F477117

General Info

Members Datasets Scaffolds Average Seq Length
717 378 1434 117

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0316723|Ga0495584_0316723_375_728
Length 107
Sequence MTDGIDLTEKLSSFSEHWSPRTVTQFNDCDVMVVKVKGEFVWHVLKGVLDIQLRDRTVTLGPGQMYVVPRGVEHRPVARDEVHLLLIEPTGTPNTGDAATAAPRRTA

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
228 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
229 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
323 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
324 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
325 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
326 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
327 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
328 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
337 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
342 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
343 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
344 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
350 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
351 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
355 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
356 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
357 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
358 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
359 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
360 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
361 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
362 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
363 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
364 2904699407
365 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
366 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
367 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
368 2922425934
369 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
370 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
371 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
372 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
373 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
374 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
375 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
376 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
377 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
378 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0.14
Isolates 3.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.64
Nodule 2.37
Rhizoplane 5.58
Rhizosphere 70.85
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0316723 3300046491 Bacteria 792
2 JGI24749J21850_1034193 3300002076 Bacteria 735
3 Ga0055528_1066225 3300003790 Bacteria 665
4 Ga0055540_1005663 3300003792 Bacteria 5180
5 Ga0055531_10006674 3300003794 Bacteria 6474
6 Ga0065712_10193223 3300005290 Bacteria 1127
7 Ga0065715_10136123 3300005293 Bacteria 1927
8 Ga0065707_10247212 3300005295 Bacteria 1136
9 Ga0070658_10131211 3300005327 Bacteria 2088
10 Ga0070658_10372858 3300005327 Unclassified 1223
11 Ga0070658_10611724 3300005327 Bacteria 944
12 Ga0070676_10123239 3300005328 Bacteria 1630
13 Ga0070676_10610778 3300005328 Bacteria 787
14 Ga0070676_10672251 3300005328 Bacteria 754
15 Ga0070683_102281464 3300005329 Unclassified 519
16 Ga0070690_100060285 3300005330 Bacteria 2442
17 Ga0070670_100131360 3300005331 Bacteria 2162
18 Ga0070670_100548332 3300005331 Bacteria 1031
19 Ga0070670_100750657 3300005331 Unclassified 879
20 Ga0070677_10052384 3300005333 Bacteria 1656
21 Ga0068869_100047515 3300005334 Bacteria 3100
22 Ga0068869_100117596 3300005334 Bacteria 2029
23 Ga0068869_100459612 3300005334 Bacteria 1056
24 Ga0070666_10599439 3300005335 Bacteria 804
25 Ga0070680_100005264 3300005336 Bacteria 9783
26 Ga0070680_100292556 3300005336 Bacteria 1380
27 Ga0070682_100978639 3300005337 Bacteria 701
28 Ga0070682_101240931 3300005337 Bacteria 631
29 Ga0068868_100053247 3300005338 Bacteria 3188
30 Ga0068868_100435681 3300005338 Bacteria 1137
31 Ga0068868_100799991 3300005338 Bacteria 851
32 Ga0068868_100860496 3300005338 Bacteria 822
33 Ga0070660_100059476 3300005339 Bacteria 2963
34 Ga0070660_100150438 3300005339 Bacteria 1871
35 Ga0070660_100273298 3300005339 Bacteria 1382
36 Ga0070660_100835257 3300005339 Bacteria 775
37 Ga0070689_100086538 3300005340 Unclassified 2465
38 Ga0070689_100099434 3300005340 Bacteria 2301
39 Ga0070689_100396596 3300005340 Bacteria 1166
40 Ga0070689_101556899 3300005340 Bacteria 600
41 Ga0070691_10939944 3300005341 Bacteria 536
42 Ga0070687_100077449 3300005343 Bacteria 1804
43 Ga0070687_100932202 3300005343 Bacteria 625
44 Ga0070661_101150465 3300005344 Bacteria 648
45 Ga0070668_100036879 3300005347 Bacteria 3731
46 Ga0070668_100104342 3300005347 Bacteria 2249
47 Ga0070668_100410713 3300005347 Bacteria 1157
48 Ga0070668_100467205 3300005347 Bacteria 1087
49 Ga0070668_101147504 3300005347 Bacteria 703
50 Ga0070669_100114137 3300005353 Bacteria 2053
51 Ga0070669_100179864 3300005353 Bacteria 1654
52 Ga0070669_101324358 3300005353 Bacteria 624
53 Ga0070675_100008159 3300005354 Bacteria 8115
54 Ga0070675_100151929 3300005354 Bacteria 1986
55 Ga0070675_100243532 3300005354 Bacteria 1572
56 Ga0070675_101215961 3300005354 Bacteria 694
57 Ga0070675_101652622 3300005354 Bacteria 591
58 Ga0070671_100116594 3300005355 Bacteria 2245
59 Ga0070671_100235621 3300005355 Bacteria 1553
60 Ga0070671_101018944 3300005355 Bacteria 726
61 Ga0070674_100124512 3300005356 Bacteria 1912
62 Ga0070674_100258980 3300005356 Bacteria 1370
63 Ga0070674_100331205 3300005356 Bacteria 1224
64 Ga0070674_100496387 3300005356 Bacteria 1016
65 Ga0070673_100009592 3300005364 Bacteria 6507
66 Ga0070673_100091132 3300005364 Bacteria 2492
67 Ga0070673_100333017 3300005364 Bacteria 1343
68 Ga0070673_101542315 3300005364 Bacteria 627
69 Ga0070688_101116352 3300005365 Bacteria 631
70 Ga0070659_100058142 3300005366 Bacteria 3051
71 Ga0070659_100205165 3300005366 Bacteria 1623
72 Ga0070659_100437578 3300005366 Bacteria 1107
73 Ga0070667_100191372 3300005367 Bacteria 1812
74 Ga0070667_100443470 3300005367 Bacteria 1186
75 Ga0070667_100529848 3300005367 Bacteria 1081
76 Ga0070709_10006958 3300005434 Bacteria 6175
77 Ga0070713_100321690 3300005436 Bacteria 1429
78 Ga0070713_100580472 3300005436 Bacteria 1064
79 Ga0070710_10010512 3300005437 Bacteria 4549
80 Ga0070701_10034415 3300005438 Unclassified 2537
81 Ga0070711_100141115 3300005439 Bacteria 1807
82 Ga0070705_100102701 3300005440 Bacteria 1809
83 Ga0070700_100166482 3300005441 Bacteria 1523
84 Ga0070694_100408368 3300005444 Bacteria 1065
85 Ga0070663_100018283 3300005455 Bacteria 4591
86 Ga0070663_100152966 3300005455 Bacteria 1770
87 Ga0070678_100261461 3300005456 Bacteria 1456
88 Ga0070662_100042829 3300005457 Bacteria 3235
