 3300053736 Bacteria 3361
679 Ga0500601_000281 3300053737 Bacteria 9680
680 Ga0500661_007848 3300055283 Bacteria 1968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0002629 Ga0496117_0002629_8197_9012 243
2 3300048921 Ga0496118_0000966 Ga0496118_0000966_8154_8969 243
3 3300006177 Ga0075362_10013528 Ga0075362_100135282 249
4 3300005334 Ga0068869_100435843 Ga0068869_1004358432 250
5 3300005347 Ga0070668_100113315 Ga0070668_1001133152 250
6 3300005347 Ga0070668_100311228 Ga0070668_1003112282 250
7 3300005356 Ga0070674_100597411 Ga0070674_1005974111 250
8 3300005455 Ga0070663_100292779 Ga0070663_1002927792 250
9 3300005456 Ga0070678_100501511 Ga0070678_1005015111 250
10 3300005466 Ga0070685_10148200 Ga0070685_101482001 250
11 3300005617 Ga0068859_100249718 Ga0068859_1002497182 250
12 3300006881 Ga0068865_100341054 Ga0068865_1003410541 250
13 3300006931 Ga0097620_100249719 Ga0097620_1002497192 250
14 3300009098 Ga0105245_10404395 Ga0105245_104043952 250
15 3300009148 Ga0105243_10387330 Ga0105243_103873302 250
16 3300009553 Ga0105249_10074635 Ga0105249_100746351 250
17 3300009553 Ga0105249_10302474 Ga0105249_103024742 250
18 3300011119 Ga0105246_10191172 Ga0105246_101911722 250
19 3300013296 Ga0157374_10258654 Ga0157374_102586542 250
20 3300013306 Ga0163162_10141115 Ga0163162_101411152 250
21 3300013308 Ga0157375_10255364 Ga0157375_102553642 250
22 3300014325 Ga0163163_10174349 Ga0163163_101743492 250
23 3300014326 Ga0157380_10340015 Ga0157380_103400152 250
24 3300017792 Ga0163161_10059876 Ga0163161_100598762 250
25 3300025925 Ga0207650_10479750 Ga0207650_104797502 250
26 3300025927 Ga0207687_10221890 Ga0207687_102218902 250
27 3300025940 Ga0207691_10312468 Ga0207691_103124682 250
28 3300025942 Ga0207689_10204640 Ga0207689_102046402 250
29 3300025961 Ga0207712_10441389 Ga0207712_104413891 250
30 3300025972 Ga0207668_10123377 Ga0207668_101233772 250
31 3300025972 Ga0207668_10206681 Ga0207668_102066812 250
32 3300026035 Ga0207703_10166302 Ga0207703_101663022 250
33 3300026067 Ga0207678_10288341 Ga0207678_102883412 250
34 3300026088 Ga0207641_10420258 Ga0207641_104202582 250
35 3300026121 Ga0207683_10121405 Ga0207683_101214052 250
36 3300028379 Ga0268266_10009304 Ga0268266_100093046 250
37 3300028380 Ga0268265_10243572 Ga0268265_102435722 250
38 3300028381 Ga0268264_10367337 Ga0268264_103673372 250
39 3300044901 Ga0466960_0055738 Ga0466960_0055738_88_846 250
40 3300046471 Ga0495650_0051104 Ga0495650_0051104_412_1170 250
41 3300046474 Ga0495605_0047395 Ga0495605_0047395_877_1635 250
42 3300046492 Ga0495585_0020057 Ga0495585_0020057_647_1405 250
43 3300046522 Ga0495643_0151802 Ga0495643_0151802_249_1007 250
44 3300046538 Ga0495609_0038300 Ga0495609_0038300_237_995 250
45 3300046558 Ga0495633_0031351 Ga0495633_0031351_1222_1980 250
46 3300046615 Ga0495656_0054638 Ga0495656_0054638_754_1512 250
47 3300046616 Ga0495668_0009157 Ga0495668_0009157_3988_4746 250
48 3300046684 Ga0495669_0035469 Ga0495669_0035469_1136_1894 250
49 3300047323 Ga0495683_0066995 Ga0495683_0066995_884_1642 250
50 3300047446 Ga0495679_043286 Ga0495679_043286_47_805 250
51 3300048909 Ga0496106_0298450 Ga0496106_0298450_318_1076 250
52 3300048912 Ga0496109_0198344 Ga0496109_0198344_541_1299 250
53 3300048913 Ga0496110_0319451 Ga0496110_0319451_398_1156 250
54 3300048918 Ga0496115_0095385 Ga0496115_0095385_181_939 250
55 3300053118 Ga0500594_0020507 Ga0500594_0020507_97_855 250
56 3300003775 Ga0055524_1000014 Ga0055524_1000014175 251
57 3300005356 Ga0070674_100041548 Ga0070674_1000415482 251
58 3300005456 Ga0070678_100213961 Ga0070678_1002139611 251
59 3300006237 Ga0097621_100484999 Ga0097621_1004849992 251
60 3300009148 Ga0105243_10336116 Ga0105243_103361162 251
61 3300011119 Ga0105246_10501948 Ga0105246_105019481 251
62 3300013308 Ga0157375_10112761 Ga0157375_101127612 251
63 3300014325 Ga0163163_10214567 Ga0163163_102145672 251
64 3300014969 Ga0157376_10019174 Ga0157376_100191741 251
65 3300025935 Ga0207709_10306939 Ga0207709_103069392 251
66 3300026075 Ga0207708_10339450 Ga0207708_103394502 251
67 3300026121 Ga0207683_10073252 Ga0207683_100732523 251
68 3300046477 Ga0495664_0400051 Ga0495664_0400051_16_774 251
69 3300048913 Ga0496110_0160483 Ga0496110_0160483_986_1744 251
70 3300002987 JGI25159J45721_1000030 JGI25159J45721_10000306 252
71 3300003187 JGI25151J46595_10001370 JGI25151J46595_1000137014 252
72 3300003187 JGI25151J46595_10002889 JGI25151J46595_100028897 252
73 3300003214 JGI25165J46597_1000975 JGI25165J46597_100097514 252
74 3300003320 rootH2_10065025 rootH2_100650251 252
75 3300003323 rootH1_10265325 rootH1_102653253 252
76 3300003354 JGI25160J50197_1000075 JGI25160J50197_10000756 252
77 3300003354 JGI25160J50197_1000524 JGI25160J50197_100052420 252
78 3300003374 JGI25161J50226_1000388 JGI25161J50226_10003884 252
79 3300003374 JGI25161J50226_1000593 JGI25161J50226_10005938 252
80 3300003659 JGI25404J52841_10000831 JGI25404J52841_100008313 252
81 3300003771 Ga0055526_1002008 Ga0055526_100200815 252
82 3300003771 Ga0055526_1008700 Ga0055526_10087003 252
83 3300003771 Ga0055526_1012200 Ga0055526_10122004 252
84 3300003775 Ga0055524_1006932 Ga0055524_10069323 252
85 3300003781 Ga0055536_1005974 Ga0055536_10059744 252
86 3300003784 Ga0055534_1004256 Ga0055534_10042563 252
87 3300003794 Ga0055531_10018718 Ga0055531_100187182 252
88 3300004625 Ga0055543_1000168 Ga0055543_10001686 252
89 3300004625 Ga0055543_1000449 Ga0055543_100044923 252
90 3300005262 Ga0065165_1000206 Ga0065165_10002066 252
91 3300005262 Ga0065165_1001476 Ga0065165_100147623 252
92 3300005341 Ga0070691_10001016 Ga0070691_100010167 252
93 3300005353 Ga0070669_100010500 Ga0070669_1000105007 252
