F477104

General Info

Members Datasets Scaffolds Average Seq Length
717 320 1434 245

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10207612|Ga0163163_102076122
Length 289
Sequence LGLAPTNREDAVPTDARVLALAIGFAGFMVQAASAQSPGTAAKQESVPMSEAAKSELAPTGVLRAGINLSNFLLVTGKSASGDPQGVSPDMAAEIAKRLGVPVKYVPYKTPGELADMAGTDAWDIGLIGAEPQRAEKIAFTAAYCEIEATYLVPAGSALKAIADVDKPGVRIAVTGRSAYGLWLDRNIKAATLVRSDTLDSAYEQFVKDKLDALAGLRPRLISDVKKLPGARILDGQFTAVQQAVGTSPKNAAGIAFLRKFVEEAKASGFVKQLIERHKVVGLSVAPPG

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
315 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
319 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
320 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.02
Nodule 0
Rhizoplane 4.74
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10207612 3300014325 Bacteria 2007
2 JGI25406J46586_10000858 3300003203 Bacteria 14329
3 Ga0070676_10145408 3300005328 Bacteria 1513
4 Ga0070683_100076900 3300005329 Bacteria 3121
5 Ga0070670_100049840 3300005331 Bacteria 3600
6 Ga0070666_10096579 3300005335 Unclassified 2034
7 Ga0070666_10382643 3300005335 Bacteria 1010
8 Ga0070680_100015728 3300005336 Bacteria 5940
9 Ga0070680_100018914 3300005336 Bacteria 5450
10 Ga0070660_100035269 3300005339 Bacteria 3786
11 Ga0070660_100057536 3300005339 Bacteria 3012
12 Ga0070689_100021465 3300005340 Bacteria 4808
13 Ga0070691_10008931 3300005341 Bacteria 4587
14 Ga0070691_10200059 3300005341 Bacteria 1049
15 Ga0070661_100002004 3300005344 Bacteria 14094
16 Ga0070661_100030028 3300005344 Bacteria 3925
17 Ga0070668_100060882 3300005347 Bacteria 2924
18 Ga0070668_100094942 3300005347 Bacteria 2355
19 Ga0070671_100086224 3300005355 Bacteria 2626
20 Ga0070671_100144601 3300005355 Bacteria 2007
21 Ga0070671_100288743 3300005355 Bacteria 1396
22 Ga0070673_100038692 3300005364 Bacteria 3644
23 Ga0070673_100243700 3300005364 Bacteria 1564
24 Ga0070673_100580153 3300005364 Bacteria 1021
25 Ga0070659_100125331 3300005366 Bacteria 2084
26 Ga0070667_100067343 3300005367 Bacteria 3044
27 Ga0070667_100428968 3300005367 Bacteria 1206
28 Ga0070703_10144566 3300005406 Bacteria 887
29 Ga0070709_10211631 3300005434 Unclassified 1378
30 Ga0070714_100076874 3300005435 Bacteria 2899
31 Ga0070714_100092897 3300005435 Bacteria 2645
32 Ga0070714_100202842 3300005435 Bacteria 1815
33 Ga0070714_100572269 3300005435 Bacteria 1083
34 Ga0070713_100111353 3300005436 Bacteria 2387
35 Ga0070710_10090443 3300005437 Bacteria 1804
36 Ga0070710_10444076 3300005437 Bacteria 878
37 Ga0070711_100024542 3300005439 Bacteria 3934
38 Ga0070711_100077683 3300005439 Bacteria 2357
39 Ga0070711_100124939 3300005439 Bacteria 1909
40 Ga0070711_100301821 3300005439 Bacteria 1274
41 Ga0070705_100126502 3300005440 Bacteria 1660
42 Ga0070700_100019718 3300005441 Bacteria 3896
43 Ga0070700_100344132 3300005441 Bacteria 1103
44 Ga0070694_100086279 3300005444 Bacteria 2193
45 Ga0070708_100097355 3300005445 Bacteria 2690
46 Ga0070708_100175035 3300005445 Bacteria 2005
47 Ga0070708_100265081 3300005445 Bacteria 1615
48 Ga0070708_100382449 3300005445 Bacteria 1327
49 Ga0070678_100091429 3300005456 Bacteria 2335
50 Ga0070678_100129144 3300005456 Bacteria 2005
51 Ga0070662_100197155 3300005457 Bacteria 1596
52 Ga0070681_10002271 3300005458 Bacteria 17559
53 Ga0070681_10002726 3300005458 Bacteria 16270
54 Ga0070681_10072999 3300005458 Bacteria 3393
55 Ga0070681_10296454 3300005458 Bacteria 1527
56 Ga0068867_100160534 3300005459 Bacteria 1772
57 Ga0070706_100184423 3300005467 Bacteria 1949
58 Ga0070707_100005527 3300005468 Bacteria 11812
59 Ga0070707_100051334 3300005468 Bacteria 3954
60 Ga0070707_100176381 3300005468 Bacteria 2083
61 Ga0070707_100374501 3300005468 Bacteria 1383
62 Ga0070707_100439318 3300005468 Bacteria 1265
63 Ga0070698_100000151 3300005471 Bacteria 62941
64 Ga0070698_100240034 3300005471 Bacteria 1745
65 Ga0070699_100037674 3300005518 Bacteria 4187
66 Ga0070699_100093048 3300005518 Bacteria 2637
67 Ga0070699_100471893 3300005518 Bacteria 1138
68 Ga0070679_100002206 3300005530 Bacteria 17585
69 Ga0070679_100084504 3300005530 Bacteria 3162
70 Ga0070679_100211549 3300005530 Bacteria 1903
71 Ga0070679_100222581 3300005530 Unclassified 1848
72 Ga0070684_100004651 3300005535 Bacteria 10477
73 Ga0070684_100198306 3300005535 Bacteria 1828
74 Ga0070697_100020046 3300005536 Bacteria 5286
75 Ga0068853_100002617 3300005539 Bacteria 13541
76 Ga0070672_100054452 3300005543 Bacteria 3132
77 Ga0070672_100092248 3300005543 Bacteria 2445
78 Ga0070672_100215012 3300005543 Bacteria 1611
79 Ga0070686_100148778 3300005544 Bacteria 1638
80 Ga0070665_100045868 3300005548 Bacteria 4390
81 Ga0070665_100534221 3300005548 Bacteria 1185
82 Ga0070665_100966612 3300005548 Bacteria 864
83 Ga0068855_100006805 3300005563 Bacteria 13870
84 Ga0068855_100064976 3300005563 Bacteria 4254
85 Ga0070664_100006100 3300005564 Bacteria 9745
86 Ga0070664_100081116 3300005564 Bacteria 2795
87 Ga0070664_100178422 3300005564 Bacteria 1887
88 Ga0070664_100221865 3300005564 Bacteria 1692
89 Ga0068857_100082893 3300005577 Bacteria 2865
90 Ga0068857_100338064 3300005577 Bacteria 1393
91 Ga0068857_100379154 3300005577 Bacteria 1313
92 Ga0068857_100786425 3300005577 Bacteria 908
93 Ga0068854_100203316 3300005578 Bacteria 1558
94 Ga0068856_100005989 3300005614 Bacteria 11971
95 Ga0068856_100092197 3300005614 Bacteria 3014
96 Ga0068856_100121296 3300005614 Bacteria 2616
97 Ga0068856_100145805 3300005614 Bacteria 2375
98 Ga0068856_100245538 3300005614 Bacteria 1805
99 Ga0070702_100136597 3300005615 Bacteria 1556
100 Ga0068852_100002176 3300005616 Bacteria 13431
101 Ga0068852_100226473 3300005616 Bacteria 1780
102 Ga0068859_100060184 3300005617 Bacteria 3827
103 Ga0068859_100114911 3300005617 Bacteria 2756
104 Ga0068861_100096125 3300005719 Bacteria 2347
105 Ga0068858_100265659 3300005842 Bacteria 1632
106 Ga0068860_100091970 3300005843 Bacteria 2890
107 Ga0068860_100123087 3300005843 Bacteria 2485
108 Ga0068862_100248007 3300005844 Bacteria 1622
109 Ga0068862_100255562 3300005844 Bacteria 1598