89 Ga0070662_100253871 3300005457 Bacteria 1414
90 Ga0070681_10048651 3300005458 Bacteria 4237
91 Ga0068867_100677681 3300005459 Bacteria 907
92 Ga0068867_101675904 3300005459 Bacteria 596
93 Ga0070685_10307773 3300005466 Bacteria 1070
94 Ga0070698_100767434 3300005471 Bacteria 908
95 Ga0070699_102102499 3300005518 Bacteria 516
96 Ga0070679_100122998 3300005530 Bacteria 2578
97 Ga0070679_100408419 3300005530 Bacteria 1303
98 Ga0070679_100876827 3300005530 Bacteria 841
99 Ga0070684_100327787 3300005535 Bacteria 1407
100 Ga0068853_100099470 3300005539 Bacteria 2569
101 Ga0068853_100469962 3300005539 Bacteria 1184
102 Ga0068853_101304614 3300005539 Bacteria 702
103 Ga0070672_100006242 3300005543 Bacteria 7986
104 Ga0070672_100331538 3300005543 Bacteria 1295
105 Ga0070672_101535011 3300005543 Bacteria 597
106 Ga0070686_100407599 3300005544 Bacteria 1035
107 Ga0070693_100053394 3300005547 Bacteria 2320
108 Ga0070693_100434693 3300005547 Bacteria 917
109 Ga0070665_100022984 3300005548 Bacteria 6278
110 Ga0070665_100026622 3300005548 Bacteria 5822
111 Ga0070665_100231994 3300005548 Bacteria 1846
112 Ga0070665_100500870 3300005548 Bacteria 1226
113 Ga0070665_100744152 3300005548 Bacteria 993
114 Ga0070704_100091123 3300005549 Bacteria 2272
115 Ga0068855_100043940 3300005563 Bacteria 5290
116 Ga0068855_100064637 3300005563 Bacteria 4267
117 Ga0068855_100117710 3300005563 Bacteria 3043
118 Ga0068855_100708722 3300005563 Bacteria 1076
119 Ga0070664_100444399 3300005564 Bacteria 1190
120 Ga0070664_100968125 3300005564 Bacteria 799
121 Ga0068857_100627056 3300005577 Bacteria 1017
122 Ga0068857_101256132 3300005577 Bacteria 718
123 Ga0068854_101047311 3300005578 Bacteria 724
124 Ga0068854_101593298 3300005578 Bacteria 595
125 Ga0068856_100688733 3300005614 Bacteria 1042
126 Ga0068852_100096412 3300005616 Bacteria 2658
127 Ga0068852_100834461 3300005616 Bacteria 937
128 Ga0068852_101106285 3300005616 Bacteria 813
129 Ga0068859_100002736 3300005617 Bacteria 17891
130 Ga0068859_100504089 3300005617 Bacteria 1305
131 Ga0068859_100573231 3300005617 Bacteria 1222
132 Ga0068859_100635764 3300005617 Bacteria 1159
133 Ga0068859_101096795 3300005617 Bacteria 875
134 Ga0068864_100109121 3300005618 Bacteria 2463
135 Ga0068864_100131373 3300005618 Bacteria 2249
136 Ga0068864_100889971 3300005618 Bacteria 879
137 Ga0068864_101292290 3300005618 Bacteria 730
138 Ga0068866_10091124 3300005718 Bacteria 1660
139 Ga0068861_100024747 3300005719 Bacteria 4345
140 Ga0068861_100071452 3300005719 Bacteria 2690
141 Ga0068861_100327770 3300005719 Bacteria 1335
142 Ga0068870_10357705 3300005840 Bacteria 939
143 Ga0068870_10594271 3300005840 Unclassified 751
144 Ga0068863_100053847 3300005841 Bacteria 3814
145 Ga0068863_100347016 3300005841 Bacteria 1445
146 Ga0068863_100512018 3300005841 Bacteria 1183
147 Ga0068858_100125607 3300005842 Bacteria 2402
148 Ga0068858_100220651 3300005842 Bacteria 1795
149 Ga0068858_100290970 3300005842 Bacteria 1557
150 Ga0068858_100621509 3300005842 Bacteria 1049
151 Ga0068860_100011029 3300005843 Bacteria 8910
152 Ga0068860_100199927 3300005843 Bacteria 1936
153 Ga0068860_100445091 3300005843 Bacteria 1287
154 Ga0068860_100660524 3300005843 Bacteria 1053
155 Ga0068862_100075460 3300005844 Bacteria 2916
156 Ga0068862_100134215 3300005844 Bacteria 2192
157 Ga0068862_100600500 3300005844 Bacteria 1056
158 Ga0068862_101333371 3300005844 Bacteria 719
159 Ga0068862_101459988 3300005844 Bacteria 688
160 Ga0081455_10051352 3300005937 Bacteria 3537
161 Ga0070717_11151238 3300006028 Bacteria 706
162 Ga0075365_10072110 3300006038 Bacteria 2326
163 Ga0075365_10154402 3300006038 Bacteria 1597
164 Ga0075365_10231822 3300006038 Bacteria 1296
165 Ga0075365_10424015 3300006038 Bacteria 939
166 Ga0075365_10638638 3300006038 Bacteria 752
167 Ga0075368_10466375 3300006042 Bacteria 561
168 Ga0075368_10524046 3300006042 Bacteria 531
169 Ga0075363_100050423 3300006048 Bacteria 2218
170 Ga0075363_100117147 3300006048 Bacteria 1484
171 Ga0075363_100540457 3300006048 Bacteria 695
172 Ga0075364_10135946 3300006051 Bacteria 1651
173 Ga0075364_10151219 3300006051 Bacteria 1564
174 Ga0075432_10358442 3300006058 Bacteria 620
175 Ga0070716_100039535 3300006173 Bacteria 2619
176 Ga0070716_100606841 3300006173 Bacteria 824
177 Ga0070712_100000951 3300006175 Bacteria 17412
178 Ga0075362_10043079 3300006177 Bacteria 1998
179 Ga0075362_10129870 3300006177 Bacteria 1197
180 Ga0075362_10380687 3300006177 Bacteria 710
181 Ga0075367_10007812 3300006178 Bacteria 5502
182 Ga0075367_10087581 3300006178 Bacteria 1891
183 Ga0075367_10675461 3300006178 Bacteria 657
184 Ga0075369_10085534 3300006186 Bacteria 1402
185 Ga0075369_10143261 3300006186 Bacteria 1090
186 Ga0075369_10165402 3300006186 Bacteria 1014
187 Ga0075369_10418314 3300006186 Bacteria 633
188 Ga0075366_10036473 3300006195 Bacteria 2899
189 Ga0075366_10192240 3300006195 Bacteria 1240
190 Ga0075366_10596708 3300006195 Bacteria 684
191 Ga0075366_10680641 3300006195 Bacteria 639
192 Ga0097621_100091438 3300006237 Bacteria 2547
193 Ga0097621_100862678 3300006237 Bacteria 842
194 Ga0075370_10072032 3300006353 Bacteria 1978
195 Ga0075370_10157396 3300006353 Bacteria 1332
196 Ga0075370_10298193 3300006353 Bacteria 958
197 Ga0075370_10587120 3300006353 Bacteria 675
198 Ga0068871_100304169 3300006358 Bacteria 1400
199 Ga0068871_100798810 3300006358 Bacteria 870
200 Ga0068871_100910210 3300006358 Bacteria 816
201 Ga0068871_101178550 3300006358 Bacteria 718
202 Ga0075428_100058225 3300006844 Bacteria 4230
203 Ga0075428_100286200 3300006844 Bacteria 1773
204 Ga0075434_100087362 3300006871 Bacteria 3119
205 Ga0068865_100793020 3300006881 Bacteria 817
206 Ga0075436_100334212 3300006914 Bacteria 1090
207 Ga0097620_100002736 3300006931 Bacteria 17891
208 Ga0097620_100504061 3300006931 Bacteria 1305
209 Ga0097620_100573239 3300006931 Bacteria 1222
210 Ga0097620_100635785 3300006931 Bacteria 1159
211 Ga0097620_101096857 3300006931 Bacteria 875
212 Ga0075435_100603855 3300007076 Bacteria 952
213 Ga0099794_10003403 3300007265 Bacteria 6063
214 Ga0099795_10176822 3300007788 Unclassified 889
215 Ga0099795_10441260 3300007788 Bacteria 598
216 Ga0105250_10030194 3300009092 Bacteria 2179
217 Ga0105250_10127323 3300009092 Bacteria 1050
218 Ga0105250_10604110 3300009092 Bacteria 508
219 Ga0105240_10788542 3300009093 Bacteria 1030
220 Ga0105240_11673669 3300009093 Bacteria 665
221 Ga0111539_10021024 3300009094 Bacteria 8036
222 Ga0105245_10203126 3300009098 Bacteria 1904
223 Ga0105245_10239297 3300009098 Bacteria 1759
224 Ga0105245_11031544 3300009098 Bacteria 867
225 Ga0105247_10037147 3300009101 Bacteria 2971
226 Ga0105247_10146615 3300009101 Bacteria 1552
227 Ga0105247_10398369 3300009101 Bacteria 980
228 Ga0114129_11123901 3300009147 Bacteria 982
229 Ga0105243_10158076 3300009148 Bacteria 1951
230 Ga0105243_10801352 3300009148 Bacteria 928