94 3300005353 Ga0070669_100312136 Ga0070669_1003121362 252
95 3300005355 Ga0070671_100034409 Ga0070671_1000344093 252
96 3300005355 Ga0070671_100318680 Ga0070671_1003186801 252
97 3300005364 Ga0070673_100195956 Ga0070673_1001959562 252
98 3300005434 Ga0070709_10000216 Ga0070709_1000021635 252
99 3300005434 Ga0070709_10270246 Ga0070709_102702462 252
100 3300005436 Ga0070713_100050867 Ga0070713_1000508673 252
101 3300005437 Ga0070710_10003345 Ga0070710_100033453 252
102 3300005437 Ga0070710_10272384 Ga0070710_102723841 252
103 3300005439 Ga0070711_100014513 Ga0070711_1000145133 252
104 3300005439 Ga0070711_100103366 Ga0070711_1001033662 252
105 3300005439 Ga0070711_100190094 Ga0070711_1001900941 252
106 3300005441 Ga0070700_100004033 Ga0070700_1000040333 252
107 3300005441 Ga0070700_100194720 Ga0070700_1001947201 252
108 3300005444 Ga0070694_100124957 Ga0070694_1001249571 252
109 3300005455 Ga0070663_100151170 Ga0070663_1001511701 252
110 3300005457 Ga0070662_100085523 Ga0070662_1000855232 252
111 3300005467 Ga0070706_100201010 Ga0070706_1002010104 252
112 3300005518 Ga0070699_100055039 Ga0070699_1000550396 252
113 3300005545 Ga0070695_100000381 Ga0070695_10000038122 252
114 3300005546 Ga0070696_100170054 Ga0070696_1001700542 252
115 3300005614 Ga0068856_100115164 Ga0068856_1001151641 252
116 3300005614 Ga0068856_100824728 Ga0068856_1008247281 252
117 3300005618 Ga0068864_100482899 Ga0068864_1004828992 252
118 3300005719 Ga0068861_100025826 Ga0068861_1000258262 252
119 3300005841 Ga0068863_100684527 Ga0068863_1006845271 252
120 3300005842 Ga0068858_100422023 Ga0068858_1004220232 252
121 3300005843 Ga0068860_100271287 Ga0068860_1002712872 252
122 3300005844 Ga0068862_100717787 Ga0068862_1007177871 252
123 3300005937 Ga0081455_10015097 Ga0081455_100150973 252
124 3300005983 Ga0081540_1001168 Ga0081540_10011688 252
125 3300005983 Ga0081540_1001292 Ga0081540_100129223 252
126 3300005983 Ga0081540_1001561 Ga0081540_100156121 252
127 3300005983 Ga0081540_1004935 Ga0081540_10049357 252
128 3300005983 Ga0081540_1010233 Ga0081540_10102338 252
129 3300005983 Ga0081540_1024995 Ga0081540_10249954 252
130 3300005983 Ga0081540_1037124 Ga0081540_10371241 252
131 3300005983 Ga0081540_1046539 Ga0081540_10465394 252
132 3300005983 Ga0081540_1059518 Ga0081540_10595183 252
133 3300005983 Ga0081540_1082315 Ga0081540_10823153 252
134 3300005983 Ga0081540_1105346 Ga0081540_11053462 252
135 3300006038 Ga0075365_10080588 Ga0075365_100805881 252
136 3300006038 Ga0075365_10081745 Ga0075365_100817452 252
137 3300006048 Ga0075363_100023998 Ga0075363_1000239984 252
138 3300006048 Ga0075363_100114755 Ga0075363_1001147551 252
139 3300006048 Ga0075363_100159599 Ga0075363_1001595992 252
140 3300006173 Ga0070716_100011407 Ga0070716_1000114074 252
141 3300006175 Ga0070712_100056386 Ga0070712_1000563864 252
142 3300006175 Ga0070712_100174541 Ga0070712_1001745413 252
143 3300006177 Ga0075362_10014315 Ga0075362_100143153 252
144 3300006177 Ga0075362_10194877 Ga0075362_101948771 252
145 3300006178 Ga0075367_10009837 Ga0075367_100098378 252
146 3300006178 Ga0075367_10176499 Ga0075367_101764991 252
147 3300006178 Ga0075367_10176815 Ga0075367_101768152 252
148 3300006186 Ga0075369_10004647 Ga0075369_100046474 252
149 3300006186 Ga0075369_10071047 Ga0075369_100710474 252
150 3300006186 Ga0075369_10137584 Ga0075369_101375842 252
151 3300006195 Ga0075366_10024023 Ga0075366_100240234 252
152 3300006237 Ga0097621_100197921 Ga0097621_1001979213 252
153 3300006353 Ga0075370_10031353 Ga0075370_100313533 252
154 3300006844 Ga0075428_100440920 Ga0075428_1004409202 252
155 3300006852 Ga0075433_10007299 Ga0075433_1000729911 252
156 3300006871 Ga0075434_100011869 Ga0075434_1000118693 252
157 3300006871 Ga0075434_100187476 Ga0075434_1001874762 252
158 3300006944 Ga0099823_1016936 Ga0099823_10169369 252
159 3300006944 Ga0099823_1018785 Ga0099823_10187859 252
160 3300006948 Ga0099826_10000013 Ga0099826_10000013148 252
161 3300007788 Ga0099795_10065222 Ga0099795_100652221 252
162 3300007788 Ga0099795_10104886 Ga0099795_101048862 252
163 3300009011 Ga0105251_10021512 Ga0105251_100215122 252
164 3300009092 Ga0105250_10010707 Ga0105250_100107075 252
165 3300009094 Ga0111539_10891516 Ga0111539_108915162 252
166 3300009098 Ga0105245_10049804 Ga0105245_100498042 252
167 3300009098 Ga0105245_10230938 Ga0105245_102309382 252
168 3300009101 Ga0105247_10257099 Ga0105247_102570991 252
169 3300009101 Ga0105247_10325575 Ga0105247_103255752 252
170 3300009147 Ga0114129_10196308 Ga0114129_101963084 252
171 3300009148 Ga0105243_10179674 Ga0105243_101796742 252
172 3300009174 Ga0105241_10035047 Ga0105241_100350473 252
173 3300009174 Ga0105241_10064819 Ga0105241_100648192 252
174 3300009177 Ga0105248_10054096 Ga0105248_100540963 252
175 3300009177 Ga0105248_10194397 Ga0105248_101943972 252
176 3300009545 Ga0105237_10130535 Ga0105237_101305353 252
177 3300009545 Ga0105237_10231480 Ga0105237_102314801 252
178 3300009545 Ga0105237_10264745 Ga0105237_102647452 252
179 3300009545 Ga0105237_10518106 Ga0105237_105181062 252
180 3300009551 Ga0105238_10289878 Ga0105238_102898782 252
181 3300009553 Ga0105249_10889471 Ga0105249_108894712 252
182 3300010159 Ga0099796_10046893 Ga0099796_100468932 252
183 3300010375 Ga0105239_10011851 Ga0105239_1001185110 252
184 3300010375 Ga0105239_10421767 Ga0105239_104217672 252
185 3300011119 Ga0105246_10083115 Ga0105246_100831152 252
186 3300013308 Ga0157375_10422745 Ga0157375_104227453 252
187 3300014325 Ga0163163_10333207 Ga0163163_103332071 252
188 3300014326 Ga0157380_10461206 Ga0157380_104612062 252
189 3300014745 Ga0157377_10160862 Ga0157377_101608621 252