110 Ga0068862_100298786 3300005844 Bacteria 1481
111 Ga0081455_10000058 3300005937 Bacteria 119171
112 Ga0081455_10014280 3300005937 Bacteria 7794
113 Ga0081455_10014867 3300005937 Bacteria 7590
114 Ga0081455_10040186 3300005937 Bacteria 4127
115 Ga0081540_1000040 3300005983 Bacteria 136968
116 Ga0081540_1016800 3300005983 Bacteria 4561
117 Ga0081539_10000118 3300005985 Bacteria 184562
118 Ga0081539_10003667 3300005985 Bacteria 18436
119 Ga0081539_10106698 3300005985 Bacteria 1417
120 Ga0070717_10078984 3300006028 Bacteria 2758
121 Ga0070717_10174947 3300006028 Bacteria 1868
122 Ga0070717_10293321 3300006028 Bacteria 1444
123 Ga0070717_10359992 3300006028 Bacteria 1302
124 Ga0075365_10002405 3300006038 Bacteria 9164
125 Ga0075365_10128891 3300006038 Bacteria 1750
126 Ga0075365_10129417 3300006038 Bacteria 1746
127 Ga0075365_10389289 3300006038 Bacteria 983
128 Ga0075368_10003668 3300006042 Bacteria 5150
129 Ga0075368_10021831 3300006042 Bacteria 2433
130 Ga0075368_10087405 3300006042 Bacteria 1273
131 Ga0075363_100027715 3300006048 Bacteria 2907
132 Ga0075364_10010124 3300006051 Bacteria 5687
133 Ga0075432_10102773 3300006058 Bacteria 1058
134 Ga0070715_10026516 3300006163 Bacteria 2307
135 Ga0070712_100038899 3300006175 Bacteria 3253
136 Ga0070712_100070508 3300006175 Bacteria 2497
137 Ga0070712_100105208 3300006175 Bacteria 2095
138 Ga0070712_100139468 3300006175 Bacteria 1848
139 Ga0070712_100215231 3300006175 Bacteria 1517
140 Ga0075362_10082341 3300006177 Bacteria 1485
141 Ga0075362_10224942 3300006177 Bacteria 918
142 Ga0075367_10083007 3300006178 Bacteria 1941
143 Ga0075369_10001810 3300006186 Bacteria 7447
144 Ga0075428_100026575 3300006844 Bacteria 6408
145 Ga0075428_100112351 3300006844 Bacteria 2967
146 Ga0075428_100145913 3300006844 Bacteria 2572
147 Ga0075428_100450658 3300006844 Bacteria 1378
148 Ga0075428_100579662 3300006844 Bacteria 1199
149 Ga0075430_100059928 3300006846 Bacteria 3199
150 Ga0075430_100147098 3300006846 Bacteria 1962
151 Ga0075430_100236636 3300006846 Bacteria 1513
152 Ga0075430_100339119 3300006846 Bacteria 1242
153 Ga0075430_100544122 3300006846 Bacteria 957
154 Ga0075431_100003740 3300006847 Bacteria 14780
155 Ga0075431_100007662 3300006847 Bacteria 10752
156 Ga0075431_100035511 3300006847 Bacteria 5132
157 Ga0075431_100035737 3300006847 Bacteria 5116
158 Ga0075431_100048763 3300006847 Bacteria 4368
159 Ga0075431_100110767 3300006847 Bacteria 2833
160 Ga0075433_10002457 3300006852 Bacteria 14094
161 Ga0075433_10040255 3300006852 Bacteria 4045
162 Ga0075433_10100652 3300006852 Bacteria 2559
163 Ga0075434_100001552 3300006871 Bacteria 19464
164 Ga0075429_100238900 3300006880 Bacteria 1591
165 Ga0075429_100353646 3300006880 Bacteria 1286
166 Ga0075436_100085191 3300006914 Bacteria 2193
167 Ga0097620_100060186 3300006931 Bacteria 3827
168 Ga0097620_100114908 3300006931 Bacteria 2756
169 Ga0097620_100885767 3300006931 Bacteria 978
170 Ga0075435_100005800 3300007076 Bacteria 8676
171 Ga0075435_100026923 3300007076 Bacteria 4492
172 Ga0075435_100158186 3300007076 Bacteria 1908
173 Ga0099794_10292543 3300007265 Bacteria 843
174 Ga0099795_10151714 3300007788 Bacteria 949
175 Ga0105240_10002630 3300009093 Bacteria 28616
176 Ga0105240_10019378 3300009093 Bacteria 9090
177 Ga0105240_10176907 3300009093 Bacteria 2522
178 Ga0105240_10318233 3300009093 Unclassified 1774
179 Ga0105240_10514520 3300009093 Bacteria 1329
180 Ga0105240_11070846 3300009093 Bacteria 859
181 Ga0111539_10003980 3300009094 Bacteria 19415
182 Ga0111539_10008813 3300009094 Bacteria 12790
183 Ga0111539_10036498 3300009094 Bacteria 5942
184 Ga0111539_10175139 3300009094 Bacteria 2506
185 Ga0111539_10191067 3300009094 Bacteria 2389
186 Ga0105245_10142083 3300009098 Bacteria 2262
187 Ga0105245_10512308 3300009098 Unclassified 1217
188 Ga0105245_10730848 3300009098 Bacteria 1025
189 Ga0114129_10288183 3300009147 Bacteria 2192
190 Ga0114129_10390679 3300009147 Bacteria 1835
191 Ga0114129_11641492 3300009147 Bacteria 786
192 Ga0105243_10244828 3300009148 Bacteria 1597
193 Ga0105243_10700195 3300009148 Bacteria 987
194 Ga0105241_10046486 3300009174 Bacteria 3296
195 Ga0105241_10702071 3300009174 Bacteria 923
196 Ga0105248_10036725 3300009177 Bacteria 5479
197 Ga0105248_10273665 3300009177 Bacteria 1901
198 Ga0105248_10878700 3300009177 Bacteria 1012
199 Ga0105237_10149731 3300009545 Bacteria 2330
200 Ga0105237_10664275 3300009545 Bacteria 1049
201 Ga0105238_10001395 3300009551 Bacteria 24233
202 Ga0105238_10131003 3300009551 Bacteria 2486
203 Ga0105238_10281596 3300009551 Bacteria 1644
204 Ga0105249_10242527 3300009553 Bacteria 1782
205 Ga0105249_10562662 3300009553 Bacteria 1192
206 Ga0105249_10899084 3300009553 Bacteria 952
207 Ga0099796_10083298 3300010159 Bacteria 1176
208 Ga0099796_10178150 3300010159 Bacteria 852
209 Ga0105239_10372967 3300010375 Bacteria 1613
210 Ga0157373_10018195 3300013100 Bacteria 5117
211 Ga0157371_10020398 3300013102 Bacteria 4877
212 Ga0157371_10357717 3300013102 Bacteria 1063
213 Ga0157370_10028222 3300013104 Bacteria 5524
214 Ga0157370_10110453 3300013104 Bacteria 2570
215 Ga0157370_10722170 3300013104 Unclassified 909
216 Ga0157369_10027627 3300013105 Bacteria 6287
217 Ga0157369_10579116 3300013105 Bacteria 1159
218 Ga0157374_10285474 3300013296 Bacteria 1630
219 Ga0157378_10442262 3300013297 Bacteria 1289
220 Ga0163162_10023969 3300013306 Bacteria 6022
221 Ga0157372_10005959 3300013307 Bacteria 12957
222 Ga0157372_10106475 3300013307 Bacteria 3207
223 Ga0157375_10050936 3300013308 Bacteria 4064
224 Ga0157380_10099565 3300014326 Bacteria 2418
225 Ga0157380_10112989 3300014326 Bacteria 2286
226 Ga0157380_10473160 3300014326 Bacteria 1210
227 Ga0182008_10015135 3300014497 Bacteria 4031
228 Ga0157379_10060599 3300014968 Plasmid 3383
229 Ga0157376_10195768 3300014969 Bacteria 1856
230 Ga0157376_10564736 3300014969 Bacteria 1128
231 Ga0163161_10230834 3300017792 Bacteria 1436
232 Ga0213873_10061209 3300021358 Bacteria 1020
233 Ga0213872_10025640 3300021361 Bacteria 2710
234 Ga0213872_10062346 3300021361 Bacteria 1685