231 Ga0105243_11059938 3300009148 Bacteria 817
232 Ga0105243_12696303 3300009148 Bacteria 537
233 Ga0105241_10585774 3300009174 Bacteria 1006
234 Ga0105241_10813996 3300009174 Bacteria 861
235 Ga0105241_11130210 3300009174 Bacteria 739
236 Ga0105242_10097246 3300009176 Bacteria 2489
237 Ga0105242_10826861 3300009176 Bacteria 919
238 Ga0105242_11823625 3300009176 Bacteria 647
239 Ga0105248_10766171 3300009177 Bacteria 1089
240 Ga0105248_11084950 3300009177 Bacteria 905
241 Ga0105237_10072361 3300009545 Bacteria 3441
242 Ga0105238_10779843 3300009551 Bacteria 971
243 Ga0105238_11396690 3300009551 Bacteria 727
244 Ga0105238_11481650 3300009551 Bacteria 707
245 Ga0105249_10098349 3300009553 Bacteria 2748
246 Ga0105249_11140049 3300009553 Bacteria 850
247 Ga0105249_12931517 3300009553 Bacteria 548
248 Ga0099796_10034442 3300010159 Bacteria 1673
249 Ga0099796_10063069 3300010159 Unclassified 1319
250 Ga0105239_10035945 3300010375 Bacteria 5438
251 Ga0105239_10124717 3300010375 Bacteria 2862
252 Ga0105239_10855553 3300010375 Bacteria 1043
253 Ga0105246_10042407 3300011119 Bacteria 3081
254 Ga0105246_10269036 3300011119 Bacteria 1361
255 Ga0105246_10337992 3300011119 Bacteria 1230
256 Ga0105246_10946787 3300011119 Bacteria 776
257 Ga0105246_10952600 3300011119 Bacteria 774
258 Ga0157373_10510928 3300013100 Bacteria 869
259 Ga0157371_10153425 3300013102 Bacteria 1643
260 Ga0157371_10752555 3300013102 Bacteria 732
261 Ga0157370_10548458 3300013104 Bacteria 1060
262 Ga0157370_11204604 3300013104 Bacteria 683
263 Ga0157369_11078890 3300013105 Bacteria 821
264 Ga0157369_11273224 3300013105 Bacteria 750
265 Ga0157374_10044217 3300013296 Bacteria 4117
266 Ga0157374_10600485 3300013296 Bacteria 1110
267 Ga0157378_10005363 3300013297 Bacteria 11249
268 Ga0157378_10522012 3300013297 Bacteria 1189
269 Ga0157378_10955524 3300013297 Bacteria 890
270 Ga0157378_11540908 3300013297 Bacteria 710
271 Ga0157378_11587179 3300013297 Unclassified 700
272 Ga0163162_10255081 3300013306 Bacteria 1886
273 Ga0163162_10268451 3300013306 Bacteria 1838
274 Ga0163162_10348835 3300013306 Bacteria 1613
275 Ga0163162_10431037 3300013306 Bacteria 1450
276 Ga0163162_10739578 3300013306 Bacteria 1103
277 Ga0163162_11208048 3300013306 Bacteria 858
278 Ga0163162_11531212 3300013306 Unclassified 760
279 Ga0157372_10192555 3300013307 Bacteria 2362
280 Ga0157375_10324454 3300013308 Bacteria 1704
281 Ga0157375_10645845 3300013308 Bacteria 1215
282 Ga0157375_11302157 3300013308 Bacteria 854
283 Ga0157375_11843852 3300013308 Bacteria 717
284 Ga0157375_13276674 3300013308 Bacteria 540
285 Ga0163163_10443296 3300014325 Bacteria 1358
286 Ga0163163_10687757 3300014325 Bacteria 1086
287 Ga0163163_10974038 3300014325 Bacteria 911
288 Ga0157380_10245257 3300014326 Bacteria 1618
289 Ga0157380_10784199 3300014326 Bacteria 968
290 Ga0157380_11446589 3300014326 Bacteria 739
291 Ga0157377_10011325 3300014745 Bacteria 4446
292 Ga0157377_10104968 3300014745 Bacteria 1690
293 Ga0157377_10209610 3300014745 Bacteria 1242
294 Ga0157377_10496182 3300014745 Bacteria 852
295 Ga0157379_10053255 3300014968 Bacteria 3615
296 Ga0157379_10304506 3300014968 Bacteria 1453
297 Ga0157376_10155139 3300014969 Bacteria 2069
298 Ga0157376_10175902 3300014969 Bacteria 1952
299 Ga0157376_10296329 3300014969 Bacteria 1529
300 Ga0157376_11263485 3300014969 Unclassified 768
301 Ga0182007_10175457 3300015262 Bacteria 739
302 Ga0163161_10113379 3300017792 Bacteria 2029
303 Ga0163161_10456040 3300017792 Bacteria 1034
304 Ga0163161_10660202 3300017792 Bacteria 867
305 Ga0163161_10680399 3300017792 Bacteria 855
306 Ga0163161_11435694 3300017792 Bacteria 604
307 Ga0209233_1006618 3300025261 Bacteria 3720
308 Ga0209673_1016651 3300025273 Bacteria 2738
309 Ga0209758_1030384 3300025297 Bacteria 2239
310 Ga0209051_1000055 3300025303 Bacteria 277194
311 Ga0209257_1000101 3300025304 Bacteria 251553
312 Ga0207697_10174948 3300025315 Bacteria 939
313 Ga0207682_10102091 3300025893 Bacteria 1255
314 Ga0207682_10110695 3300025893 Bacteria 1209
315 Ga0207692_10028124 3300025898 Bacteria 2655
316 Ga0207642_10507950 3300025899 Bacteria 739
317 Ga0207710_10019727 3300025900 Bacteria 2878
318 Ga0207710_10037655 3300025900 Bacteria 2137
319 Ga0207710_10686579 3300025900 Bacteria 537
320 Ga0207688_10023525 3300025901 Bacteria 3374
321 Ga0207688_10433860 3300025901 Bacteria 818
322 Ga0207680_10013086 3300025903 Bacteria 4249
323 Ga0207647_10149552 3300025904 Bacteria 1365
324 Ga0207699_10012904 3300025906 Bacteria 4259
325 Ga0207645_10324327 3300025907 Bacteria 1028
326 Ga0207645_10473799 3300025907 Bacteria 846
327 Ga0207645_10620189 3300025907 Bacteria 734
328 Ga0207645_10863139 3300025907 Bacteria 615
329 Ga0207643_10285672 3300025908 Bacteria 1024
330 Ga0207643_10547354 3300025908 Bacteria 742
331 Ga0207643_10552838 3300025908 Unclassified 739
332 Ga0207705_10182589 3300025909 Unclassified 1584
333 Ga0207705_10646341 3300025909 Bacteria 822
334 Ga0207654_10003593 3300025911 Bacteria 7841
335 Ga0207707_10282770 3300025912 Bacteria 1437
336 Ga0207671_10035158 3300025914 Bacteria 3720
337 Ga0207671_10053994 3300025914 Bacteria 2977
338 Ga0207693_10020036 3300025915 Bacteria 5321
339 Ga0207663_10221148 3300025916 Bacteria 1378
340 Ga0207663_10385592 3300025916 Bacteria 1068
341 Ga0207660_10142019 3300025917 Bacteria 1836
342 Ga0207660_10164388 3300025917 Bacteria 1714
343 Ga0207662_10320890 3300025918 Bacteria 1034
344 Ga0207657_10005102 3300025919 Bacteria 13757
345 Ga0207657_10058944 3300025919 Bacteria 3302
346 Ga0207657_10249951 3300025919 Bacteria 1414
347 Ga0207681_10267258 3300025923 Bacteria 1341
348 Ga0207681_10782504 3300025923 Bacteria 796
349 Ga0207694_10737526 3300025924 Bacteria 831
350 Ga0207650_10109998 3300025925 Bacteria 2132
351 Ga0207659_10000772 3300025926 Bacteria 18985
352 Ga0207659_10074425 3300025926 Bacteria 2489
353 Ga0207659_10684928 3300025926 Bacteria 877
354 Ga0207659_10905171 3300025926 Bacteria 758
355 Ga0207687_10021600 3300025927 Bacteria 4277
356 Ga0207687_11642414 3300025927 Bacteria 551
357 Ga0207687_11859333 3300025927 Bacteria 515
358 Ga0207700_10301064 3300025928 Bacteria 1385
359 Ga0207644_10851404 3300025931 Bacteria 763
360 Ga0207644_10884782 3300025931 Bacteria 748
361 Ga0207690_10413208 3300025932 Bacteria 1078
362 Ga0207706_10112956 3300025933 Bacteria 2390
363 Ga0207706_11203566 3300025933 Bacteria 629
364 Ga0207686_10655413 3300025934 Bacteria 831
365 Ga0207686_10806677 3300025934 Bacteria 753
366 Ga0207686_10920461 3300025934 Bacteria 706
367 Ga0207709_11335065 3300025935 Bacteria 593
368 Ga0207670_10059085 3300025936 Unclassified 2607
369 Ga0207670_10072520 3300025936 Bacteria 2384
370 Ga0207670_10275016 3300025936 Bacteria 1310
371 Ga0207670_10388829 3300025936 Bacteria 1113
372 Ga0207669_10139254 3300025937 Bacteria 1681
373 Ga0207669_10155763 3300025937 Bacteria 1607