190 3300014968 Ga0157379_10780084 Ga0157379_107800841 252
191 3300015262 Ga0182007_10000608 Ga0182007_100006082 252
192 3300015265 Ga0182005_1014887 Ga0182005_10148874 252
193 3300017792 Ga0163161_10053658 Ga0163161_100536584 252
194 3300017792 Ga0163161_10207646 Ga0163161_102076461 252
195 3300021361 Ga0213872_10000907 Ga0213872_1000090710 252
196 3300021361 Ga0213872_10001086 Ga0213872_100010868 252
197 3300021361 Ga0213872_10001611 Ga0213872_1000161111 252
198 3300021361 Ga0213872_10001866 Ga0213872_100018665 252
199 3300021361 Ga0213872_10028434 Ga0213872_100284341 252
200 3300021361 Ga0213872_10104833 Ga0213872_101048331 252
201 3300025233 Ga0209437_100858 Ga0209437_10085810 252
202 3300025261 Ga0209233_1000584 Ga0209233_100058411 252
203 3300025261 Ga0209233_1010556 Ga0209233_10105563 252
204 3300025263 Ga0209565_1000201 Ga0209565_100020141 252
205 3300025272 Ga0209455_1002576 Ga0209455_10025764 252
206 3300025273 Ga0209673_1000036 Ga0209673_1000036264 252
207 3300025284 Ga0209130_1000154 Ga0209130_10001546 252
208 3300025284 Ga0209130_1000409 Ga0209130_100040921 252
209 3300025291 Ga0209675_1000013 Ga0209675_1000013264 252
210 3300025291 Ga0209675_1007498 Ga0209675_10074983 252
211 3300025292 Ga0209676_1005963 Ga0209676_10059634 252
212 3300025294 Ga0209025_1000032 Ga0209025_1000032292 252
213 3300025294 Ga0209025_1001002 Ga0209025_10010028 252
214 3300025294 Ga0209025_1008061 Ga0209025_10080618 252
215 3300025295 Ga0209564_1000025 Ga0209564_1000025488 252
216 3300025295 Ga0209564_1000240 Ga0209564_1000240100 252
217 3300025295 Ga0209564_1000434 Ga0209564_100043466 252
218 3300025295 Ga0209564_1000578 Ga0209564_100057824 252
219 3300025295 Ga0209564_1003386 Ga0209564_10033863 252
220 3300025295 Ga0209564_1019204 Ga0209564_10192041 252
221 3300025297 Ga0209758_1000868 Ga0209758_100086816 252
222 3300025298 Ga0209050_1019218 Ga0209050_10192183 252
223 3300025299 Ga0209256_1000052 Ga0209256_1000052252 252
224 3300025299 Ga0209256_1000801 Ga0209256_100080128 252
225 3300025299 Ga0209256_1009401 Ga0209256_10094013 252
226 3300025302 Ga0207426_1000269 Ga0207426_100026921 252
227 3300025302 Ga0207426_1000286 Ga0207426_10002866 252
228 3300025302 Ga0207426_1000439 Ga0207426_100043953 252
229 3300025303 Ga0209051_1015854 Ga0209051_10158542 252
230 3300025304 Ga0209257_1005525 Ga0209257_10055252 252
231 3300025304 Ga0209257_1012653 Ga0209257_10126532 252
232 3300025315 Ga0207697_10059965 Ga0207697_100599653 252
233 3300025735 Ga0207713_1055515 Ga0207713_10555152 252
234 3300025898 Ga0207692_10001498 Ga0207692_100014988 252
235 3300025901 Ga0207688_10060451 Ga0207688_100604513 252
236 3300025901 Ga0207688_10063154 Ga0207688_100631542 252
237 3300025904 Ga0207647_10024012 Ga0207647_100240124 252
238 3300025904 Ga0207647_10253591 Ga0207647_102535911 252
239 3300025905 Ga0207685_10104914 Ga0207685_101049142 252
240 3300025906 Ga0207699_10001209 Ga0207699_1000120910 252
241 3300025906 Ga0207699_10229295 Ga0207699_102292952 252
242 3300025907 Ga0207645_10081665 Ga0207645_100816653 252
243 3300025910 Ga0207684_10296148 Ga0207684_102961482 252
244 3300025911 Ga0207654_10066590 Ga0207654_100665901 252
245 3300025914 Ga0207671_10222242 Ga0207671_102222422 252
246 3300025915 Ga0207693_10021080 Ga0207693_100210804 252
247 3300025915 Ga0207693_10201893 Ga0207693_102018931 252
248 3300025915 Ga0207693_10344303 Ga0207693_103443032 252
249 3300025916 Ga0207663_10001932 Ga0207663_100019323 252
250 3300025916 Ga0207663_10124266 Ga0207663_101242662 252
251 3300025924 Ga0207694_10080092 Ga0207694_100800922 252
252 3300025927 Ga0207687_10110474 Ga0207687_101104742 252
253 3300025928 Ga0207700_10058522 Ga0207700_100585223 252
254 3300025929 Ga0207664_10050921 Ga0207664_100509213 252
255 3300025933 Ga0207706_10005893 Ga0207706_1000589311 252
256 3300025934 Ga0207686_10137816 Ga0207686_101378162 252
257 3300025935 Ga0207709_10116283 Ga0207709_101162833 252
258 3300025939 Ga0207665_10019548 Ga0207665_100195483 252
259 3300025939 Ga0207665_10234163 Ga0207665_102341632 252
260 3300025941 Ga0207711_10048075 Ga0207711_100480752 252
261 3300025941 Ga0207711_10141715 Ga0207711_101417151 252
262 3300025941 Ga0207711_10404783 Ga0207711_104047832 252
263 3300025942 Ga0207689_10005976 Ga0207689_100059765 252
264 3300025942 Ga0207689_10206622 Ga0207689_102066222 252
265 3300025961 Ga0207712_10256372 Ga0207712_102563723 252
266 3300025972 Ga0207668_10007990 Ga0207668_100079902 252
267 3300025986 Ga0207658_10119941 Ga0207658_101199412 252
268 3300026035 Ga0207703_10168249 Ga0207703_101682491 252
269 3300026035 Ga0207703_10231864 Ga0207703_102318642 252
270 3300026067 Ga0207678_10118746 Ga0207678_101187463 252
271 3300026075 Ga0207708_10021747 Ga0207708_100217472 252
272 3300026088 Ga0207641_10312969 Ga0207641_103129692 252
273 3300026089 Ga0207648_10659761 Ga0207648_106597611 252
274 3300026116 Ga0207674_10208086 Ga0207674_102080863 252
275 3300026118 Ga0207675_100045363 Ga0207675_1000453634 252
276 3300026121 Ga0207683_10088006 Ga0207683_100880064 252
277 3300026142 Ga0207698_10306334 Ga0207698_103063342 252
278 3300027296 Ga0209389_1008948 Ga0209389_10089488 252
279 3300027296 Ga0209389_1010024 Ga0209389_10100248 252
280 3300027357 Ga0209589_1000676 Ga0209589_10006767 252
281 3300027361 Ga0209489_100062 Ga0209489_100062115 252
282 3300027361 Ga0209489_111509 Ga0209489_1115098 252
283 3300027361 Ga0209489_111839 Ga0209489_1118398 252
284 3300027363 Ga0209700_110927 Ga0209700_1109278 252
285 3300027363 Ga0209700_111242 Ga0209700_1112428 252
286 3300027666 Ga0209282_1000043 Ga0209282_100004356 252
287 3300027671 Ga0209588_1014646 Ga0209588_10146462 252