235 Ga0213872_10073160 3300021361 Bacteria 1544
236 Ga0213876_10139037 3300021384 Bacteria 1292
237 Ga0213875_10000424 3300021388 Bacteria 37012
238 Ga0213875_10009829 3300021388 Bacteria 4823
239 Ga0213875_10014253 3300021388 Bacteria 3882
240 Ga0213875_10099822 3300021388 Bacteria 1355
241 Ga0213875_10217217 3300021388 Bacteria 901
242 Ga0207682_10119475 3300025893 Bacteria 1168
243 Ga0207692_10044804 3300025898 Bacteria 2209
244 Ga0207680_10086233 3300025903 Bacteria 1985
245 Ga0207680_10328879 3300025903 Bacteria 1070
246 Ga0207685_10013744 3300025905 Bacteria 2513
247 Ga0207699_10058486 3300025906 Bacteria 2306
248 Ga0207699_10126046 3300025906 Unclassified 1663
249 Ga0207705_10029840 3300025909 Bacteria 3888
250 Ga0207705_10190201 3300025909 Bacteria 1552
251 Ga0207705_10346648 3300025909 Bacteria 1144
252 Ga0207684_10068225 3300025910 Bacteria 3022
253 Ga0207684_10082279 3300025910 Bacteria 2741
254 Ga0207707_10041726 3300025912 Bacteria 4007
255 Ga0207707_10100127 3300025912 Bacteria 2533
256 Ga0207707_10264987 3300025912 Bacteria 1490
257 Ga0207695_10197134 3300025913 Unclassified 1929
258 Ga0207695_10228426 3300025913 Bacteria 1766
259 Ga0207695_10324475 3300025913 Bacteria 1429
260 Ga0207693_10015426 3300025915 Bacteria 6128
261 Ga0207693_10021995 3300025915 Bacteria 5069
262 Ga0207693_10055956 3300025915 Bacteria 3093
263 Ga0207693_10171102 3300025915 Bacteria 1710
264 Ga0207693_10192495 3300025915 Bacteria 1605
265 Ga0207693_10202988 3300025915 Bacteria 1559
266 Ga0207693_10282938 3300025915 Bacteria 1299
267 Ga0207693_10397448 3300025915 Bacteria 1078
268 Ga0207660_10355704 3300025917 Bacteria 1174
269 Ga0207657_10029903 3300025919 Bacteria 4951
270 Ga0207657_10296615 3300025919 Bacteria 1281
271 Ga0207649_10003790 3300025920 Bacteria 8245
272 Ga0207649_10025800 3300025920 Bacteria 3431
273 Ga0207652_10006133 3300025921 Bacteria 9720
274 Ga0207652_10113529 3300025921 Bacteria 2405
275 Ga0207652_10127613 3300025921 Bacteria 2266
276 Ga0207652_10145332 3300025921 Bacteria 2122
277 Ga0207646_10008706 3300025922 Bacteria 10125
278 Ga0207646_10117167 3300025922 Bacteria 2392
279 Ga0207646_10438130 3300025922 Bacteria 1179
280 Ga0207646_10465218 3300025922 Bacteria 1140
281 Ga0207694_10071122 3300025924 Bacteria 2718
282 Ga0207694_10241427 3300025924 Bacteria 1477
283 Ga0207650_10047749 3300025925 Bacteria 3155
284 Ga0207659_10097934 3300025926 Bacteria 2204
285 Ga0207687_10088115 3300025927 Bacteria 2257
286 Ga0207687_10164414 3300025927 Bacteria 1706
287 Ga0207700_10029099 3300025928 Bacteria 3894
288 Ga0207700_10056886 3300025928 Bacteria 2946
289 Ga0207700_10214060 3300025928 Bacteria 1631
290 Ga0207700_10261306 3300025928 Bacteria 1483
291 Ga0207664_10036468 3300025929 Bacteria 3801
292 Ga0207664_10130575 3300025929 Bacteria 2114
293 Ga0207664_10311048 3300025929 Bacteria 1388
294 Ga0207664_10503124 3300025929 Bacteria 1085
295 Ga0207644_10008559 3300025931 Bacteria 6693
296 Ga0207644_10367805 3300025931 Bacteria 1171
297 Ga0207644_10395037 3300025931 Bacteria 1129
298 Ga0207690_10053769 3300025932 Bacteria 2704
299 Ga0207706_10019719 3300025933 Bacteria 6065
300 Ga0207706_10271632 3300025933 Bacteria 1479
301 Ga0207709_10066020 3300025935 Bacteria 2277
302 Ga0207670_10049145 3300025936 Bacteria 2820
303 Ga0207670_10179831 3300025936 Bacteria 1592
304 Ga0207665_10050650 3300025939 Bacteria 2793
305 Ga0207691_10005919 3300025940 Bacteria 11807
306 Ga0207691_10115744 3300025940 Bacteria 2380
307 Ga0207711_10020650 3300025941 Bacteria 5496
308 Ga0207711_10276244 3300025941 Bacteria 1546
309 Ga0207661_10019962 3300025944 Bacteria 5002
310 Ga0207661_10370031 3300025944 Bacteria 1296
311 Ga0207661_10717491 3300025944 Bacteria 920
312 Ga0207679_10028203 3300025945 Bacteria 3892
313 Ga0207679_10052364 3300025945 Bacteria 2993
314 Ga0207679_10248931 3300025945 Bacteria 1510
315 Ga0207679_10300607 3300025945 Bacteria 1383
316 Ga0207679_10545839 3300025945 Bacteria 1039
317 Ga0207667_10031492 3300025949 Bacteria 5725
318 Ga0207667_10234870 3300025949 Bacteria 1877
319 Ga0207667_10384343 3300025949 Bacteria 1430
320 Ga0207667_10777094 3300025949 Bacteria 956
321 Ga0207668_10083105 3300025972 Bacteria 2329
322 Ga0207703_10254752 3300026035 Bacteria 1584
323 Ga0207639_10003687 3300026041 Bacteria 10295
324 Ga0207678_10154512 3300026067 Bacteria 1959
325 Ga0207678_10642033 3300026067 Bacteria 932
326 Ga0207708_10008880 3300026075 Bacteria 7439
327 Ga0207708_10366322 3300026075 Bacteria 1185
328 Ga0207708_10406907 3300026075 Bacteria 1126
329 Ga0207702_10014050 3300026078 Bacteria 6648
330 Ga0207702_10049619 3300026078 Plasmid 3542
331 Ga0207702_10057572 3300026078 Bacteria 3304
332 Ga0207702_10155645 3300026078 Bacteria 2083
333 Ga0207641_10038460 3300026088 Bacteria 4000
334 Ga0207648_10165786 3300026089 Bacteria 1952
335 Ga0207648_10218927 3300026089 Bacteria 1692
336 Ga0207648_10607214 3300026089 Bacteria 1009
337 Ga0207676_10645730 3300026095 Bacteria 1021
338 Ga0207676_10791329 3300026095 Bacteria 925
339 Ga0207674_10000005 3300026116 Bacteria 237935
340 Ga0207674_10012502 3300026116 Bacteria 9484
341 Ga0207674_10084065 3300026116 Bacteria 3181
342 Ga0207674_10108400 3300026116 Bacteria 2754
343 Ga0207674_10789946 3300026116 Bacteria 916
344 Ga0207675_100033679 3300026118 Bacteria 4773
345 Ga0207675_100082428 3300026118 Bacteria 3017
346 Ga0207683_10305156 3300026121 Bacteria 1456
347 Ga0207698_10076754 3300026142 Bacteria 2676
348 Ga0207698_10336881 3300026142 Unclassified 1419
349 Ga0209813_10001131 3300027866 Bacteria 5943
350 Ga0207428_10000820 3300027907 Bacteria 35016
351 Ga0207428_10023160 3300027907 Bacteria 5226
352 Ga0207428_10109523 3300027907 Bacteria 2127
353 Ga0207428_10183983 3300027907 Bacteria 1577
354 Ga0207428_10477781 3300027907 Unclassified 907
355 Ga0268265_10191522 3300028380 Bacteria 1766
356 Ga0268265_10515605 3300028380 Bacteria 1129
357 Ga0268265_10606819 3300028380 Bacteria 1047
358 Ga0268264_10217565 3300028381 Bacteria 1757
359 Ga0265338_10110649 3300028800 Bacteria 2213
360 Ga0265762_1033348 3300030760 Bacteria 985