374 Ga0207669_10882571 3300025937 Bacteria 746
375 Ga0207669_11358212 3300025937 Bacteria 604
376 Ga0207704_10160372 3300025938 Bacteria 1599
377 Ga0207704_11139392 3300025938 Bacteria 664
378 Ga0207665_10084303 3300025939 Bacteria 2193
379 Ga0207691_10074693 3300025940 Unclassified 3057
380 Ga0207691_10094815 3300025940 Bacteria 2670
381 Ga0207691_10409102 3300025940 Bacteria 1157
382 Ga0207691_10586463 3300025940 Bacteria 944
383 Ga0207691_10819085 3300025940 Bacteria 782
384 Ga0207711_10381546 3300025941 Bacteria 1308
385 Ga0207711_10486911 3300025941 Bacteria 1149
386 Ga0207689_10030057 3300025942 Bacteria 4529
387 Ga0207689_10155301 3300025942 Bacteria 1886
388 Ga0207689_10163585 3300025942 Bacteria 1833
389 Ga0207689_10366124 3300025942 Bacteria 1199
390 Ga0207689_10475262 3300025942 Bacteria 1046
391 Ga0207689_11518062 3300025942 Bacteria 559
392 Ga0207679_10764433 3300025945 Bacteria 879
393 Ga0207667_10120040 3300025949 Bacteria 2709
394 Ga0207667_10188271 3300025949 Bacteria 2118
395 Ga0207667_10570993 3300025949 Bacteria 1142
396 Ga0207651_10004299 3300025960 Bacteria 7152
397 Ga0207651_10055151 3300025960 Bacteria 2728
398 Ga0207651_10352920 3300025960 Bacteria 1239
399 Ga0207712_10404014 3300025961 Bacteria 1149
400 Ga0207712_10794375 3300025961 Bacteria 832
401 Ga0207668_10059369 3300025972 Bacteria 2679
402 Ga0207668_10528827 3300025972 Bacteria 1018
403 Ga0207668_10637953 3300025972 Bacteria 931
404 Ga0207668_11005567 3300025972 Bacteria 745
405 Ga0207668_11735769 3300025972 Bacteria 563
406 Ga0207658_10605772 3300025986 Bacteria 984
407 Ga0207677_10393444 3300026023 Bacteria 1173
408 Ga0207677_10457214 3300026023 Bacteria 1095
409 Ga0207677_11454873 3300026023 Bacteria 632
410 Ga0207703_10097771 3300026035 Bacteria 2481
411 Ga0207703_10215863 3300026035 Bacteria 1713
412 Ga0207639_10131778 3300026041 Bacteria 2070
413 Ga0207639_10245652 3300026041 Bacteria 1559
414 Ga0207639_10280230 3300026041 Bacteria 1466
415 Ga0207678_10037382 3300026067 Bacteria 4222
416 Ga0207678_10720544 3300026067 Bacteria 878
417 Ga0207678_10989957 3300026067 Bacteria 744
418 Ga0207708_10344113 3300026075 Bacteria 1222
419 Ga0207702_10051224 3300026078 Bacteria 3488
420 Ga0207641_10099173 3300026088 Bacteria 2563
421 Ga0207641_10321365 3300026088 Bacteria 1468
422 Ga0207648_10012968 3300026089 Bacteria 7779
423 Ga0207648_10751959 3300026089 Bacteria 905
424 Ga0207676_10035414 3300026095 Bacteria 3788
425 Ga0207676_11257607 3300026095 Bacteria 734
426 Ga0207674_10649822 3300026116 Bacteria 1018
427 Ga0207674_10775842 3300026116 Bacteria 925
428 Ga0207675_100154879 3300026118 Bacteria 2183
429 Ga0207675_100159412 3300026118 Bacteria 2152
430 Ga0207675_100332032 3300026118 Bacteria 1487
431 Ga0207675_101702576 3300026118 Bacteria 650
432 Ga0207698_10065830 3300026142 Bacteria 2849
433 Ga0209179_1064206 3300027512 Unclassified 799
434 Ga0209588_1004111 3300027671 Bacteria 4079
435 Ga0209813_10241565 3300027866 Bacteria 683
436 Ga0207428_10058958 3300027907 Bacteria 3045
437 Ga0268266_10002854 3300028379 Bacteria 18005
438 Ga0268266_10256937 3300028379 Bacteria 1618
439 Ga0268266_10362585 3300028379 Bacteria 1364
440 Ga0268265_10156852 3300028380 Bacteria 1927
441 Ga0268265_10250917 3300028380 Bacteria 1567
442 Ga0268265_10584999 3300028380 Bacteria 1064
443 Ga0268264_10037660 3300028381 Unclassified 3988
444 Ga0268264_10132895 3300028381 Bacteria 2209
445 Ga0268264_10402572 3300028381 Bacteria 1316
446 Ga0268264_11267110 3300028381 Bacteria 747
447 Ga0268264_11606856 3300028381 Bacteria 661
448 Ga0307517_10278262 3300028786 Bacteria 956
449 Ga0307517_10351815 3300028786 Bacteria 800
450 Ga0307515_10349203 3300028794 Bacteria 1127
451 Ga0307511_10084540 3300030521 Bacteria 2201
452 Ga0307513_10159519 3300031456 Bacteria 2150
453 Ga0307509_10388989 3300031507 Bacteria 1105
454 Ga0265313_10015491 3300031595 Bacteria 4433
455 Ga0307508_10096558 3300031616 Bacteria 2546
456 Ga0307508_10125530 3300031616 Bacteria 2168
457 Ga0265314_10384356 3300031711 Bacteria 763
458 Ga0265342_10000843 3300031712 Bacteria 30662
459 Ga0307516_10170702 3300031730 Bacteria 1916
460 Ga0307516_10251770 3300031730 Bacteria 1460
461 Ga0307516_10456053 3300031730 Bacteria 934
462 Ga0307516_10840111 3300031730 Bacteria 581
463 Ga0307406_11487867 3300031901 Bacteria 595
464 Ga0307412_10132287 3300031911 Bacteria 1814
465 Ga0307416_100264067 3300032002 Bacteria 1685
466 Ga0307415_100343442 3300032126 Bacteria 1254
467 Ga0307415_101493491 3300032126 Bacteria 646
468 Ga0307507_10047307 3300033179 Bacteria 4203
469 Ga0307510_10387545 3300033180 Bacteria 842
470 Ga0373958_0145846 3300034819 Bacteria 589
471 Ga0373943_0090908 3300035170 Bacteria 1581
472 Ga0373935_0012593 3300035692 Bacteria 5088
473 Ga0373927_0054172 3300035695 Bacteria 2594
474 Ga0373947_1038037 3300035725 Bacteria 559
475 Ga0373925_0007023 3300037068 Bacteria 8225
476 Ga0395898_0979198 3300037466 Bacteria 782
477 Ga0395905_0501375 3300037471 Bacteria 1114
478 Ga0451787_269926 3300041441 Bacteria 798
479 Ga0451793_0486698 3300041452 Bacteria 1153
480 Ga0451793_1540473 3300041452 Bacteria 705
481 Ga0451797_1033710 3300041453 Bacteria 516
482 Ga0451795_0305214 3300041456 Bacteria 542
483 Ga0451795_1553351 3300041456 Bacteria 547
484 Ga0451800_0461331 3300041459 Bacteria 1017
485 Ga0451839_0868187 3300041496 Bacteria 1019
486 Ga0451845_0110141 3300041501 Bacteria 1106
487 Ga0451851_0775507 3300041507 Bacteria 689
488 Ga0451843_0307086 3300041509 Bacteria 1021
489 Ga0451853_3926746 3300041512 Bacteria 514
490 Ga0439440_0075816 3300042993 Bacteria 882
491 Ga0466966_0326624 3300044684 Bacteria 922
492 Ga0466959_0366735 3300045049 Bacteria 981
493 Ga0466959_0669003 3300045049 Bacteria 696
494 Ga0451576_1591628 3300045051 Bacteria 678
495 Ga0495617_072881 3300046452 Bacteria 1129
496 Ga0495617_138363 3300046452 Bacteria 778
497 Ga0495603_0115526 3300046455 Bacteria 1565
498 Ga0495638_0144090 3300046460 Bacteria 1387
499 Ga0495638_0247043 3300046460 Bacteria 985
500 Ga0495638_0382550 3300046460 Bacteria 735
501 Ga0495650_0124736 3300046471 Bacteria 945
502 Ga0495605_0270520 3300046474 Bacteria 724
503 Ga0495584_0053365 3300046491 Bacteria 2034
504 Ga0495584_0318945 3300046491 Bacteria 789
505 Ga0495585_0269721 3300046492 Bacteria 844
506 Ga0495585_0290746 3300046492 Bacteria 805
507 Ga0495585_0398204 3300046492 Bacteria 663
508 Ga0495594_0253316 3300046499 Bacteria 1003
509 Ga0495596_0111391 3300046500 Bacteria 1063
510 Ga0495607_0091607 3300046501 Bacteria 1646
511 Ga0495610_0208871 3300046512 Bacteria 795
512 Ga0495616_0052563 3300046513 Bacteria 2028
513 Ga0495620_0079041 3300046515 Bacteria 1333
514 Ga0495628_0650607 3300046516 Bacteria 748
515 Ga0495631_0114370 3300046518 Bacteria 1160
516 Ga0495631_0460195 3300046518 Bacteria 542
517 Ga0495632_0232898 3300046519 Bacteria 830