288 3300028379 Ga0268266_10193947 Ga0268266_101939471 252
289 3300028380 Ga0268265_10005524 Ga0268265_100055249 252
290 3300028380 Ga0268265_10139082 Ga0268265_101390822 252
291 3300028381 Ga0268264_10368601 Ga0268264_103686011 252
292 3300028794 Ga0307515_10000160 Ga0307515_1000016038 252
293 3300033180 Ga0307510_10010555 Ga0307510_100105556 252
294 3300033180 Ga0307510_10209592 Ga0307510_102095922 252
295 3300033442 Ga0315911_1000006 Ga0315911_1000006164 252
296 3300035170 Ga0373943_0050055 Ga0373943_0050055_312_1070 252
297 3300035691 Ga0373931_0140751 Ga0373931_0140751_50_808 252
298 3300035695 Ga0373927_0005782 Ga0373927_0005782_3260_4018 252
299 3300035695 Ga0373927_0016306 Ga0373927_0016306_2953_3711 252
300 3300035725 Ga0373947_0004169 Ga0373947_0004169_2066_2824 252
301 3300035725 Ga0373947_0037380 Ga0373947_0037380_48_806 252
302 3300037068 Ga0373925_0062663 Ga0373925_0062663_879_1637 252
303 3300037471 Ga0395905_0031525 Ga0395905_0031525_3237_3995 252
304 3300037471 Ga0395905_0280648 Ga0395905_0280648_374_1132 252
305 3300039437 Ga0436365_0931078 Ga0436365_0931078_1936_2694 252
306 3300039437 Ga0436365_1178230 Ga0436365_1178230_676_1440 252
307 3300039437 Ga0436365_1769494 Ga0436365_1769494_44_802 252
308 3300039438 Ga0436360_0148226 Ga0436360_0148226_162_920 252
309 3300039438 Ga0436360_0731023 Ga0436360_0731023_665_1423 252
310 3300039447 Ga0436361_0096149 Ga0436361_0096149_5200_5967 252
311 3300039447 Ga0436361_0201274 Ga0436361_0201274_1164_1931 252
312 3300039447 Ga0436361_0262026 Ga0436361_0262026_25428_26186 252
313 3300039447 Ga0436361_0277135 Ga0436361_0277135_1820_2578 252
314 3300039447 Ga0436361_0681104 Ga0436361_0681104_20811_21575 252
315 3300039447 Ga0436361_0796193 Ga0436361_0796193_199_957 252
316 3300039447 Ga0436361_0827273 Ga0436361_0827273_7659_8417 252
317 3300039447 Ga0436361_1011321 Ga0436361_1011321_351_1109 252
318 3300039447 Ga0436361_1085489 Ga0436361_1085489_259_1017 252
319 3300042010 Ga0439452_033630 Ga0439452_033630_376_1143 252
320 3300044706 Ga0466964_0027182 Ga0466964_0027182_533_1291 252
321 3300045976 Ga0466967_0312108 Ga0466967_0312108_330_1088 252
322 3300046455 Ga0495603_0006194 Ga0495603_0006194_2254_3012 252
323 3300046455 Ga0495603_0177132 Ga0495603_0177132_288_1046 252
324 3300046460 Ga0495638_0007874 Ga0495638_0007874_2800_3558 252
325 3300046472 Ga0495580_0262535 Ga0495580_0262535_48_806 252
326 3300046474 Ga0495605_0031954 Ga0495605_0031954_524_1282 252
327 3300046474 Ga0495605_0047792 Ga0495605_0047792_974_1732 252
328 3300046491 Ga0495584_0000007 Ga0495584_0000007_75700_76458 252
329 3300046491 Ga0495584_0000901 Ga0495584_0000901_10190_10948 252
330 3300046492 Ga0495585_0000003 Ga0495585_0000003_50330_51088 252
331 3300046492 Ga0495585_0000264 Ga0495585_0000264_28239_28997 252
332 3300046492 Ga0495585_0006146 Ga0495585_0006146_5223_5981 252
333 3300046500 Ga0495596_0001236 Ga0495596_0001236_8156_8914 252
334 3300046500 Ga0495596_0005439 Ga0495596_0005439_1744_2502 252
335 3300046500 Ga0495596_0077643 Ga0495596_0077643_396_1154 252
336 3300046501 Ga0495607_0007789 Ga0495607_0007789_3130_3888 252
337 3300046506 Ga0495583_0001238 Ga0495583_0001238_4895_5653 252
338 3300046506 Ga0495583_0039461 Ga0495583_0039461_86_844 252
339 3300046507 Ga0495606_0002146 Ga0495606_0002146_6337_7095 252
340 3300046507 Ga0495606_0036483 Ga0495606_0036483_1139_1906 252
341 3300046507 Ga0495606_0042940 Ga0495606_0042940_370_1128 252
342 3300046507 Ga0495606_0063805 Ga0495606_0063805_227_985 252
343 3300046513 Ga0495616_0000228 Ga0495616_0000228_22484_23242 252
344 3300046513 Ga0495616_0003675 Ga0495616_0003675_4258_5016 252
345 3300046513 Ga0495616_0015489 Ga0495616_0015489_2695_3453 252
346 3300046513 Ga0495616_0034720 Ga0495616_0034720_1840_2598 252
347 3300046515 Ga0495620_0001264 Ga0495620_0001264_8513_9271 252
348 3300046517 Ga0495630_0122386 Ga0495630_0122386_165_923 252
349 3300046518 Ga0495631_0000090 Ga0495631_0000090_51953_52711 252
350 3300046519 Ga0495632_0169762 Ga0495632_0169762_186_944 252
351 3300046522 Ga0495643_0013974 Ga0495643_0013974_3408_4166 252
352 3300046522 Ga0495643_0037229 Ga0495643_0037229_224_982 252
353 3300046522 Ga0495643_0063433 Ga0495643_0063433_543_1310 252
354 3300046524 Ga0495648_0000171 Ga0495648_0000171_50585_51343 252
355 3300046524 Ga0495648_0005173 Ga0495648_0005173_9106_9864 252
356 3300046524 Ga0495648_0029940 Ga0495648_0029940_1768_2526 252
357 3300046524 Ga0495648_0078434 Ga0495648_0078434_1022_1780 252
358 3300046524 Ga0495648_0083356 Ga0495648_0083356_562_1320 252
359 3300046528 Ga0495642_0003682 Ga0495642_0003682_1631_2389 252
360 3300046530 Ga0495654_0007039 Ga0495654_0007039_3407_4165 252
361 3300046538 Ga0495609_0000566 Ga0495609_0000566_15340_16098 252
362 3300046538 Ga0495609_0020794 Ga0495609_0020794_1265_2023 252
363 3300046538 Ga0495609_0034901 Ga0495609_0034901_82_840 252
364 3300046542 Ga0495597_0008221 Ga0495597_0008221_2933_3703 252
365 3300046557 Ga0495622_0085362 Ga0495622_0085362_647_1405 252
366 3300046558 Ga0495633_0000702 Ga0495633_0000702_9894_10652 252
367 3300046558 Ga0495633_0013203 Ga0495633_0013203_3255_4013 252
368 3300046616 Ga0495668_0000094 Ga0495668_0000094_82943_83701 252
369 3300046616 Ga0495668_0000129 Ga0495668_0000129_9656_10414 252
370 3300046616 Ga0495668_0007639 Ga0495668_0007639_1278_2036 252
371 3300046616 Ga0495668_0145382 Ga0495668_0145382_433_1191 252
372 3300046648 Ga0495611_0013495 Ga0495611_0013495_2420_3178 252
373 3300046648 Ga0495611_0077769 Ga0495611_0077769_158_916 252
374 3300046648 Ga0495611_0185090 Ga0495611_0185090_47_805 252
375 3300046660 Ga0495625_0003017 Ga0495625_0003017_6505_7275 252