361 Ga0265760_10020451 3300031090 Bacteria 1911
362 Ga0265339_10000047 3300031249 Bacteria 110601
363 Ga0265316_10308211 3300031344 Bacteria 1152
364 Ga0307408_100335510 3300031548 Bacteria 1278
365 Ga0265313_10000069 3300031595 Bacteria 100065
366 Ga0265313_10121941 3300031595 Unclassified 1136
367 Ga0316576_10109279 3300031727 Bacteria 2072
368 Ga0307406_10370964 3300031901 Bacteria 1125
369 Ga0307416_100241314 3300032002 Bacteria 1751
370 Ga0373950_0010782 3300034818 Bacteria 1483
371 Ga0373926_0073934 3300035083 Bacteria 1255
372 Ga0373934_0093214 3300035086 Bacteria 1215
373 Ga0373940_0004606 3300035088 Bacteria 2925
374 Ga0373940_0010882 3300035088 Bacteria 2150
375 Ga0373940_0106758 3300035088 Bacteria 855
376 Ga0373923_0044031 3300035111 Bacteria 1849
377 Ga0373923_0071502 3300035111 Bacteria 1490
378 Ga0373936_0092067 3300035113 Bacteria 1272
379 Ga0373939_0002275 3300035114 Bacteria 4540
380 Ga0373939_0012130 3300035114 Bacteria 2191
381 Ga0373941_0013366 3300035115 Bacteria 2169
382 Ga0373953_0007043 3300035117 Bacteria 3744
383 Ga0373953_0053349 3300035117 Bacteria 1639
384 Ga0373954_0053704 3300035118 Bacteria 1894
385 Ga0373956_0183323 3300035119 Bacteria 990
386 Ga0373957_0043487 3300035120 Unclassified 1698
387 Ga0373957_0066338 3300035120 Bacteria 1405
388 Ga0373946_0077574 3300035171 Bacteria 1448
389 Ga0373946_0089460 3300035171 Bacteria 1362
390 Ga0373955_0013905 3300035172 Bacteria 3905
391 Ga0373955_0037958 3300035172 Bacteria 2564
392 Ga0373942_0016762 3300035207 Bacteria 1800
393 Ga0373942_0081450 3300035207 Bacteria 962
394 Ga0373961_0010010 3300035241 Bacteria 2331
395 Ga0373961_0019586 3300035241 Bacteria 1780
396 Ga0373962_0014124 3300035242 Bacteria 2031
397 Ga0316574_0250935 3300035398 Unclassified 1131
398 Ga0373924_0044852 3300035410 Bacteria 1818
399 Ga0373924_0113203 3300035410 Unclassified 1174
400 Ga0373931_0007066 3300035691 Bacteria 5278
401 Ga0373931_0013645 3300035691 Bacteria 3960
402 Ga0373931_0050747 3300035691 Bacteria 2208
403 Ga0373931_0183971 3300035691 Bacteria 1239
404 Ga0373931_0258801 3300035691 Bacteria 1061
405 Ga0373935_0033555 3300035692 Bacteria 3195
406 Ga0373935_0073612 3300035692 Bacteria 2207
407 Ga0373935_0082099 3300035692 Bacteria 2097
408 Ga0373935_0285236 3300035692 Bacteria 1163
409 Ga0373927_0044150 3300035695 Bacteria 2884
410 Ga0373927_0071306 3300035695 Bacteria 2249
411 Ga0373927_0163066 3300035695 Bacteria 1461
412 Ga0373927_0191689 3300035695 Bacteria 1341
413 Ga0373927_0310970 3300035695 Bacteria 1037
414 Ga0373933_0004861 3300035724 Bacteria 7334
415 Ga0373933_0011796 3300035724 Bacteria 4826
416 Ga0373933_0016852 3300035724 Bacteria 4094
417 Ga0373933_0097211 3300035724 Bacteria 1823
418 Ga0373933_0162416 3300035724 Bacteria 1419
419 Ga0373947_0016322 3300035725 Bacteria 4268
420 Ga0373947_0197397 3300035725 Bacteria 1315
421 Ga0373947_0284726 3300035725 Unclassified 1099
422 Ga0373947_0378709 3300035725 Bacteria 952
423 Ga0373937_0000761 3300036401 Bacteria 27843
424 Ga0373937_0136329 3300036401 Bacteria 2295
425 Ga0373937_0374780 3300036401 Bacteria 1349
426 Ga0316584_0147376 3300036712 Bacteria 1753
427 Ga0373925_0037185 3300037068 Bacteria 3593
428 Ga0373925_0050679 3300037068 Bacteria 3097
429 Ga0373925_0109152 3300037068 Bacteria 2136
430 Ga0373925_0533388 3300037068 Bacteria 965
431 Ga0373925_0685459 3300037068 Bacteria 845
432 Ga0395899_0024032 3300037312 Bacteria 4609
433 Ga0395899_0069251 3300037312 Bacteria 2584
434 Ga0395899_0088176 3300037312 Bacteria 2251
435 Ga0395900_0021639 3300037418 Bacteria 6574
436 Ga0395900_0077801 3300037418 Bacteria 3408
437 Ga0395900_0168974 3300037418 Bacteria 2227
438 Ga0395898_0022898 3300037466 Bacteria 6317
439 Ga0395905_0603119 3300037471 Bacteria 1000
440 Ga0436364_0108726 3300037853 Bacteria 1264
441 Ga0436364_0141915 3300037853 Bacteria 16587
442 Ga0436364_0286343 3300037853 Bacteria 1598
443 Ga0436364_0663275 3300037853 Bacteria 97909
444 Ga0436364_0668296 3300037853 Bacteria 132076
445 Ga0436364_1070480 3300037853 Bacteria 1140
446 Ga0436364_1100698 3300037853 Bacteria 2819
447 Ga0436364_1147233 3300037853 Bacteria 1375
448 Ga0436364_1324861 3300037853 Bacteria 2239
449 Ga0436364_1427712 3300037853 Bacteria 1088
450 Ga0436364_1502786 3300037853 Bacteria 3112
451 Ga0395901_0004105 3300038443 Bacteria 14682
452 Ga0395901_0027696 3300038443 Bacteria 5826
453 Ga0436365_0585284 3300039437 Bacteria 1374
454 Ga0436365_0750241 3300039437 Bacteria 3919
455 Ga0436365_0758860 3300039437 Bacteria 2253
456 Ga0436365_0941153 3300039437 Bacteria 2382
457 Ga0436365_1479190 3300039437 Bacteria 1623
458 Ga0436360_0427988 3300039438 Bacteria 1983
459 Ga0436360_0923341 3300039438 Bacteria 4418
460 Ga0436360_0981069 3300039438 Bacteria 3532
461 Ga0436360_1116770 3300039438 Bacteria 1047
462 Ga0436360_1179304 3300039438 Bacteria 1252
463 Ga0436360_1203512 3300039438 Bacteria 1343
464 Ga0436360_1369054 3300039438 Bacteria 4584
465 Ga0436361_0537570 3300039447 Bacteria 1563
466 Ga0436361_0661457 3300039447 Bacteria 3507
467 Ga0436361_0819334 3300039447 Bacteria 1666
468 Ga0436361_0895546 3300039447 Bacteria 3935
469 Ga0436363_0337004 3300039450 Bacteria 755
470 Ga0436363_0630022 3300039450 Bacteria 1215
471 Ga0436363_1370045 3300039450 Bacteria 1051
472 Ga0436362_0018763 3300039453 Bacteria 2619
473 Ga0436362_0151417 3300039453 Bacteria 1687
474 Ga0436362_0821186 3300039453 Bacteria 1967
475 Ga0436362_0905187 3300039453 Bacteria 956
476 Ga0451807_1379513 3300041486 Unclassified 1370
477 Ga0451577_0058318 3300042876 Bacteria 3442
478 Ga0466963_0034271 3300044694 Bacteria 3303
479 Ga0466963_0063652 3300044694 Bacteria 2469
480 Ga0466963_0139486 3300044694 Bacteria 1679
481 Ga0453684_0221968 3300044712 Bacteria 2189
482 Ga0466957_0029268 3300044842 Bacteria 3283
483 Ga0466960_0159009 3300044901 Bacteria 1212
484 Ga0451576_0000231 3300045051 Bacteria 136040
485 Ga0466958_0278385 3300045836 Unclassified 1072
486 Ga0466967_0017620 3300045976 Bacteria 5679
487 Ga0466967_0047199 3300045976 Bacteria 3754