518 Ga0495632_0283879 3300046519 Bacteria 737
519 Ga0495637_0364677 3300046520 Bacteria 505
520 Ga0495643_0454274 3300046522 Bacteria 557
521 Ga0495644_0023943 3300046523 Bacteria 2323
522 Ga0495648_0296546 3300046524 Bacteria 759
523 Ga0495663_0127476 3300046525 Bacteria 856
524 Ga0495642_0151178 3300046528 Bacteria 1004
525 Ga0495598_0009693 3300046537 Bacteria 2285
526 Ga0495609_0372753 3300046538 Bacteria 574
527 Ga0495622_0165978 3300046557 Bacteria 994
528 Ga0495622_0389862 3300046557 Bacteria 601
529 Ga0495633_0085101 3300046558 Bacteria 1471
530 Ga0495633_0433190 3300046558 Bacteria 594
531 Ga0495656_0161456 3300046615 Bacteria 1089
532 Ga0495656_0744054 3300046615 Bacteria 529
533 Ga0495634_0505652 3300046642 Bacteria 708
534 Ga0495611_0369866 3300046648 Bacteria 657
535 Ga0495611_0399734 3300046648 Bacteria 628
536 Ga0495625_0142904 3300046660 Bacteria 1613
537 Ga0495625_0217632 3300046660 Bacteria 1253
538 Ga0495659_0005385 3300046664 Bacteria 4025
539 Ga0495661_0249470 3300046665 Bacteria 907
540 Ga0495623_0074149 3300046679 Bacteria 2115
541 Ga0495669_0013177 3300046684 Bacteria 3521
542 Ga0495669_0109008 3300046684 Bacteria 1291
543 Ga0495669_0134551 3300046684 Bacteria 1165
544 Ga0495669_0409666 3300046684 Bacteria 657
545 Ga0495624_0673054 3300046690 Bacteria 615
546 Ga0495671_0460553 3300046692 Bacteria 607
547 Ga0495649_0092029 3300046694 Bacteria 1615
548 Ga0495649_0224948 3300046694 Bacteria 970
549 Ga0495589_0076232 3300046794 Bacteria 1635
550 Ga0495589_0286297 3300046794 Bacteria 765
551 Ga0495660_0326009 3300046810 Bacteria 689
552 Ga0495604_0282650 3300047317 Bacteria 1121
553 Ga0495672_0013393 3300047320 Bacteria 5661
554 Ga0495673_0042175 3300047469 Bacteria 2050
555 Ga0495686_0331643 3300047472 Bacteria 831
556 Ga0496100_0287862 3300048903 Bacteria 1227
557 Ga0496101_0173280 3300048904 Bacteria 1659
558 Ga0496101_0690193 3300048904 Bacteria 806
559 Ga0496102_0444826 3300048905 Bacteria 1216
560 Ga0496102_0693779 3300048905 Bacteria 941
561 Ga0496102_1657047 3300048905 Bacteria 558
562 Ga0496104_0007991 3300048907 Bacteria 9379
563 Ga0496104_0445406 3300048907 Bacteria 1207
564 Ga0496105_0022621 3300048908 Bacteria 5092
565 Ga0496105_0817232 3300048908 Bacteria 708
566 Ga0496106_0000823 3300048909 Bacteria 22502
567 Ga0496107_0293922 3300048910 Bacteria 1209
568 Ga0496107_0407043 3300048910 Bacteria 1012
569 Ga0496107_0695260 3300048910 Bacteria 748
570 Ga0496107_0699196 3300048910 Bacteria 746
571 Ga0496107_1054646 3300048910 Bacteria 588
572 Ga0496108_0527753 3300048911 Bacteria 1031
573 Ga0496108_1179464 3300048911 Bacteria 648
574 Ga0496108_1573070 3300048911 Bacteria 545
575 Ga0496109_0443791 3300048912 Bacteria 1226
576 Ga0496110_0379526 3300048913 Bacteria 1288
577 Ga0496111_0039571 3300048914 Bacteria 3381
578 Ga0496111_0233151 3300048914 Bacteria 1367
579 Ga0496112_0117208 3300048915 Bacteria 2633
580 Ga0496112_0691761 3300048915 Bacteria 948
581 Ga0496113_0062270 3300048916 Bacteria 2817
582 Ga0496113_0305793 3300048916 Bacteria 1274
583 Ga0496114_0174500 3300048917 Bacteria 1875
584 Ga0496114_0207640 3300048917 Bacteria 1717
585 Ga0496114_0777430 3300048917 Bacteria 836
586 Ga0496115_0177266 3300048918 Bacteria 1762
587 Ga0496115_0310199 3300048918 Bacteria 1292
588 Ga0496118_0003610 3300048921 Bacteria 19225
589 Ga0496119_0506608 3300048922 Bacteria 561
590 Ga0496121_0000041 3300048924 Bacteria 346686
591 Ga0496121_0031388 3300048924 Bacteria 4854
592 Ga0496121_0040880 3300048924 Bacteria 4061
593 Ga0496121_0075021 3300048924 Bacteria 2703
594 Ga0496121_0082307 3300048924 Bacteria 2545
595 Ga0496121_0186029 3300048924 Bacteria 1494
596 Ga0496121_0242134 3300048924 Bacteria 1256
597 Ga0496121_0260498 3300048924 Bacteria 1197
598 Ga0496124_0012074 3300048927 Bacteria 8573
599 Ga0496124_0058100 3300048927 Bacteria 3255
600 Ga0496125_0018399 3300048928 Bacteria 6637
601 Ga0496125_0308763 3300048928 Bacteria 965
602 Ga0496125_0353316 3300048928 Bacteria 877
603 Ga0496126_0005875 3300048929 Bacteria 13844
604 Ga0496126_0023926 3300048929 Bacteria 5906
605 Ga0496126_0085029 3300048929 Bacteria 2789
606 Ga0496126_0176571 3300048929 Bacteria 1816
607 Ga0496126_0251575 3300048929 Bacteria 1472
608 Ga0496126_0521746 3300048929 Bacteria 946
609 Ga0495682_0125380 3300049460 Bacteria 919
610 Ga0501036_1248346 3300049572 Bacteria 605
611 Ga0501047_0055649 3300049581 Bacteria 3825
612 Ga0501072_0076673 3300049588 Bacteria 2645
613 Ga0501076_1101378 3300049592 Bacteria 654
614 Ga0501079_0055765 3300049741 Bacteria 3049
615 Ga0501080_0595545 3300049742 Bacteria 982
616 Ga0501081_0211468 3300049743 Bacteria 1409
617 nmdc:mga03683_192922_c1 3300050489 Bacteria 933
618 nmdc:mga03683_57966_c1 3300050489 Bacteria 1631
619 nmdc:mga03n38_229172_c1 3300050490 Bacteria 973
620 nmdc:mga00v17_158549_c1 3300050491 Bacteria 1456
621 nmdc:mga0yw44_237847_c1 3300050492 Bacteria 1210
622 nmdc:mga0yw44_47061_c1 3300050492 Bacteria 2594
623 nmdc:mga0yw44_6514_c1 3300050492 Bacteria 5652
624 nmdc:mga0k408_12947_c1 3300050493 Bacteria 4568
625 nmdc:mga0k408_302846_c1 3300050493 Bacteria 954
626 nmdc:mga0k408_498496_c1 3300050493 Bacteria 722
627 nmdc:mga0k408_517296_c1 3300050493 Bacteria 707
628 nmdc:mga06z11_118035_c1 3300050494 Bacteria 1477
629 nmdc:mga06z11_189262_c1 3300050494 Bacteria 1191
630 nmdc:mga06z11_247955_c1 3300050494 Bacteria 1048
631 nmdc:mga06z11_306378_c1 3300050494 Bacteria 945
632 nmdc:mga06z11_776782_c1 3300050494 Bacteria 584
633 nmdc:mga04h51_310213_c1 3300050495 Bacteria 645
634 nmdc:mga07m45_30801_c1 3300050496 Bacteria 1411
635 nmdc:mga07m45_519222_c1 3300050496 Bacteria 689
636 nmdc:mga05p37_368542_c1 3300050507 Bacteria 1686
637 nmdc:mga08y16_38733_c1 3300050511 Bacteria 5003
638 nmdc:mga0n895_109602_c1 3300050512 Bacteria 2776
639 nmdc:mga0rr50_194565_c1 3300050513 Bacteria 1663
640 nmdc:mga0rr50_598055_c1 3300050513 Bacteria 940
641 nmdc:mga0sz30_142091_c2 3300050516 Bacteria 539
642 nmdc:mga0sz30_208040_c1 3300050516 Bacteria 869
643 nmdc:mga0sz30_215842_c1 3300050516 Bacteria 853
644 nmdc:mga0sz30_353628_c1 3300050516 Bacteria 657
645 nmdc:mga0sz30_572800_c1 3300050516 Bacteria 510
646 Ga0500635_0015678 3300053080 Bacteria 2242
647 Ga0495595_0139564 3300053084 Bacteria 1188
648 Ga0495619_0036153 3300053085 Bacteria 3215
649 Ga0500646_0009377 3300053090 Bacteria 2507
650 Ga0500647_0077076 3300053091 Bacteria 1599
651 Ga0500583_0063551 3300053092 Bacteria 1749
652 Ga0500583_0422446 3300053092 Bacteria 637
653 Ga0500648_271036 3300053097 Bacteria 776
654 Ga0500650_0225018 3300053098 Bacteria 848
655 Ga0500654_191721 3300053099 Bacteria 632
656 Ga0500557_000044 3300053105 Bacteria 62934
657 Ga0500562_079031 3300053108 Bacteria 889
658 Ga0500594_0204299 3300053118 Bacteria 650
659 Ga0500595_034405 3300053119 Bacteria 1675
660 Ga0500595_049365 3300053119 Bacteria 1311