376 3300046660 Ga0495625_0007263 Ga0495625_0007263_7260_8018 252
377 3300046660 Ga0495625_0128561 Ga0495625_0128561_637_1395 252
378 3300046664 Ga0495659_0077495 Ga0495659_0077495_272_1030 252
379 3300046665 Ga0495661_0011409 Ga0495661_0011409_41_799 252
380 3300046665 Ga0495661_0037066 Ga0495661_0037066_2023_2781 252
381 3300046665 Ga0495661_0081364 Ga0495661_0081364_934_1692 252
382 3300046674 Ga0495588_0316572 Ga0495588_0316572_20_778 252
383 3300046692 Ga0495671_0004568 Ga0495671_0004568_1758_2516 252
384 3300046692 Ga0495671_0036772 Ga0495671_0036772_672_1430 252
385 3300046692 Ga0495671_0270782 Ga0495671_0270782_50_808 252
386 3300046694 Ga0495649_0003412 Ga0495649_0003412_2841_3599 252
387 3300046694 Ga0495649_0026960 Ga0495649_0026960_2226_2993 252
388 3300046794 Ga0495589_0000033 Ga0495589_0000033_94563_95336 252
389 3300046810 Ga0495660_0025127 Ga0495660_0025127_50_808 252
390 3300046810 Ga0495660_0169777 Ga0495660_0169777_84_842 252
391 3300047319 Ga0495674_0264219 Ga0495674_0264219_433_1191 252
392 3300047320 Ga0495672_0011421 Ga0495672_0011421_1833_2591 252
393 3300047321 Ga0495676_0119583 Ga0495676_0119583_955_1713 252
394 3300047323 Ga0495683_0000083 Ga0495683_0000083_85838_86596 252
395 3300047323 Ga0495683_0001589 Ga0495683_0001589_1532_2299 252
396 3300047323 Ga0495683_0005834 Ga0495683_0005834_5711_6469 252
397 3300047323 Ga0495683_0018287 Ga0495683_0018287_91_849 252
398 3300047323 Ga0495683_0087202 Ga0495683_0087202_283_1041 252
399 3300047323 Ga0495683_0215841 Ga0495683_0215841_42_800 252
400 3300047443 Ga0495687_000017 Ga0495687_000017_280877_281635 252
401 3300047443 Ga0495687_009263 Ga0495687_009263_3623_4390 252
402 3300047443 Ga0495687_084482 Ga0495687_084482_281_1039 252
403 3300047446 Ga0495679_007526 Ga0495679_007526_3148_3906 252
404 3300047447 Ga0495685_000938 Ga0495685_000938_4612_5370 252
405 3300047447 Ga0495685_004641 Ga0495685_004641_2930_3688 252
406 3300047469 Ga0495673_0177686 Ga0495673_0177686_37_795 252
407 3300047470 Ga0495681_0005657 Ga0495681_0005657_3481_4239 252
408 3300047471 Ga0495684_0329700 Ga0495684_0329700_230_988 252
409 3300047673 Ga0495593_0044363 Ga0495593_0044363_622_1380 252
410 3300048903 Ga0496100_0151990 Ga0496100_0151990_219_977 252
411 3300048905 Ga0496102_0210877 Ga0496102_0210877_896_1654 252
412 3300048905 Ga0496102_0558935 Ga0496102_0558935_91_849 252
413 3300048906 Ga0496103_0038267 Ga0496103_0038267_727_1485 252
414 3300048906 Ga0496103_0050426 Ga0496103_0050426_777_1535 252
415 3300048907 Ga0496104_0004902 Ga0496104_0004902_2861_3619 252
416 3300048908 Ga0496105_0009330 Ga0496105_0009330_3216_3974 252
417 3300048908 Ga0496105_0287710 Ga0496105_0287710_29_787 252
418 3300048909 Ga0496106_0039933 Ga0496106_0039933_41_799 252
419 3300048911 Ga0496108_0137938 Ga0496108_0137938_211_969 252
420 3300048911 Ga0496108_0429783 Ga0496108_0429783_321_1079 252
421 3300048912 Ga0496109_0034401 Ga0496109_0034401_581_1339 252
422 3300048912 Ga0496109_0165578 Ga0496109_0165578_524_1282 252
423 3300048912 Ga0496109_0258248 Ga0496109_0258248_640_1398 252
424 3300048915 Ga0496112_0339272 Ga0496112_0339272_573_1331 252
425 3300048916 Ga0496113_0191469 Ga0496113_0191469_225_983 252
426 3300048917 Ga0496114_0179980 Ga0496114_0179980_313_1071 252
427 3300048917 Ga0496114_0557354 Ga0496114_0557354_22_780 252
428 3300048918 Ga0496115_0089701 Ga0496115_0089701_293_1051 252
429 3300048919 Ga0496116_0004369 Ga0496116_0004369_2945_3703 252
430 3300048919 Ga0496116_0105368 Ga0496116_0105368_77_835 252
431 3300048919 Ga0496116_0244197 Ga0496116_0244197_75_833 252
432 3300048920 Ga0496117_0055074 Ga0496117_0055074_1691_2449 252
433 3300048920 Ga0496117_0141950 Ga0496117_0141950_329_1087 252
434 3300048921 Ga0496118_0031253 Ga0496118_0031253_75_833 252
435 3300048921 Ga0496118_0054891 Ga0496118_0054891_138_896 252
436 3300048921 Ga0496118_0104009 Ga0496118_0104009_555_1313 252
437 3300048922 Ga0496119_0016165 Ga0496119_0016165_1905_2669 252
438 3300048922 Ga0496119_0023355 Ga0496119_0023355_1955_2713 252
439 3300048923 Ga0496120_0013451 Ga0496120_0013451_2240_3004 252
440 3300048924 Ga0496121_0002217 Ga0496121_0002217_520_1278 252
441 3300048924 Ga0496121_0015838 Ga0496121_0015838_868_1626 252
442 3300048924 Ga0496121_0262874 Ga0496121_0262874_221_979 252
443 3300048924 Ga0496121_0317503 Ga0496121_0317503_19_777 252
444 3300048925 Ga0496122_0000043 Ga0496122_0000043_235411_236169 252
445 3300048925 Ga0496122_0000908 Ga0496122_0000908_3747_4505 252
446 3300048926 Ga0496123_0000090 Ga0496123_0000090_44158_44916 252
447 3300048926 Ga0496123_0000412 Ga0496123_0000412_30585_31343 252
448 3300048926 Ga0496123_0020702 Ga0496123_0020702_2243_3007 252
449 3300048927 Ga0496124_0180048 Ga0496124_0180048_702_1466 252
450 3300048928 Ga0496125_0000051 Ga0496125_0000051_270144_270908 252
451 3300048928 Ga0496125_0311741 Ga0496125_0311741_151_909 252
452 3300048929 Ga0496126_0007725 Ga0496126_0007725_10145_10903 252
453 3300048929 Ga0496126_0022164 Ga0496126_0022164_5076_5834 252
454 3300048929 Ga0496126_0143739 Ga0496126_0143739_900_1658 252
455 3300050490 nmdc:mga03n38_276029_c1 nmdc:mga03n38_276029_c1_11_769 252
456 3300050490 nmdc:mga03n38_45650_c1 nmdc:mga03n38_45650_c1_768_1526 252
457 3300050491 nmdc:mga00v17_62136_c1 nmdc:mga00v17_62136_c1_1181_1939 252
458 3300050493 nmdc:mga0k408_154697_c1 nmdc:mga0k408_154697_c1_307_1065 252
459 3300050494 nmdc:mga06z11_158517_c1 nmdc:mga06z11_158517_c1_467_1225 252
460 3300050494 nmdc:mga06z11_21857_c1 nmdc:mga06z11_21857_c1_38_796 252
461 3300050494 nmdc:mga06z11_357388_c1 nmdc:mga06z11_357388_c1_89_847 252