488 Ga0466967_0434529 3300045976 Bacteria 1281
489 Ga0466967_0541993 3300045976 Bacteria 1145
490 Ga0466967_0820418 3300045976 Bacteria 924
491 Ga0495592_0207647 3300046454 Unclassified 1317
492 Ga0495592_0296424 3300046454 Bacteria 1052
493 Ga0495592_0457795 3300046454 Bacteria 798
494 Ga0495603_0060560 3300046455 Bacteria 2237
495 Ga0495629_0009132 3300046459 Bacteria 7262
496 Ga0495629_0050778 3300046459 Bacteria 2904
497 Ga0495629_0324725 3300046459 Bacteria 1052
498 Ga0495651_0001110 3300046462 Bacteria 20796
499 Ga0495651_0035681 3300046462 Bacteria 3871
500 Ga0495651_0210964 3300046462 Bacteria 1351
501 Ga0495653_0015948 3300046463 Bacteria 6125
502 Ga0495580_0033025 3300046472 Bacteria 3730
503 Ga0495580_0331218 3300046472 Bacteria 1034
504 Ga0495582_0201455 3300046473 Bacteria 1137
505 Ga0495664_0003048 3300046477 Bacteria 9072
506 Ga0495664_0203852 3300046477 Unclassified 1198
507 Ga0495664_0451982 3300046477 Bacteria 769
508 Ga0495594_0091952 3300046499 Bacteria 1701
509 Ga0495608_0002474 3300046511 Bacteria 13250
510 Ga0495608_0003631 3300046511 Bacteria 11079
511 Ga0495608_0010040 3300046511 Bacteria 6604
512 Ga0495608_0346536 3300046511 Unclassified 915
513 Ga0495618_0004450 3300046514 Bacteria 8617
514 Ga0495618_0243946 3300046514 Bacteria 1129
515 Ga0495628_0026011 3300046516 Bacteria 4778
516 Ga0495628_0162703 3300046516 Bacteria 1695
517 Ga0495630_0188579 3300046517 Bacteria 1573
518 Ga0495642_0092971 3300046528 Bacteria 1278
519 Ga0495652_0008869 3300046529 Bacteria 9150
520 Ga0495640_0013010 3300046533 Bacteria 6339
521 Ga0495640_0013014 3300046533 Bacteria 6337
522 Ga0495640_0089210 3300046533 Bacteria 2037
523 Ga0495640_0095657 3300046533 Bacteria 1955
524 Ga0495640_0302616 3300046533 Bacteria 993
525 Ga0495587_0003059 3300046536 Bacteria 11171
526 Ga0495587_0003972 3300046536 Bacteria 9806
527 Ga0495587_0126345 3300046536 Bacteria 1463
528 Ga0495645_0026353 3300046543 Bacteria 4219
529 Ga0495645_0130339 3300046543 Bacteria 1763
530 Ga0495645_0197727 3300046543 Bacteria 1366
531 Ga0495645_0327354 3300046543 Bacteria 993
532 Ga0495667_0002458 3300046559 Bacteria 12367
533 Ga0495667_0095069 3300046559 Bacteria 1930
534 Ga0495667_0217275 3300046559 Bacteria 1221
535 Ga0495634_0021446 3300046642 Bacteria 4566
536 Ga0495634_0315460 3300046642 Bacteria 942
537 Ga0495635_0134069 3300046663 Bacteria 1688
538 Ga0495635_0263073 3300046663 Bacteria 1161
539 Ga0495599_0006436 3300046678 Bacteria 7084
540 Ga0495599_0194900 3300046678 Bacteria 1245
541 Ga0495623_0054108 3300046679 Bacteria 2533
542 Ga0495623_0056199 3300046679 Unclassified 2478
543 Ga0495646_0024219 3300046680 Bacteria 3823
544 Ga0495646_0092056 3300046680 Unclassified 1749
545 Ga0495658_0044840 3300046683 Bacteria 2479
546 Ga0495658_0364690 3300046683 Bacteria 919
547 Ga0495669_0003664 3300046684 Bacteria 6327
548 Ga0495613_0160950 3300046689 Bacteria 1597
549 Ga0495613_0243124 3300046689 Bacteria 1258
550 Ga0495613_0326434 3300046689 Bacteria 1058
551 Ga0495670_0149208 3300046691 Bacteria 1226
552 Ga0495600_0001916 3300046809 Bacteria 11682
553 Ga0495600_0033817 3300046809 Unclassified 3319
554 Ga0495600_0213057 3300046809 Bacteria 1237
555 Ga0495581_0114871 3300047315 Bacteria 1566
556 Ga0495581_0430511 3300047315 Bacteria 769
557 Ga0495604_0016624 3300047317 Bacteria 5884
558 Ga0495604_0237929 3300047317 Bacteria 1246
559 Ga0495604_0309282 3300047317 Unclassified 1059
560 Ga0495636_0223409 3300047318 Bacteria 865
561 Ga0495674_0002245 3300047319 Bacteria 18988
562 Ga0495676_0373977 3300047321 Bacteria 949
563 Ga0495680_0001116 3300047322 Bacteria 29627
564 Ga0495680_0109017 3300047322 Bacteria 2054
565 Ga0495675_0008949 3300047444 Bacteria 6225
566 Ga0495675_0009772 3300047444 Bacteria 5983
567 Ga0495684_0080283 3300047471 Bacteria 2476
568 Ga0495684_0215571 3300047471 Bacteria 1410
569 Ga0495602_0000398 3300048088 Bacteria 40599
570 Ga0495602_0003277 3300048088 Bacteria 16722
571 Ga0495602_0083357 3300048088 Bacteria 2679
572 Ga0496100_0189029 3300048903 Bacteria 1494
573 Ga0496100_0317406 3300048903 Bacteria 1170
574 Ga0496101_0226698 3300048904 Bacteria 1452
575 Ga0496102_0130395 3300048905 Bacteria 2352
576 Ga0496102_0252018 3300048905 Bacteria 1665
577 Ga0496104_0000182 3300048907 Bacteria 56117
578 Ga0496104_0157687 3300048907 Bacteria 2178
579 Ga0496104_0161275 3300048907 Bacteria 2151
580 Ga0496104_0256037 3300048907 Bacteria 1663
581 Ga0496104_0951254 3300048907 Bacteria 763
582 Ga0496105_0018209 3300048908 Bacteria 5640
583 Ga0496106_0042250 3300048909 Bacteria 3419
584 Ga0496107_0084564 3300048910 Bacteria 2315
585 Ga0496108_0014116 3300048911 Bacteria 6516
586 Ga0496108_0144705 3300048911 Bacteria 2049
587 Ga0496108_0338840 3300048911 Unclassified 1312
588 Ga0496109_0004093 3300048912 Bacteria 12190
589 Ga0496109_0084299 3300048912 Bacteria 2932
590 Ga0496109_0311928 3300048912 Bacteria 1484
591 Ga0496110_0009439 3300048913 Bacteria 7902
592 Ga0496110_0062738 3300048913 Bacteria 3283
593 Ga0496111_0006863 3300048914 Bacteria 7430
594 Ga0496111_0069536 3300048914 Bacteria 2560
595 Ga0496111_0089794 3300048914 Bacteria 2251
596 Ga0496112_0022376 3300048915 Bacteria 6025
597 Ga0496112_0045592 3300048915 Bacteria 4298
598 Ga0496112_0072626 3300048915 Bacteria 3401
599 Ga0496112_0142143 3300048915 Unclassified 2369
600 Ga0496112_0231401 3300048915 Bacteria 1803
601 Ga0496113_0008368 3300048916 Bacteria 6739
602 Ga0496113_0770174 3300048916 Bacteria 766
603 Ga0496115_0219333 3300048918 Bacteria 1570
604 Ga0496115_0368809 3300048918 Unclassified 1169
605 Ga0496119_0021644 3300048922 Bacteria 4636
606 Ga0496120_0010331 3300048923 Bacteria 6525
607 Ga0496126_0019977 3300048929 Bacteria 6582
608 Ga0501034_0015519 3300049571 Bacteria 7826
609 Ga0501036_0585873 3300049572 Bacteria 926
610 Ga0501037_0543421 3300049573 Bacteria 785
611 Ga0501039_0507502 3300049575 Bacteria 947
612 Ga0501040_0014149 3300049576 Bacteria 5252
613 Ga0501046_0331248 3300049580 Bacteria 1108
614 Ga0501047_0049032 3300049581 Bacteria 4078
615 Ga0501048_0254716 3300049582 Bacteria 1247