661 Ga0500595_114741 3300053119 Unclassified 764
662 Ga0500642_0000213 3300053130 Bacteria 23233
663 Ga0500642_0104548 3300053130 Bacteria 1319
664 Ga0500642_0192874 3300053130 Bacteria 950
665 Ga0500658_0319611 3300053134 Bacteria 713
666 Ga0500559_0004964 3300053136 Bacteria 6183
667 Ga0500559_0329785 3300053136 Bacteria 715
668 Ga0500573_0003937 3300053140 Bacteria 7762
669 Ga0500573_0488613 3300053140 Bacteria 559
670 Ga0500577_0510506 3300053142 Bacteria 525
671 Ga0500588_0046828 3300053146 Unclassified 1331
672 Ga0500588_0252036 3300053146 Bacteria 663
673 Ga0500590_044244 3300053148 Bacteria 2281
674 Ga0500590_052767 3300053148 Bacteria 2062
675 Ga0500603_056530 3300053150 Bacteria 1087
676 Ga0500604_0125688 3300053151 Bacteria 860
677 Ga0500624_071306 3300053157 Bacteria 680
678 Ga0500627_0262735 3300053158 Bacteria 761
679 Ga0500638_033753 3300053162 Bacteria 2475
680 Ga0500639_086259 3300053163 Bacteria 1572
681 Ga0500639_317623 3300053163 Bacteria 573
682 Ga0500636_0025723 3300053177 Bacteria 3478
683 Ga0500636_0183458 3300053177 Bacteria 1121
684 Ga0500636_0216880 3300053177 Bacteria 1000
685 Ga0500637_0197807 3300053178 Bacteria 1146
686 Ga0500625_004188 3300053729 Bacteria 5845
687 Ga0500645_055283 3300053730 Bacteria 1153
688 Ga0500552_001386 3300053733 Bacteria 2318
689 Ga0500596_002971 3300053735 Bacteria 3276
690 Ga0587073_0152060 3300059492 Bacteria 655
691 Ga0501082_1072990 3300060353 Bacteria 704
692 Ga0466962_0413200 3300061719 Bacteria 676
693 2513657018 2513237096 Bacteria 8722461
694 2513723857 2513237104 Bacteria 10034502
695 2513855458 2513237137 Bacteria 9558895
696 2513918758 2513237145 Bacteria 8979722
697 2517892007 2517572143 Bacteria 9484767
698 2524534080 2524023228 Bacteria 10118060
699 2671121956 2667528175 Bacteria 7532676
700 2793068920 2791355197 Bacteria 8420563
701 2885378699 2885374607 Bacteria 8927485
702 2903751006 2903748898 Bacteria 9972761
703 2904704032
704 2906639195 2906635258 Bacteria 8601019
705 2906662395 2906660503 Bacteria 8595048
706 2908742282 2908739725 Bacteria 8628932
707 2922430712
708 2935636414 2935630451 Bacteria 8169952
709 2935695510 2935694250 Bacteria 9291695
710 2941509876 2941507105 Bacteria 8166816
711 2941520880 2941515067 Bacteria 8166720
712 2941525275 2941523033 Bacteria 8169134
713 3005480617 3005474847 Bacteria 9259049
714 8006930944 8006926726 Bacteria 6749210
715 8006940157 8006933436 Bacteria 10410654
716 8006979938 8006973647 Bacteria 10679141
717 8019569178 8019565922 Bacteria 9639779
718 Ga0495584_0316723
719 JGI24749J21850_1034193
720 Ga0055528_1066225
721 Ga0055540_1005663
722 Ga0055531_10006674
723 Ga0065712_10193223
724 Ga0065715_10136123
725 Ga0065707_10247212
726 Ga0070658_10131211
727 Ga0070658_10372858
728 Ga0070658_10611724
729 Ga0070676_10123239
730 Ga0070676_10610778
731 Ga0070676_10672251
732 Ga0070683_102281464
733 Ga0070690_100060285
734 Ga0070670_100131360
735 Ga0070670_100548332
736 Ga0070670_100750657
737 Ga0070677_10052384
738 Ga0068869_100047515
739 Ga0068869_100117596
740 Ga0068869_100459612
741 Ga0070666_10599439
742 Ga0070680_100005264
743 Ga0070680_100292556
744 Ga0070682_100978639
745 Ga0070682_101240931
746 Ga0068868_100053247
747 Ga0068868_100435681
748 Ga0068868_100799991
749 Ga0068868_100860496
750 Ga0070660_100059476
751 Ga0070660_100150438
752 Ga0070660_100273298
753 Ga0070660_100835257
754 Ga0070689_100086538
755 Ga0070689_100099434
756 Ga0070689_100396596
757 Ga0070689_101556899
758 Ga0070691_10939944
759 Ga0070687_100077449
760 Ga0070687_100932202
761 Ga0070661_101150465
762 Ga0070668_100036879
763 Ga0070668_100104342
764 Ga0070668_100410713
765 Ga0070668_100467205
766 Ga0070668_101147504
767 Ga0070669_100114137
768 Ga0070669_100179864
769 Ga0070669_101324358
770 Ga0070675_100008159
771 Ga0070675_100151929
772 Ga0070675_100243532
773 Ga0070675_101215961
774 Ga0070675_101652622
775 Ga0070671_100116594
776 Ga0070671_100235621
777 Ga0070671_101018944
778 Ga0070674_100124512
779 Ga0070674_100258980
780 Ga0070674_100331205
781 Ga0070674_100496387
782 Ga0070673_100009592
783 Ga0070673_100091132
784 Ga0070673_100333017
785 Ga0070673_101542315
786 Ga0070688_101116352
787 Ga0070659_100058142
788 Ga0070659_100205165
789 Ga0070659_100437578
790 Ga0070667_100191372
791 Ga0070667_100443470
792 Ga0070667_100529848
793 Ga0070709_10006958
794 Ga0070713_100321690
795 Ga0070713_100580472
796 Ga0070710_10010512
797 Ga0070701_10034415
798 Ga0070711_100141115
799 Ga0070705_100102701
800 Ga0070700_100166482
801 Ga0070694_100408368
802 Ga0070663_100018283
803 Ga0070663_100152966
804 Ga0070678_100261461
805 Ga0070662_100042829
806 Ga0070662_100253871
807 Ga0070681_10048651
808 Ga0068867_100677681
809 Ga0068867_101675904
810 Ga0070685_10307773
811 Ga0070698_100767434
812 Ga0070699_102102499
813 Ga0070679_100122998
814 Ga0070679_100408419
815 Ga0070679_100876827
816 Ga0070684_100327787
817 Ga0068853_100099470
818 Ga0068853_100469962
819 Ga0068853_101304614
820 Ga0070672_100006242
821 Ga0070672_100331538
822 Ga0070672_101535011
823 Ga0070686_100407599
824 Ga0070693_100053394
825 Ga0070693_100434693
826 Ga0070665_100022984
827 Ga0070665_100026622
828 Ga0070665_100231994
829 Ga0070665_100500870
830 Ga0070665_100744152
831 Ga0070704_100091123
832 Ga0068855_100043940
833 Ga0068855_100064637
834 Ga0068855_100117710
835 Ga0068855_100708722
836 Ga0070664_100444399
837 Ga0070664_100968125
838 Ga0068857_100627056
839 Ga0068857_101256132
840 Ga0068854_101047311
841 Ga0068854_101593298
842 Ga0068856_100688733
843 Ga0068852_100096412
844 Ga0068852_100834461
845 Ga0068852_101106285
846 Ga0068859_100002736
847 Ga0068859_100504089
848 Ga0068859_100573231
849 Ga0068859_100635764
850 Ga0068859_101096795
851 Ga0068864_100109121
852 Ga0068864_100131373
853 Ga0068864_100889971
854 Ga0068864_101292290
855 Ga0068866_10091124
856 Ga0068861_100024747
857 Ga0068861_100071452
858 Ga0068861_100327770
859 Ga0068870_10357705
860 Ga0068870_10594271
861 Ga0068863_100053847
862 Ga0068863_100347016
863 Ga0068863_100512018
864 Ga0068858_100125607
865 Ga0068858_100220651
866 Ga0068858_100290970
867 Ga0068858_100621509
868 Ga0068860_100011029
869 Ga0068860_100199927
870 Ga0068860_100445091
871 Ga0068860_100660524
872 Ga0068862_100075460
873 Ga0068862_100134215
874 Ga0068862_100600500
875 Ga0068862_101333371
876 Ga0068862_101459988
877 Ga0081455_10051352
878 Ga0070717_11151238
879 Ga0075365_10072110
880 Ga0075365_10154402
881 Ga0075365_10231822
882 Ga0075365_10424015
883 Ga0075365_10638638
884 Ga0075368_10466375
885 Ga0075368_10524046
886 Ga0075363_100050423
887 Ga0075363_100117147
888 Ga0075363_100540457
889 Ga0075364_10135946
890 Ga0075364_10151219
891 Ga0075432_10358442
892 Ga0070716_100039535
893 Ga0070716_100606841
894 Ga0070712_100000951
895 Ga0075362_10043079
896 Ga0075362_10129870
897 Ga0075362_10380687
898 Ga0075367_10007812