462 3300050494 nmdc:mga06z11_61061_c1 nmdc:mga06z11_61061_c1_245_1003 252
463 3300050495 nmdc:mga04h51_4538_c1 nmdc:mga04h51_4538_c1_604_1362 252
464 3300050496 nmdc:mga07m45_5932_c1 nmdc:mga07m45_5932_c1_3916_4674 252
465 3300050507 nmdc:mga05p37_705158_c1 nmdc:mga05p37_705158_c1_146_904 252
466 3300050511 nmdc:mga08y16_34670_c1 nmdc:mga08y16_34670_c1_240_998 252
467 3300050512 nmdc:mga0n895_182164_c1 nmdc:mga0n895_182164_c1_699_1457 252
468 3300050512 nmdc:mga0n895_502_c1 nmdc:mga0n895_502_c1_12468_13226 252
469 3300050515 nmdc:mga0a205_4465_c1 nmdc:mga0a205_4465_c1_8648_9406 252
470 3300050516 nmdc:mga0sz30_32577_c1 nmdc:mga0sz30_32577_c1_213_971 252
471 3300050516 nmdc:mga0sz30_53526_c2 nmdc:mga0sz30_53526_c2_158_916 252
472 3300050516 nmdc:mga0sz30_84720_c1 nmdc:mga0sz30_84720_c1_151_909 252
473 3300053080 Ga0500635_0037167 Ga0500635_0037167_689_1447 252
474 3300053087 Ga0500643_000015 Ga0500643_000015_179002_179760 252
475 3300053103 Ga0500555_009621 Ga0500555_009621_1122_1880 252
476 3300053104 Ga0500556_0006082 Ga0500556_0006082_385_1143 252
477 3300053104 Ga0500556_0044133 Ga0500556_0044133_195_953 252
478 3300053108 Ga0500562_003619 Ga0500562_003619_1950_2708 252
479 3300053109 Ga0500569_004065 Ga0500569_004065_122_880 252
480 3300053116 Ga0500592_005045 Ga0500592_005045_1202_1960 252
481 3300053130 Ga0500642_0078492 Ga0500642_0078492_411_1169 252
482 3300053138 Ga0500564_093306 Ga0500564_093306_416_1174 252
483 3300053142 Ga0500577_0140046 Ga0500577_0140046_198_956 252
484 3300053153 Ga0500616_0013901 Ga0500616_0013901_3675_4433 252
485 3300053154 Ga0500619_036813 Ga0500619_036813_348_1106 252
486 3300053155 Ga0500620_021597 Ga0500620_021597_596_1354 252
487 3300053156 Ga0500622_0025216 Ga0500622_0025216_2220_2978 252
488 3300053160 Ga0500633_0013380 Ga0500633_0013380_1229_1987 252
489 3300053162 Ga0500638_176194 Ga0500638_176194_119_877 252
490 3300053177 Ga0500636_0000206 Ga0500636_0000206_15833_16591 252
491 3300053177 Ga0500636_0155931 Ga0500636_0155931_434_1192 252
492 3300053178 Ga0500637_0125989 Ga0500637_0125989_578_1336 252
493 3300053730 Ga0500645_016121 Ga0500645_016121_1585_2343 252
494 3300053736 Ga0500599_000862 Ga0500599_000862_2396_3154 252
495 3300053737 Ga0500601_000281 Ga0500601_000281_5242_6000 252
496 3300055283 Ga0500661_007848 Ga0500661_007848_1111_1869 252
497 iso_pu_bacteria 2738541300 2738846719 252
498 iso_pu_bacteria 2738543018 2739277623 252
499 iso_pu_bacteria 2738543030 2739346692 252
500 3300009011 Ga0105251_10016616 Ga0105251_100166162 253
501 3300031456 Ga0307513_10326741 Ga0307513_103267411 253
502 3300048905 Ga0496102_0006087 Ga0496102_0006087_8915_9676 253
503 3300048916 Ga0496113_0191174 Ga0496113_0191174_316_1077 253
504 3300053158 Ga0500627_0038138 Ga0500627_0038138_624_1391 253
505 3300005329 Ga0070683_100149183 Ga0070683_1001491832 254
506 3300005338 Ga0068868_100105920 Ga0068868_1001059204 254
507 3300005344 Ga0070661_100070893 Ga0070661_1000708933 254
508 3300005354 Ga0070675_100246230 Ga0070675_1002462303 254
509 3300005355 Ga0070671_100081155 Ga0070671_1000811552 254
510 3300005456 Ga0070678_100030921 Ga0070678_1000309212 254
511 3300005539 Ga0068853_100740690 Ga0068853_1007406901 254
512 3300005616 Ga0068852_100032142 Ga0068852_1000321425 254
513 3300005618 Ga0068864_100053213 Ga0068864_1000532132 254
514 3300006353 Ga0075370_10283004 Ga0075370_102830041 254
515 3300006358 Ga0068871_100139043 Ga0068871_1001390432 254
516 3300006881 Ga0068865_100248066 Ga0068865_1002480663 254
517 3300009098 Ga0105245_10079949 Ga0105245_100799492 254
518 3300010375 Ga0105239_10075944 Ga0105239_100759442 254
519 3300011119 Ga0105246_10098459 Ga0105246_100984592 254
520 3300013296 Ga0157374_10080954 Ga0157374_100809543 254
521 3300013306 Ga0163162_10124775 Ga0163162_101247752 254
522 3300013308 Ga0157375_10018732 Ga0157375_100187322 254
523 3300014325 Ga0163163_10175381 Ga0163163_101753812 254
524 3300014745 Ga0157377_10203701 Ga0157377_102037013 254
525 3300014969 Ga0157376_10143567 Ga0157376_101435672 254
526 3300025315 Ga0207697_10053949 Ga0207697_100539492 254
527 3300025901 Ga0207688_10078029 Ga0207688_100780293 254
528 3300025920 Ga0207649_10093549 Ga0207649_100935493 254
529 3300025927 Ga0207687_10025333 Ga0207687_100253332 254
530 3300026067 Ga0207678_10053206 Ga0207678_100532064 254
531 3300026095 Ga0207676_10264548 Ga0207676_102645482 254
532 3300026121 Ga0207683_10090469 Ga0207683_100904694 254
533 3300046458 Ga0495591_000251 Ga0495591_000251_34282_35046 254
534 3300046474 Ga0495605_0018977 Ga0495605_0018977_2663_3427 254
535 3300046492 Ga0495585_0001279 Ga0495585_0001279_10679_11443 254
536 3300046501 Ga0495607_0030451 Ga0495607_0030451_473_1237 254
537 3300046506 Ga0495583_0004255 Ga0495583_0004255_9213_9977 254
538 3300046507 Ga0495606_0001356 Ga0495606_0001356_7522_8286 254
539 3300046513 Ga0495616_0003233 Ga0495616_0003233_471_1235 254
540 3300046519 Ga0495632_0000681 Ga0495632_0000681_28558_29322 254
541 3300046524 Ga0495648_0003560 Ga0495648_0003560_12355_13119 254
542 3300046524 Ga0495648_0010240 Ga0495648_0010240_4106_4870 254
543 3300046660 Ga0495625_0026997 Ga0495625_0026997_1227_1991 254
544 3300046664 Ga0495659_0008109 Ga0495659_0008109_236_1000 254
545 3300046691 Ga0495670_0000770 Ga0495670_0000770_2120_2884 254
546 3300046692 Ga0495671_0011654 Ga0495671_0011654_4021_4785 254
547 3300046692 Ga0495671_0013199 Ga0495671_0013199_1095_1859 254
548 3300046810 Ga0495660_0001774 Ga0495660_0001774_3097_3861 254
549 3300047320 Ga0495672_0050386 Ga0495672_0050386_1143_1907 254
550 3300047323 Ga0495683_0002730 Ga0495683_0002730_731_1495 254