616 Ga0501070_0001514 3300049586 Bacteria 20720
617 Ga0501072_0015465 3300049588 Bacteria 5850
618 Ga0501072_0043292 3300049588 Bacteria 3538
619 Ga0501072_0055740 3300049588 Bacteria 3115
620 Ga0501072_0368856 3300049588 Bacteria 1140
621 Ga0501073_0109984 3300049589 Bacteria 1912
622 Ga0501074_0024883 3300049590 Bacteria 4349
623 Ga0501075_0096213 3300049591 Bacteria 2247
624 Ga0501075_0135227 3300049591 Bacteria 1878
625 Ga0501075_0330944 3300049591 Bacteria 1161
626 Ga0501076_0009242 3300049592 Bacteria 7272
627 Ga0501076_0502018 3300049592 Bacteria 1000
628 Ga0501077_0046065 3300049593 Bacteria 2771
629 Ga0501077_0262511 3300049593 Bacteria 1098
630 Ga0501079_0006102 3300049741 Bacteria 9033
631 Ga0501079_0017971 3300049741 Bacteria 5399
632 Ga0501079_0139779 3300049741 Bacteria 1886
633 Ga0501079_0679599 3300049741 Bacteria 810
634 Ga0501080_0109882 3300049742 Bacteria 2555
635 Ga0501080_0318290 3300049742 Unclassified 1409
636 Ga0501080_0346834 3300049742 Unclassified 1341
637 Ga0501081_0016815 3300049743 Bacteria 4836
638 Ga0501081_0182537 3300049743 Bacteria 1518
639 Ga0501035_0313992 3300049822 Bacteria 1318
640 Ga0501044_0141440 3300049823 Bacteria 2395
641 Ga0501044_0444430 3300049823 Bacteria 1204
642 Ga0501045_0249183 3300049824 Bacteria 1322
643 nmdc:mga03683_103395_c1 3300050489 Bacteria 1254
644 nmdc:mga03683_32200_c1 3300050489 Bacteria 2108
645 nmdc:mga03683_58390_c1 3300050489 Bacteria 1626
646 nmdc:mga03n38_40237_c1 3300050490 Bacteria 2031
647 nmdc:mga00v17_49624_c1 3300050491 Bacteria 2547
648 nmdc:mga0yw44_157233_c1 3300050492 Bacteria 1486
649 nmdc:mga0yw44_2874_c1 3300050492 Bacteria 7483
650 nmdc:mga0yw44_85847_c1 3300050492 Bacteria 1981
651 nmdc:mga0yw44_9815_c1 3300050492 Bacteria 4861
652 nmdc:mga0k408_213338_c1 3300050493 Bacteria 1153
653 nmdc:mga06z11_103120_c1 3300050494 Bacteria 1568
654 nmdc:mga06z11_45433_c1 3300050494 Bacteria 2220
655 nmdc:mga06z11_65071_c1 3300050494 Bacteria 1913
656 nmdc:mga06z11_90393_c1 3300050494 Bacteria 1661
657 nmdc:mga04h51_5824_c1 3300050495 Bacteria 3159
658 nmdc:mga09592_373772_c1 3300050508 Bacteria 1233
659 nmdc:mga0qj67_21559_c1 3300050509 Bacteria 4943
660 nmdc:mga0qj67_229684_c1 3300050509 Bacteria 1506
661 nmdc:mga0qj67_34476_c1 3300050509 Bacteria 3954
662 nmdc:mga0qj67_382766_c1 3300050509 Bacteria 1136
663 nmdc:mga0qj67_39099_c1 3300050509 Bacteria 3724
664 nmdc:mga0qj67_95065_c1 3300050509 Bacteria 2398
665 nmdc:mga06r32_32644_c1 3300050510 Bacteria 4900
666 nmdc:mga06r32_33534_c1 3300050510 Bacteria 4836
667 nmdc:mga06r32_3463_c1 3300050510 Bacteria 14091
668 nmdc:mga06r32_46521_c1 3300050510 Bacteria 4140
669 nmdc:mga06r32_47421_c1 3300050510 Bacteria 4104
670 nmdc:mga06r32_607844_c1 3300050510 Bacteria 1064
671 nmdc:mga06r32_93534_c1 3300050510 Bacteria 2940
672 nmdc:mga08y16_13096_c1 3300050511 Bacteria 8725
673 nmdc:mga08y16_334135_c1 3300050511 Bacteria 1558
674 nmdc:mga08y16_70455_c1 3300050511 Bacteria 3645
675 nmdc:mga08y16_864617_c1 3300050511 Unclassified 893
676 nmdc:mga08y16_87880_c1 3300050511 Bacteria 3239
677 nmdc:mga0n895_207504_c1 3300050512 Bacteria 1990
678 nmdc:mga0n895_896_c1 3300050512 Bacteria 21473
679 nmdc:mga0rr50_455280_c1 3300050513 Bacteria 1085
680 nmdc:mga0rr50_5196_c1 3300050513 Bacteria 7739
681 nmdc:mga0rr50_8180_c1 3300050513 Bacteria 6494
682 nmdc:mga08x19_15172_c1 3300050514 Bacteria 4684
683 nmdc:mga0a205_206901_c1 3300050515 Bacteria 1851
684 nmdc:mga0a205_2921_c1 3300050515 Bacteria 15133
685 nmdc:mga0sz30_1852_c2 3300050516 Bacteria 1449
686 nmdc:mga0sz30_498_c1 3300050516 Bacteria 14575
687 Ga0495601_0000712 3300053077 Bacteria 17859
688 Ga0495601_0002860 3300053077 Bacteria 9810
689 Ga0495601_0297200 3300053077 Bacteria 1052
690 Ga0495612_0001184 3300053078 Bacteria 10747
691 Ga0495612_0118627 3300053078 Bacteria 1137
692 Ga0495612_0199031 3300053078 Unclassified 883
693 Ga0495595_0000196 3300053084 Bacteria 24609
694 Ga0495595_0006523 3300053084 Bacteria 4759
695 Ga0495595_0016485 3300053084 Bacteria 3162
696 Ga0495595_0021033 3300053084 Bacteria 2847
697 Ga0495595_0146977 3300053084 Bacteria 1158
698 Ga0495595_0296113 3300053084 Unclassified 813
699 Ga0495619_0004840 3300053085 Bacteria 8547
700 Ga0495619_0009682 3300053085 Bacteria 6076
701 Ga0495619_0116253 3300053085 Bacteria 1831
702 Ga0500651_0223322 3300053093 Bacteria 1104
703 Ga0500577_0129207 3300053142 Bacteria 1058
704 Ga0500616_0002029 3300053153 Bacteria 17855
705 Ga0500620_010418 3300053155 Bacteria 2446
706 Ga0500552_000491 3300053733 Bacteria 3661
707 Ga0501084_0071843 3300054114 Bacteria 2898
708 Ga0501084_0104908 3300054114 Bacteria 2374
709 Ga0501082_0042769 3300060353 Bacteria 3905
710 Ga0501082_0053454 3300060353 Bacteria 3482
711 Ga0501082_0409096 3300060353 Bacteria 1184
712 Ga0501082_0456676 3300060353 Bacteria 1116
713 Ga0530510_0024319 3300061734 Bacteria 4321
714 Ga0530510_0035765 3300061734 Bacteria 3580
715 Ga0530510_0297382 3300061734 Bacteria 1208
716 2929200466 2929199973 Bacteria 7260745
717 8055914638 8055909800 Bacteria 7278581
718 Ga0163163_10207612
719 JGI25406J46586_10000858
720 Ga0070676_10145408
721 Ga0070683_100076900
722 Ga0070670_100049840
723 Ga0070666_10096579
724 Ga0070666_10382643
725 Ga0070680_100015728
726 Ga0070680_100018914
727 Ga0070660_100035269
728 Ga0070660_100057536
729 Ga0070689_100021465
730 Ga0070691_10008931
731 Ga0070691_10200059
732 Ga0070661_100002004
733 Ga0070661_100030028
734 Ga0070668_100060882
735 Ga0070668_100094942
736 Ga0070671_100086224
737 Ga0070671_100144601
738 Ga0070671_100288743
739 Ga0070673_100038692
740 Ga0070673_100243700
741 Ga0070673_100580153
742 Ga0070659_100125331
743 Ga0070667_100067343
744 Ga0070667_100428968
745 Ga0070703_10144566
746 Ga0070709_10211631
747 Ga0070714_100076874
748 Ga0070714_100092897
749 Ga0070714_100202842
750 Ga0070714_100572269
751 Ga0070713_100111353
752 Ga0070710_10090443
753 Ga0070710_10444076
754 Ga0070711_100024542
755 Ga0070711_100077683
756 Ga0070711_100124939
757 Ga0070711_100301821
758 Ga0070705_100126502
759 Ga0070700_100019718
760 Ga0070700_100344132