899 Ga0075367_10087581
900 Ga0075367_10675461
901 Ga0075369_10085534
902 Ga0075369_10143261
903 Ga0075369_10165402
904 Ga0075369_10418314
905 Ga0075366_10036473
906 Ga0075366_10192240
907 Ga0075366_10596708
908 Ga0075366_10680641
909 Ga0097621_100091438
910 Ga0097621_100862678
911 Ga0075370_10072032
912 Ga0075370_10157396
913 Ga0075370_10298193
914 Ga0075370_10587120
915 Ga0068871_100304169
916 Ga0068871_100798810
917 Ga0068871_100910210
918 Ga0068871_101178550
919 Ga0075428_100058225
920 Ga0075428_100286200
921 Ga0075434_100087362
922 Ga0068865_100793020
923 Ga0075436_100334212
924 Ga0097620_100002736
925 Ga0097620_100504061
926 Ga0097620_100573239
927 Ga0097620_100635785
928 Ga0097620_101096857
929 Ga0075435_100603855
930 Ga0099794_10003403
931 Ga0099795_10176822
932 Ga0099795_10441260
933 Ga0105250_10030194
934 Ga0105250_10127323
935 Ga0105250_10604110
936 Ga0105240_10788542
937 Ga0105240_11673669
938 Ga0111539_10021024
939 Ga0105245_10203126
940 Ga0105245_10239297
941 Ga0105245_11031544
942 Ga0105247_10037147
943 Ga0105247_10146615
944 Ga0105247_10398369
945 Ga0114129_11123901
946 Ga0105243_10158076
947 Ga0105243_10801352
948 Ga0105243_11059938
949 Ga0105243_12696303
950 Ga0105241_10585774
951 Ga0105241_10813996
952 Ga0105241_11130210
953 Ga0105242_10097246
954 Ga0105242_10826861
955 Ga0105242_11823625
956 Ga0105248_10766171
957 Ga0105248_11084950
958 Ga0105237_10072361
959 Ga0105238_10779843
960 Ga0105238_11396690
961 Ga0105238_11481650
962 Ga0105249_10098349
963 Ga0105249_11140049
964 Ga0105249_12931517
965 Ga0099796_10034442
966 Ga0099796_10063069
967 Ga0105239_10035945
968 Ga0105239_10124717
969 Ga0105239_10855553
970 Ga0105246_10042407
971 Ga0105246_10269036
972 Ga0105246_10337992
973 Ga0105246_10946787
974 Ga0105246_10952600
975 Ga0157373_10510928
976 Ga0157371_10153425
977 Ga0157371_10752555
978 Ga0157370_10548458
979 Ga0157370_11204604
980 Ga0157369_11078890
981 Ga0157369_11273224
982 Ga0157374_10044217
983 Ga0157374_10600485
984 Ga0157378_10005363
985 Ga0157378_10522012
986 Ga0157378_10955524
987 Ga0157378_11540908
988 Ga0157378_11587179
989 Ga0163162_10255081
990 Ga0163162_10268451
991 Ga0163162_10348835
992 Ga0163162_10431037
993 Ga0163162_10739578
994 Ga0163162_11208048
995 Ga0163162_11531212
996 Ga0157372_10192555
997 Ga0157375_10324454
998 Ga0157375_10645845
999 Ga0157375_11302157
1000 Ga0157375_11843852
1001 Ga0157375_13276674
1002 Ga0163163_10443296
1003 Ga0163163_10687757
1004 Ga0163163_10974038
1005 Ga0157380_10245257
1006 Ga0157380_10784199
1007 Ga0157380_11446589
1008 Ga0157377_10011325
1009 Ga0157377_10104968
1010 Ga0157377_10209610
1011 Ga0157377_10496182
1012 Ga0157379_10053255
1013 Ga0157379_10304506
1014 Ga0157376_10155139
1015 Ga0157376_10175902
1016 Ga0157376_10296329
1017 Ga0157376_11263485
1018 Ga0182007_10175457
1019 Ga0163161_10113379
1020 Ga0163161_10456040
1021 Ga0163161_10660202
1022 Ga0163161_10680399
1023 Ga0163161_11435694
1024 Ga0209233_1006618
1025 Ga0209673_1016651
1026 Ga0209758_1030384
1027 Ga0209051_1000055
1028 Ga0209257_1000101
1029 Ga0207697_10174948
1030 Ga0207682_10102091
1031 Ga0207682_10110695
1032 Ga0207692_10028124
1033 Ga0207642_10507950
1034 Ga0207710_10019727
1035 Ga0207710_10037655
1036 Ga0207710_10686579
1037 Ga0207688_10023525
1038 Ga0207688_10433860
1039 Ga0207680_10013086
1040 Ga0207647_10149552
1041 Ga0207699_10012904
1042 Ga0207645_10324327
1043 Ga0207645_10473799
1044 Ga0207645_10620189
1045 Ga0207645_10863139
1046 Ga0207643_10285672
1047 Ga0207643_10547354
1048 Ga0207643_10552838
1049 Ga0207705_10182589
1050 Ga0207705_10646341
1051 Ga0207654_10003593
1052 Ga0207707_10282770
1053 Ga0207671_10035158
1054 Ga0207671_10053994
1055 Ga0207693_10020036
1056 Ga0207663_10221148
1057 Ga0207663_10385592
1058 Ga0207660_10142019
1059 Ga0207660_10164388
1060 Ga0207662_10320890
1061 Ga0207657_10005102
1062 Ga0207657_10058944
1063 Ga0207657_10249951
1064 Ga0207681_10267258
1065 Ga0207681_10782504
1066 Ga0207694_10737526
1067 Ga0207650_10109998
1068 Ga0207659_10000772
1069 Ga0207659_10074425
1070 Ga0207659_10684928
1071 Ga0207659_10905171
1072 Ga0207687_10021600
1073 Ga0207687_11642414
1074 Ga0207687_11859333
1075 Ga0207700_10301064
1076 Ga0207644_10851404
1077 Ga0207644_10884782
1078 Ga0207690_10413208
1079 Ga0207706_10112956
1080 Ga0207706_11203566
1081 Ga0207686_10655413
1082 Ga0207686_10806677
1083 Ga0207686_10920461
1084 Ga0207709_11335065
1085 Ga0207670_10059085
1086 Ga0207670_10072520
1087 Ga0207670_10275016
1088 Ga0207670_10388829
1089 Ga0207669_10139254
1090 Ga0207669_10155763
1091 Ga0207669_10882571
1092 Ga0207669_11358212
1093 Ga0207704_10160372
1094 Ga0207704_11139392
1095 Ga0207665_10084303
1096 Ga0207691_10074693
1097 Ga0207691_10094815
1098 Ga0207691_10409102
1099 Ga0207691_10586463
1100 Ga0207691_10819085
1101 Ga0207711_10381546
1102 Ga0207711_10486911
1103 Ga0207689_10030057
1104 Ga0207689_10155301
1105 Ga0207689_10163585
1106 Ga0207689_10366124
1107 Ga0207689_10475262
1108 Ga0207689_11518062
1109 Ga0207679_10764433
1110 Ga0207667_10120040
1111 Ga0207667_10188271
1112 Ga0207667_10570993
1113 Ga0207651_10004299
1114 Ga0207651_10055151
1115 Ga0207651_10352920
1116 Ga0207712_10404014
1117 Ga0207712_10794375
1118 Ga0207668_10059369
1119 Ga0207668_10528827
1120 Ga0207668_10637953
1121 Ga0207668_11005567
1122 Ga0207668_11735769
1123 Ga0207658_10605772
1124 Ga0207677_10393444
1125 Ga0207677_10457214
1126 Ga0207677_11454873
1127 Ga0207703_10097771
1128 Ga0207703_10215863
1129 Ga0207639_10131778
1130 Ga0207639_10245652
1131 Ga0207639_10280230
1132 Ga0207678_10037382
1133 Ga0207678_10720544
1134 Ga0207678_10989957
1135 Ga0207708_10344113
1136 Ga0207702_10051224
1137 Ga0207641_10099173
1138 Ga0207641_10321365
1139 Ga0207648_10012968
1140 Ga0207648_10751959
1141 Ga0207676_10035414
1142 Ga0207676_11257607
1143 Ga0207674_10649822
1144 Ga0207674_10775842
1145 Ga0207675_100154879
1146 Ga0207675_100159412
1147 Ga0207675_100332032
1148 Ga0207675_101702576
1149 Ga0207698_10065830
1150 Ga0209179_1064206
1151 Ga0209588_1004111
1152 Ga0209813_10241565
1153 Ga0207428_10058958
1154 Ga0268266_10002854
1155 Ga0268266_10256937
1156 Ga0268266_10362585
1157 Ga0268265_10156852
1158 Ga0268265_10250917
1159 Ga0268265_10584999
1160 Ga0268264_10037660
1161 Ga0268264_10132895
1162 Ga0268264_10402572
1163 Ga0268264_11267110
1164 Ga0268264_11606856
1165 Ga0307517_10278262
1166 Ga0307517_10351815
1167 Ga0307515_10349203
1168 Ga0307511_10084540
1169 Ga0307513_10159519
1170 Ga0307509_10388989
1171 Ga0265313_10015491
1172 Ga0307508_10096558
1173 Ga0307508_10125530
1174 Ga0265314_10384356
1175 Ga0265342_10000843
1176 Ga0307516_10170702
1177 Ga0307516_10251770
1178 Ga0307516_10456053
1179 Ga0307516_10840111
1180 Ga0307406_11487867
1181 Ga0307412_10132287
1182 Ga0307416_100264067
1183 Ga0307415_100343442
1184 Ga0307415_101493491
1185 Ga0307507_10047307
1186 Ga0307510_10387545
1187 Ga0373958_0145846