551 3300047469 Ga0495673_0003848 Ga0495673_0003848_7251_8015 254
552 3300047469 Ga0495673_0005900 Ga0495673_0005900_3318_4082 254
553 3300047469 Ga0495673_0028679 Ga0495673_0028679_444_1208 254
554 3300048091 Ga0495626_0001391 Ga0495626_0001391_16845_17609 254
555 3300048903 Ga0496100_0036374 Ga0496100_0036374_1422_2189 254
556 3300048904 Ga0496101_0242695 Ga0496101_0242695_295_1062 254
557 3300048905 Ga0496102_0006237 Ga0496102_0006237_5518_6285 254
558 3300048906 Ga0496103_0094082 Ga0496103_0094082_864_1631 254
559 3300048907 Ga0496104_0083602 Ga0496104_0083602_1743_2510 254
560 3300048908 Ga0496105_0017517 Ga0496105_0017517_1597_2364 254
561 3300048909 Ga0496106_0026512 Ga0496106_0026512_1382_2149 254
562 3300048910 Ga0496107_0003592 Ga0496107_0003592_3341_4108 254
563 3300048912 Ga0496109_0143239 Ga0496109_0143239_928_1695 254
564 3300048913 Ga0496110_0046958 Ga0496110_0046958_2674_3441 254
565 3300048914 Ga0496111_0045682 Ga0496111_0045682_643_1410 254
566 3300048915 Ga0496112_0138190 Ga0496112_0138190_483_1250 254
567 3300048916 Ga0496113_0088444 Ga0496113_0088444_1454_2221 254
568 3300048918 Ga0496115_0013677 Ga0496115_0013677_1018_1785 254
569 3300049460 Ga0495682_0001062 Ga0495682_0001062_3038_3802 254
570 3300049460 Ga0495682_0007135 Ga0495682_0007135_3009_3773 254
571 3300050496 nmdc:mga07m45_242283_c1 nmdc:mga07m45_242283_c1_171_941 254
572 iso_pu_bacteria 2775506901 2776259366 254
573 iso_pu_bacteria 2775506901 2776266308 254
574 iso_pu_bacteria 2840764183 2840764674 254
575 iso_pu_bacteria 2903748898 2903752999 254
576 iso_pu_bacteria 2904690495 2904697780 254
577 iso_pu_bacteria 2904699407 2904705941 254
578 iso_pu_bacteria 2906610324 2906611517 254
579 iso_pu_bacteria 2908756301 2908757123 254
580 iso_pu_bacteria 8006933436 8006933685 254
581 iso_pu_bacteria 8006973647 8006983357 254
582 3300003203 JGI25406J46586_10000085 JGI25406J46586_100000857 255
583 3300005985 Ga0081539_10000003 Ga0081539_1000000340 255
584 3300006173 Ga0070716_100386896 Ga0070716_1003868961 255
585 3300039438 Ga0436360_1020232 Ga0436360_1020232_1438_2250 255
586 3300046491 Ga0495584_0000018 Ga0495584_0000018_132758_133525 255
587 3300046506 Ga0495583_0008979 Ga0495583_0008979_3435_4202 255
588 3300046810 Ga0495660_0002528 Ga0495660_0002528_4385_5152 255
589 3300049459 Ga0495678_003182 Ga0495678_003182_6612_7379 255
590 iso_pu_bacteria 2513237146 2513924695 255
591 iso_pu_bacteria 2524023228 2524534551 255
592 iso_pu_bacteria 2599185170 2599416248 255
593 iso_pu_bacteria 2838035591 2838036372 255
594 iso_pu_bacteria 2842341865 2842342157 255
595 iso_pu_bacteria 2842363717 2842365867 255
596 iso_pu_bacteria 2941499720 2941505716 255
597 3300039447 Ga0436361_0204659 Ga0436361_0204659_698_1471 256
598 3300009177 Ga0105248_10034058 Ga0105248_100340586 257
599 3300009545 Ga0105237_10030235 Ga0105237_100302356 257
600 3300013104 Ga0157370_10168772 Ga0157370_101687721 257
601 3300014969 Ga0157376_10667290 Ga0157376_106672902 257
602 iso_pu_bacteria 2599185239 2599738877 257
603 iso_pu_bacteria 2818991452 2819631450 257
604 iso_pu_bacteria 2928170801 2928176080 257
605 iso_pu_bacteria 2981990288 2981996562 257
606 iso_pu_bacteria 641736154 642414425 257
607 iso_pu_bacteria 8018845410 8018851116 257
608 iso_pu_bacteria 8021120328 8021126097 257
609 3300005441 Ga0070700_100106267 Ga0070700_1001062672 258
610 3300005458 Ga0070681_10067376 Ga0070681_100673762 258
611 3300005459 Ga0068867_100605631 Ga0068867_1006056311 258
612 3300005983 Ga0081540_1047943 Ga0081540_10479432 258
613 3300005983 Ga0081540_1064159 Ga0081540_10641592 258
614 3300006881 Ga0068865_100382044 Ga0068865_1003820441 258
615 3300009148 Ga0105243_10621299 Ga0105243_106212992 258
616 3300009176 Ga0105242_10362484 Ga0105242_103624842 258
617 3300009551 Ga0105238_10874636 Ga0105238_108746361 258
618 3300021321 Ga0214542_1027346 Ga0214542_10273462 258
619 3300021327 Ga0214543_1001580 Ga0214543_100158021 258
620 3300025912 Ga0207707_10162591 Ga0207707_101625914 258
621 3300025915 Ga0207693_10032038 Ga0207693_100320382 258
622 3300025931 Ga0207644_10126042 Ga0207644_101260422 258
623 3300025934 Ga0207686_10299409 Ga0207686_102994092 258
624 3300025940 Ga0207691_10227241 Ga0207691_102272412 258
625 3300026075 Ga0207708_10145077 Ga0207708_101450773 258
626 3300026089 Ga0207648_10598162 Ga0207648_105981622 258
627 3300031730 Ga0307516_10310350 Ga0307516_103103502 258
628 3300033180 Ga0307510_10052806 Ga0307510_100528061 258
629 3300033442 Ga0315911_1000010 Ga0315911_100001098 258
630 3300039437 Ga0436365_0913976 Ga0436365_0913976_59_835 258
631 3300039447 Ga0436361_0082970 Ga0436361_0082970_4455_5231 258
632 3300039447 Ga0436361_0091951 Ga0436361_0091951_9868_10644 258
633 3300046461 Ga0495641_0034815 Ga0495641_0034815_818_1600 258
634 3300046557 Ga0495622_0069563 Ga0495622_0069563_472_1254 258
635 3300048924 Ga0496121_0137735 Ga0496121_0137735_339_1121 258
636 3300009176 Ga0105242_10084686 Ga0105242_100846861 259
637 3300010375 Ga0105239_10012140 Ga0105239_100121402 259
638 3300025261 Ga0209233_1001106 Ga0209233_10011067 259
639 3300025915 Ga0207693_10174175 Ga0207693_101741753 259
640 3300035116 Ga0373945_0098173 Ga0373945_0098173_312_1097 259
641 3300035691 Ga0373931_0002876 Ga0373931_0002876_5855_6640 259
642 3300039450 Ga0436363_0540076 Ga0436363_0540076_233_1024 259
643 3300039453 Ga0436362_0514368 Ga0436362_0514368_1314_2108 259
644 3300048903 Ga0496100_0021982 Ga0496100_0021982_2717_3502 259
645 3300048904 Ga0496101_0009247 Ga0496101_0009247_1073_1858 259
646 3300048905 Ga0496102_0018498 Ga0496102_0018498_274_1059 259
647 3300048907 Ga0496104_0048949 Ga0496104_0048949_1414_2199 259