761 Ga0070694_100086279
762 Ga0070708_100097355
763 Ga0070708_100175035
764 Ga0070708_100265081
765 Ga0070708_100382449
766 Ga0070678_100091429
767 Ga0070678_100129144
768 Ga0070662_100197155
769 Ga0070681_10002271
770 Ga0070681_10002726
771 Ga0070681_10072999
772 Ga0070681_10296454
773 Ga0068867_100160534
774 Ga0070706_100184423
775 Ga0070707_100005527
776 Ga0070707_100051334
777 Ga0070707_100176381
778 Ga0070707_100374501
779 Ga0070707_100439318
780 Ga0070698_100000151
781 Ga0070698_100240034
782 Ga0070699_100037674
783 Ga0070699_100093048
784 Ga0070699_100471893
785 Ga0070679_100002206
786 Ga0070679_100084504
787 Ga0070679_100211549
788 Ga0070679_100222581
789 Ga0070684_100004651
790 Ga0070684_100198306
791 Ga0070697_100020046
792 Ga0068853_100002617
793 Ga0070672_100054452
794 Ga0070672_100092248
795 Ga0070672_100215012
796 Ga0070686_100148778
797 Ga0070665_100045868
798 Ga0070665_100534221
799 Ga0070665_100966612
800 Ga0068855_100006805
801 Ga0068855_100064976
802 Ga0070664_100006100
803 Ga0070664_100081116
804 Ga0070664_100178422
805 Ga0070664_100221865
806 Ga0068857_100082893
807 Ga0068857_100338064
808 Ga0068857_100379154
809 Ga0068857_100786425
810 Ga0068854_100203316
811 Ga0068856_100005989
812 Ga0068856_100092197
813 Ga0068856_100121296
814 Ga0068856_100145805
815 Ga0068856_100245538
816 Ga0070702_100136597
817 Ga0068852_100002176
818 Ga0068852_100226473
819 Ga0068859_100060184
820 Ga0068859_100114911
821 Ga0068861_100096125
822 Ga0068858_100265659
823 Ga0068860_100091970
824 Ga0068860_100123087
825 Ga0068862_100248007
826 Ga0068862_100255562
827 Ga0068862_100298786
828 Ga0081455_10000058
829 Ga0081455_10014280
830 Ga0081455_10014867
831 Ga0081455_10040186
832 Ga0081540_1000040
833 Ga0081540_1016800
834 Ga0081539_10000118
835 Ga0081539_10003667
836 Ga0081539_10106698
837 Ga0070717_10078984
838 Ga0070717_10174947
839 Ga0070717_10293321
840 Ga0070717_10359992
841 Ga0075365_10002405
842 Ga0075365_10128891
843 Ga0075365_10129417
844 Ga0075365_10389289
845 Ga0075368_10003668
846 Ga0075368_10021831
847 Ga0075368_10087405
848 Ga0075363_100027715
849 Ga0075364_10010124
850 Ga0075432_10102773
851 Ga0070715_10026516
852 Ga0070712_100038899
853 Ga0070712_100070508
854 Ga0070712_100105208
855 Ga0070712_100139468
856 Ga0070712_100215231
857 Ga0075362_10082341
858 Ga0075362_10224942
859 Ga0075367_10083007
860 Ga0075369_10001810
861 Ga0075428_100026575
862 Ga0075428_100112351
863 Ga0075428_100145913
864 Ga0075428_100450658
865 Ga0075428_100579662
866 Ga0075430_100059928
867 Ga0075430_100147098
868 Ga0075430_100236636
869 Ga0075430_100339119
870 Ga0075430_100544122
871 Ga0075431_100003740
872 Ga0075431_100007662
873 Ga0075431_100035511
874 Ga0075431_100035737
875 Ga0075431_100048763
876 Ga0075431_100110767
877 Ga0075433_10002457
878 Ga0075433_10040255
879 Ga0075433_10100652
880 Ga0075434_100001552
881 Ga0075429_100238900
882 Ga0075429_100353646
883 Ga0075436_100085191
884 Ga0097620_100060186
885 Ga0097620_100114908
886 Ga0097620_100885767
887 Ga0075435_100005800
888 Ga0075435_100026923
889 Ga0075435_100158186
890 Ga0099794_10292543
891 Ga0099795_10151714
892 Ga0105240_10002630
893 Ga0105240_10019378
894 Ga0105240_10176907
895 Ga0105240_10318233
896 Ga0105240_10514520
897 Ga0105240_11070846
898 Ga0111539_10003980
899 Ga0111539_10008813
900 Ga0111539_10036498
901 Ga0111539_10175139
902 Ga0111539_10191067
903 Ga0105245_10142083
904 Ga0105245_10512308
905 Ga0105245_10730848
906 Ga0114129_10288183
907 Ga0114129_10390679
908 Ga0114129_11641492
909 Ga0105243_10244828
910 Ga0105243_10700195
911 Ga0105241_10046486
912 Ga0105241_10702071
913 Ga0105248_10036725
914 Ga0105248_10273665
915 Ga0105248_10878700
916 Ga0105237_10149731
917 Ga0105237_10664275
918 Ga0105238_10001395
919 Ga0105238_10131003
920 Ga0105238_10281596
921 Ga0105249_10242527
922 Ga0105249_10562662
923 Ga0105249_10899084
924 Ga0099796_10083298
925 Ga0099796_10178150
926 Ga0105239_10372967
927 Ga0157373_10018195
928 Ga0157371_10020398
929 Ga0157371_10357717
930 Ga0157370_10028222
931 Ga0157370_10110453
932 Ga0157370_10722170
933 Ga0157369_10027627
934 Ga0157369_10579116
935 Ga0157374_10285474
936 Ga0157378_10442262
937 Ga0163162_10023969
938 Ga0157372_10005959
939 Ga0157372_10106475
940 Ga0157375_10050936
941 Ga0157380_10099565
942 Ga0157380_10112989
943 Ga0157380_10473160
944 Ga0182008_10015135
945 Ga0157379_10060599
946 Ga0157376_10195768
947 Ga0157376_10564736
948 Ga0163161_10230834
949 Ga0213873_10061209
950 Ga0213872_10025640
951 Ga0213872_10062346
952 Ga0213872_10073160
953 Ga0213876_10139037
954 Ga0213875_10000424
955 Ga0213875_10009829
956 Ga0213875_10014253
957 Ga0213875_10099822
958 Ga0213875_10217217
959 Ga0207682_10119475
960 Ga0207692_10044804
961 Ga0207680_10086233
962 Ga0207680_10328879
963 Ga0207685_10013744
964 Ga0207699_10058486
965 Ga0207699_10126046
966 Ga0207705_10029840
967 Ga0207705_10190201
968 Ga0207705_10346648
969 Ga0207684_10068225
970 Ga0207684_10082279
971 Ga0207707_10041726
972 Ga0207707_10100127
973 Ga0207707_10264987
974 Ga0207695_10197134
975 Ga0207695_10228426
976 Ga0207695_10324475
977 Ga0207693_10015426
978 Ga0207693_10021995
979 Ga0207693_10055956
980 Ga0207693_10171102
981 Ga0207693_10192495
982 Ga0207693_10202988
983 Ga0207693_10282938
984 Ga0207693_10397448
985 Ga0207660_10355704
986 Ga0207657_10029903
987 Ga0207657_10296615
988 Ga0207649_10003790
989 Ga0207649_10025800
990 Ga0207652_10006133
991 Ga0207652_10113529
992 Ga0207652_10127613
993 Ga0207652_10145332
994 Ga0207646_10008706
995 Ga0207646_10117167
996 Ga0207646_10438130
997 Ga0207646_10465218
998 Ga0207694_10071122
999 Ga0207694_10241427
1000 Ga0207650_10047749
1001 Ga0207659_10097934
1002 Ga0207687_10088115
1003 Ga0207687_10164414
1004 Ga0207700_10029099
1005 Ga0207700_10056886
1006 Ga0207700_10214060
1007 Ga0207700_10261306
1008 Ga0207664_10036468
1009 Ga0207664_10130575
1010 Ga0207664_10311048
1011 Ga0207664_10503124
1012 Ga0207644_10008559
1013 Ga0207644_10367805
1014 Ga0207644_10395037
1015 Ga0207690_10053769
1016 Ga0207706_10019719
1017 Ga0207706_10271632