1188 Ga0373943_0090908
1189 Ga0373935_0012593
1190 Ga0373927_0054172
1191 Ga0373947_1038037
1192 Ga0373925_0007023
1193 Ga0395898_0979198
1194 Ga0395905_0501375
1195 Ga0451787_269926
1196 Ga0451793_0486698
1197 Ga0451793_1540473
1198 Ga0451797_1033710
1199 Ga0451795_0305214
1200 Ga0451795_1553351
1201 Ga0451800_0461331
1202 Ga0451839_0868187
1203 Ga0451845_0110141
1204 Ga0451851_0775507
1205 Ga0451843_0307086
1206 Ga0451853_3926746
1207 Ga0439440_0075816
1208 Ga0466966_0326624
1209 Ga0466959_0366735
1210 Ga0466959_0669003
1211 Ga0451576_1591628
1212 Ga0495617_072881
1213 Ga0495617_138363
1214 Ga0495603_0115526
1215 Ga0495638_0144090
1216 Ga0495638_0247043
1217 Ga0495638_0382550
1218 Ga0495650_0124736
1219 Ga0495605_0270520
1220 Ga0495584_0053365
1221 Ga0495584_0318945
1222 Ga0495585_0269721
1223 Ga0495585_0290746
1224 Ga0495585_0398204
1225 Ga0495594_0253316
1226 Ga0495596_0111391
1227 Ga0495607_0091607
1228 Ga0495610_0208871
1229 Ga0495616_0052563
1230 Ga0495620_0079041
1231 Ga0495628_0650607
1232 Ga0495631_0114370
1233 Ga0495631_0460195
1234 Ga0495632_0232898
1235 Ga0495632_0283879
1236 Ga0495637_0364677
1237 Ga0495643_0454274
1238 Ga0495644_0023943
1239 Ga0495648_0296546
1240 Ga0495663_0127476
1241 Ga0495642_0151178
1242 Ga0495598_0009693
1243 Ga0495609_0372753
1244 Ga0495622_0165978
1245 Ga0495622_0389862
1246 Ga0495633_0085101
1247 Ga0495633_0433190
1248 Ga0495656_0161456
1249 Ga0495656_0744054
1250 Ga0495634_0505652
1251 Ga0495611_0369866
1252 Ga0495611_0399734
1253 Ga0495625_0142904
1254 Ga0495625_0217632
1255 Ga0495659_0005385
1256 Ga0495661_0249470
1257 Ga0495623_0074149
1258 Ga0495669_0013177
1259 Ga0495669_0109008
1260 Ga0495669_0134551
1261 Ga0495669_0409666
1262 Ga0495624_0673054
1263 Ga0495671_0460553
1264 Ga0495649_0092029
1265 Ga0495649_0224948
1266 Ga0495589_0076232
1267 Ga0495589_0286297
1268 Ga0495660_0326009
1269 Ga0495604_0282650
1270 Ga0495672_0013393
1271 Ga0495673_0042175
1272 Ga0495686_0331643
1273 Ga0496100_0287862
1274 Ga0496101_0173280
1275 Ga0496101_0690193
1276 Ga0496102_0444826
1277 Ga0496102_0693779
1278 Ga0496102_1657047
1279 Ga0496104_0007991
1280 Ga0496104_0445406
1281 Ga0496105_0022621
1282 Ga0496105_0817232
1283 Ga0496106_0000823
1284 Ga0496107_0293922
1285 Ga0496107_0407043
1286 Ga0496107_0695260
1287 Ga0496107_0699196
1288 Ga0496107_1054646
1289 Ga0496108_0527753
1290 Ga0496108_1179464
1291 Ga0496108_1573070
1292 Ga0496109_0443791
1293 Ga0496110_0379526
1294 Ga0496111_0039571
1295 Ga0496111_0233151
1296 Ga0496112_0117208
1297 Ga0496112_0691761
1298 Ga0496113_0062270
1299 Ga0496113_0305793
1300 Ga0496114_0174500
1301 Ga0496114_0207640
1302 Ga0496114_0777430
1303 Ga0496115_0177266
1304 Ga0496115_0310199
1305 Ga0496118_0003610
1306 Ga0496119_0506608
1307 Ga0496121_0000041
1308 Ga0496121_0031388
1309 Ga0496121_0040880
1310 Ga0496121_0075021
1311 Ga0496121_0082307
1312 Ga0496121_0186029
1313 Ga0496121_0242134
1314 Ga0496121_0260498
1315 Ga0496124_0012074
1316 Ga0496124_0058100
1317 Ga0496125_0018399
1318 Ga0496125_0308763
1319 Ga0496125_0353316
1320 Ga0496126_0005875
1321 Ga0496126_0023926
1322 Ga0496126_0085029
1323 Ga0496126_0176571
1324 Ga0496126_0251575
1325 Ga0496126_0521746
1326 Ga0495682_0125380
1327 Ga0501036_1248346
1328 Ga0501047_0055649
1329 Ga0501072_0076673
1330 Ga0501076_1101378
1331 Ga0501079_0055765
1332 Ga0501080_0595545
1333 Ga0501081_0211468
1334 nmdc:mga03683_192922_c1
1335 nmdc:mga03683_57966_c1
1336 nmdc:mga03n38_229172_c1
1337 nmdc:mga00v17_158549_c1
1338 nmdc:mga0yw44_237847_c1
1339 nmdc:mga0yw44_47061_c1
1340 nmdc:mga0yw44_6514_c1
1341 nmdc:mga0k408_12947_c1
1342 nmdc:mga0k408_302846_c1
1343 nmdc:mga0k408_498496_c1
1344 nmdc:mga0k408_517296_c1
1345 nmdc:mga06z11_118035_c1
1346 nmdc:mga06z11_189262_c1
1347 nmdc:mga06z11_247955_c1
1348 nmdc:mga06z11_306378_c1
1349 nmdc:mga06z11_776782_c1
1350 nmdc:mga04h51_310213_c1
1351 nmdc:mga07m45_30801_c1
1352 nmdc:mga07m45_519222_c1
1353 nmdc:mga05p37_368542_c1
1354 nmdc:mga08y16_38733_c1
1355 nmdc:mga0n895_109602_c1
1356 nmdc:mga0rr50_194565_c1
1357 nmdc:mga0rr50_598055_c1
1358 nmdc:mga0sz30_142091_c2
1359 nmdc:mga0sz30_208040_c1
1360 nmdc:mga0sz30_215842_c1
1361 nmdc:mga0sz30_353628_c1
1362 nmdc:mga0sz30_572800_c1
1363 Ga0500635_0015678
1364 Ga0495595_0139564
1365 Ga0495619_0036153
1366 Ga0500646_0009377
1367 Ga0500647_0077076
1368 Ga0500583_0063551
1369 Ga0500583_0422446
1370 Ga0500648_271036
1371 Ga0500650_0225018
1372 Ga0500654_191721
1373 Ga0500557_000044
1374 Ga0500562_079031
1375 Ga0500594_0204299
1376 Ga0500595_034405
1377 Ga0500595_049365
1378 Ga0500595_114741
1379 Ga0500642_0000213
1380 Ga0500642_0104548
1381 Ga0500642_0192874
1382 Ga0500658_0319611
1383 Ga0500559_0004964
1384 Ga0500559_0329785
1385 Ga0500573_0003937
1386 Ga0500573_0488613
1387 Ga0500577_0510506
1388 Ga0500588_0046828
1389 Ga0500588_0252036
1390 Ga0500590_044244
1391 Ga0500590_052767
1392 Ga0500603_056530
1393 Ga0500604_0125688
1394 Ga0500624_071306
1395 Ga0500627_0262735
1396 Ga0500638_033753
1397 Ga0500639_086259
1398 Ga0500639_317623
1399 Ga0500636_0025723
1400 Ga0500636_0183458
1401 Ga0500636_0216880
1402 Ga0500637_0197807
1403 Ga0500625_004188
1404 Ga0500645_055283
1405 Ga0500552_001386
1406 Ga0500596_002971
1407 Ga0587073_0152060
1408 Ga0501082_1072990
1409 Ga0466962_0413200
1410 2513657018
1411 2513723857
1412 2513855458
1413 2513918758
1414 2517892007
1415 2524534080
1416 2671121956
1417 2793068920
1418 2885378699
1419 2903751006
1420 2904704032
1421 2906639195
1422 2906662395
1423 2908742282
1424 2922430712
1425 2935636414
1426 2935695510
1427 2941509876
1428 2941520880
1429 2941525275
1430 3005480617
1431 8006930944
1432 8006940157
1433 8006979938
1434 8019569178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

37

88

0.88

PF02311

AraC_binding

AraC-like ligand binding domain

35

92

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.958 4 98
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.8938 2 99
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.8935 2 99
2i45-assembly1.cif.gz_A crystal structure of protein nmb1881 from neisseria meningitidis 0.8884 2 99
7zyb-assembly1.cif.gz_A bekdgf with ca 0.8862 18 96
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9518 1 98 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9232 1 98 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9205 28 96 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8862 3 97 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.885 26 96 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3JHM8-F1-model_v4 deleted 0.9802 2 97
AF-A0A6B3GK81-F1-model_v4 Cupin domain-containing protein 0.979 2 87
AF-A0A1I5DNG9-F1-model_v4 Cupin domain-containing protein 0.9748 1 101
AF-A0A7C3VTC7-F1-model_v4 Cupin domain-containing protein 0.9746 2 93
AF-A0A7W1FG58-F1-model_v4 Cupin domain-containing protein 0.9706 1 92

Map