648 3300048908 Ga0496105_0038302 Ga0496105_0038302_1448_2233 259
649 3300048909 Ga0496106_0016217 Ga0496106_0016217_3930_4715 259
650 3300048909 Ga0496106_0065252 Ga0496106_0065252_234_1019 259
651 3300048910 Ga0496107_0002391 Ga0496107_0002391_1610_2395 259
652 3300048912 Ga0496109_0060185 Ga0496109_0060185_1211_1996 259
653 3300048913 Ga0496110_0123808 Ga0496110_0123808_620_1405 259
654 3300048914 Ga0496111_0078950 Ga0496111_0078950_1296_2081 259
655 3300048915 Ga0496112_0052196 Ga0496112_0052196_1065_1850 259
656 3300048916 Ga0496113_0003901 Ga0496113_0003901_4478_5263 259
657 3300048917 Ga0496114_0017140 Ga0496114_0017140_1173_1958 259
658 3300048918 Ga0496115_0073868 Ga0496115_0073868_1771_2556 259
659 3300053119 Ga0500595_003304 Ga0500595_003304_3563_4510 259
660 3300053162 Ga0500638_052038 Ga0500638_052038_743_1690 259
661 iso_pu_bacteria 2513237145 2513915899 259
662 iso_pu_bacteria 2667528175 2671119212 259
663 iso_pu_bacteria 2906635258 2906642441 259
664 iso_pu_bacteria 2906660503 2906660748 259
665 iso_pu_bacteria 2908739725 2908745101 259
666 iso_pu_bacteria 2935630451 2935632226 259
667 iso_pu_bacteria 2941507105 2941508174 259
668 iso_pu_bacteria 2941515067 2941515321 259
669 iso_pu_bacteria 2941523033 2941524104 259
670 iso_pu_bacteria 3005474847 3005477550 259
671 iso_pu_bacteria 8019555841 8019559615 259
672 iso_pu_bacteria 8019565922 8019569718 259
673 3300003760 Ga0055527_1000150 Ga0055527_100015044 260
674 3300003761 Ga0055535_1000202 Ga0055535_100020244 260
675 3300003762 Ga0055542_1000237 Ga0055542_100023744 260
676 3300003763 Ga0055529_1000257 Ga0055529_100025744 260
677 3300003771 Ga0055526_1006673 Ga0055526_10066739 260
678 3300003781 Ga0055536_1000203 Ga0055536_100020310 260
679 3300003784 Ga0055534_1000660 Ga0055534_10006608 260
680 3300003790 Ga0055528_1000858 Ga0055528_100085813 260
681 3300003856 Ga0058692_1011333 Ga0058692_10113332 260
682 3300005983 Ga0081540_1013374 Ga0081540_10133743 260
683 3300013104 Ga0157370_10027578 Ga0157370_100275784 260
684 3300025228 Ga0209672_100035 Ga0209672_10003566 260
685 3300025229 Ga0209147_100041 Ga0209147_10004166 260
686 3300025242 Ga0209258_100063 Ga0209258_10006368 260
687 3300025254 Ga0209148_1000088 Ga0209148_100008866 260
688 3300025263 Ga0209565_1006577 Ga0209565_10065771 260
689 3300025272 Ga0209455_1000075 Ga0209455_1000075200 260
690 3300025273 Ga0209673_1000061 Ga0209673_100006166 260
691 3300025284 Ga0209130_1006540 Ga0209130_10065406 260
692 3300025291 Ga0209675_1000167 Ga0209675_100016754 260
693 3300025292 Ga0209676_1000121 Ga0209676_100012136 260
694 3300025294 Ga0209025_1000051 Ga0209025_1000051152 260
695 3300025295 Ga0209564_1000133 Ga0209564_100013331 260
696 3300025295 Ga0209564_1004064 Ga0209564_10040647 260
697 3300026075 Ga0207708_10005744 Ga0207708_1000574411 260
698 3300026118 Ga0207675_100115548 Ga0207675_1001155482 260
699 3300027312 Ga0209371_1000179 Ga0209371_100017944 260
700 3300030500 Ga0268256_1000149 Ga0268256_100014943 260
701 3300050507 nmdc:mga05p37_72341_c1 nmdc:mga05p37_72341_c1_2253_3044 260
702 3300001989 JGI24739J22299_10004632 JGI24739J22299_100046321 261
703 3300003758 Ga0055532_1001009 Ga0055532_10010094 261
704 3300005563 Ga0068855_100124512 Ga0068855_1001245123 261
705 3300025229 Ga0209147_100156 Ga0209147_10015648 261
706 3300025913 Ga0207695_10154144 Ga0207695_101541443 261
707 3300025949 Ga0207667_10061099 Ga0207667_100610994 261
708 3300035088 Ga0373940_0014228 Ga0373940_0014228_735_1544 261
709 3300035092 Ga0373952_0009842 Ga0373952_0009842_693_1502 261
710 3300035112 Ga0373932_0041064 Ga0373932_0041064_160_969 261
711 3300035121 Ga0373960_0004154 Ga0373960_0004154_2050_2859 261
712 3300035207 Ga0373942_0053073 Ga0373942_0053073_110_919 261
713 3300035241 Ga0373961_0076659 Ga0373961_0076659_37_846 261
714 3300047323 Ga0495683_0009551 Ga0495683_0009551_801_1673 261
715 3300048907 Ga0496104_0056150 Ga0496104_0056150_2219_3091 261
716 3300048908 Ga0496105_0000318 Ga0496105_0000318_8927_9799 261
717 3300048920 Ga0496117_0094433 Ga0496117_0094433_459_1352 261
718 3300048921 Ga0496118_0044513 Ga0496118_0044513_592_1485 261
719 3300048926 Ga0496123_0096315 Ga0496123_0096315_694_1587 261
720 iso_pu_bacteria 2842475841 2842477436 261
721 iso_pu_bacteria 2842502639 2842504232 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

72

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6005 14 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5589 14 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5462 14 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5191 14 251
7xq0-assembly1.cif.gz_A structure of hslc19a1+3'3'-cda 0.4053 21 252
ID Description Score Start End Superfamily
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4859 51 259 1.20.1250.20
af_Q22089_196_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4719 81 252 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4712 51 259 1.20.1250.20
af_Q2G1R0_213_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4547 53 253 1.20.1250.20
af_A4IA48_423_647_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.451 52 256 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6P2LV15-F1-model_v4 Probable membrane transporter protein 0.9604 2 261 GO:0005886
AF-A0A6P2LV15-F1-model_v4 Probable membrane transporter protein 0.9533 2 261 GO:0005886
AF-A0A1H8LSJ1-F1-model_v4 Probable membrane transporter protein 0.9105 11 226 GO:0005886
AF-A0A1Y5TKU4-F1-model_v4 Probable membrane transporter protein 0.9087 11 256 GO:0005886
AF-A0A7X6XQX7-F1-model_v4 Probable membrane transporter protein 0.8966 14 252 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map