1018 Ga0207709_10066020
1019 Ga0207670_10049145
1020 Ga0207670_10179831
1021 Ga0207665_10050650
1022 Ga0207691_10005919
1023 Ga0207691_10115744
1024 Ga0207711_10020650
1025 Ga0207711_10276244
1026 Ga0207661_10019962
1027 Ga0207661_10370031
1028 Ga0207661_10717491
1029 Ga0207679_10028203
1030 Ga0207679_10052364
1031 Ga0207679_10248931
1032 Ga0207679_10300607
1033 Ga0207679_10545839
1034 Ga0207667_10031492
1035 Ga0207667_10234870
1036 Ga0207667_10384343
1037 Ga0207667_10777094
1038 Ga0207668_10083105
1039 Ga0207703_10254752
1040 Ga0207639_10003687
1041 Ga0207678_10154512
1042 Ga0207678_10642033
1043 Ga0207708_10008880
1044 Ga0207708_10366322
1045 Ga0207708_10406907
1046 Ga0207702_10014050
1047 Ga0207702_10049619
1048 Ga0207702_10057572
1049 Ga0207702_10155645
1050 Ga0207641_10038460
1051 Ga0207648_10165786
1052 Ga0207648_10218927
1053 Ga0207648_10607214
1054 Ga0207676_10645730
1055 Ga0207676_10791329
1056 Ga0207674_10000005
1057 Ga0207674_10012502
1058 Ga0207674_10084065
1059 Ga0207674_10108400
1060 Ga0207674_10789946
1061 Ga0207675_100033679
1062 Ga0207675_100082428
1063 Ga0207683_10305156
1064 Ga0207698_10076754
1065 Ga0207698_10336881
1066 Ga0209813_10001131
1067 Ga0207428_10000820
1068 Ga0207428_10023160
1069 Ga0207428_10109523
1070 Ga0207428_10183983
1071 Ga0207428_10477781
1072 Ga0268265_10191522
1073 Ga0268265_10515605
1074 Ga0268265_10606819
1075 Ga0268264_10217565
1076 Ga0265338_10110649
1077 Ga0265762_1033348
1078 Ga0265760_10020451
1079 Ga0265339_10000047
1080 Ga0265316_10308211
1081 Ga0307408_100335510
1082 Ga0265313_10000069
1083 Ga0265313_10121941
1084 Ga0316576_10109279
1085 Ga0307406_10370964
1086 Ga0307416_100241314
1087 Ga0373950_0010782
1088 Ga0373926_0073934
1089 Ga0373934_0093214
1090 Ga0373940_0004606
1091 Ga0373940_0010882
1092 Ga0373940_0106758
1093 Ga0373923_0044031
1094 Ga0373923_0071502
1095 Ga0373936_0092067
1096 Ga0373939_0002275
1097 Ga0373939_0012130
1098 Ga0373941_0013366
1099 Ga0373953_0007043
1100 Ga0373953_0053349
1101 Ga0373954_0053704
1102 Ga0373956_0183323
1103 Ga0373957_0043487
1104 Ga0373957_0066338
1105 Ga0373946_0077574
1106 Ga0373946_0089460
1107 Ga0373955_0013905
1108 Ga0373955_0037958
1109 Ga0373942_0016762
1110 Ga0373942_0081450
1111 Ga0373961_0010010
1112 Ga0373961_0019586
1113 Ga0373962_0014124
1114 Ga0316574_0250935
1115 Ga0373924_0044852
1116 Ga0373924_0113203
1117 Ga0373931_0007066
1118 Ga0373931_0013645
1119 Ga0373931_0050747
1120 Ga0373931_0183971
1121 Ga0373931_0258801
1122 Ga0373935_0033555
1123 Ga0373935_0073612
1124 Ga0373935_0082099
1125 Ga0373935_0285236
1126 Ga0373927_0044150
1127 Ga0373927_0071306
1128 Ga0373927_0163066
1129 Ga0373927_0191689
1130 Ga0373927_0310970
1131 Ga0373933_0004861
1132 Ga0373933_0011796
1133 Ga0373933_0016852
1134 Ga0373933_0097211
1135 Ga0373933_0162416
1136 Ga0373947_0016322
1137 Ga0373947_0197397
1138 Ga0373947_0284726
1139 Ga0373947_0378709
1140 Ga0373937_0000761
1141 Ga0373937_0136329
1142 Ga0373937_0374780
1143 Ga0316584_0147376
1144 Ga0373925_0037185
1145 Ga0373925_0050679
1146 Ga0373925_0109152
1147 Ga0373925_0533388
1148 Ga0373925_0685459
1149 Ga0395899_0024032
1150 Ga0395899_0069251
1151 Ga0395899_0088176
1152 Ga0395900_0021639
1153 Ga0395900_0077801
1154 Ga0395900_0168974
1155 Ga0395898_0022898
1156 Ga0395905_0603119
1157 Ga0436364_0108726
1158 Ga0436364_0141915
1159 Ga0436364_0286343
1160 Ga0436364_0663275
1161 Ga0436364_0668296
1162 Ga0436364_1070480
1163 Ga0436364_1100698
1164 Ga0436364_1147233
1165 Ga0436364_1324861
1166 Ga0436364_1427712
1167 Ga0436364_1502786
1168 Ga0395901_0004105
1169 Ga0395901_0027696
1170 Ga0436365_0585284
1171 Ga0436365_0750241
1172 Ga0436365_0758860
1173 Ga0436365_0941153
1174 Ga0436365_1479190
1175 Ga0436360_0427988
1176 Ga0436360_0923341
1177 Ga0436360_0981069
1178 Ga0436360_1116770
1179 Ga0436360_1179304
1180 Ga0436360_1203512
1181 Ga0436360_1369054
1182 Ga0436361_0537570
1183 Ga0436361_0661457
1184 Ga0436361_0819334
1185 Ga0436361_0895546
1186 Ga0436363_0337004
1187 Ga0436363_0630022
1188 Ga0436363_1370045
1189 Ga0436362_0018763
1190 Ga0436362_0151417
1191 Ga0436362_0821186
1192 Ga0436362_0905187
1193 Ga0451807_1379513
1194 Ga0451577_0058318
1195 Ga0466963_0034271
1196 Ga0466963_0063652
1197 Ga0466963_0139486
1198 Ga0453684_0221968
1199 Ga0466957_0029268
1200 Ga0466960_0159009
1201 Ga0451576_0000231
1202 Ga0466958_0278385
1203 Ga0466967_0017620
1204 Ga0466967_0047199
1205 Ga0466967_0434529
1206 Ga0466967_0541993
1207 Ga0466967_0820418
1208 Ga0495592_0207647
1209 Ga0495592_0296424
1210 Ga0495592_0457795
1211 Ga0495603_0060560
1212 Ga0495629_0009132
1213 Ga0495629_0050778
1214 Ga0495629_0324725
1215 Ga0495651_0001110
1216 Ga0495651_0035681
1217 Ga0495651_0210964
1218 Ga0495653_0015948
1219 Ga0495580_0033025
1220 Ga0495580_0331218
1221 Ga0495582_0201455
1222 Ga0495664_0003048
1223 Ga0495664_0203852
1224 Ga0495664_0451982
1225 Ga0495594_0091952
1226 Ga0495608_0002474
1227 Ga0495608_0003631
1228 Ga0495608_0010040
1229 Ga0495608_0346536
1230 Ga0495618_0004450
1231 Ga0495618_0243946
1232 Ga0495628_0026011
1233 Ga0495628_0162703
1234 Ga0495630_0188579
1235 Ga0495642_0092971
1236 Ga0495652_0008869
1237 Ga0495640_0013010
1238 Ga0495640_0013014
1239 Ga0495640_0089210
1240 Ga0495640_0095657
1241 Ga0495640_0302616
1242 Ga0495587_0003059
1243 Ga0495587_0003972
1244 Ga0495587_0126345
1245 Ga0495645_0026353
1246 Ga0495645_0130339
1247 Ga0495645_0197727
1248 Ga0495645_0327354
1249 Ga0495667_0002458
1250 Ga0495667_0095069
1251 Ga0495667_0217275
1252 Ga0495634_0021446
1253 Ga0495634_0315460
1254 Ga0495635_0134069
1255 Ga0495635_0263073
1256 Ga0495599_0006436
1257 Ga0495599_0194900
1258 Ga0495623_0054108
1259 Ga0495623_0056199
1260 Ga0495646_0024219
1261 Ga0495646_0092056
1262 Ga0495658_0044840
1263 Ga0495658_0364690
1264 Ga0495669_0003664
1265 Ga0495613_0160950
1266 Ga0495613_0243124
1267 Ga0495613_0326434
1268 Ga0495670_0149208
1269 Ga0495600_0001916
1270 Ga0495600_0033817
1271 Ga0495600_0213057
1272 Ga0495581_0114871
1273 Ga0495581_0430511
1274 Ga0495604_0016624
1275 Ga0495604_0237929
1276 Ga0495604_0309282
1277 Ga0495636_0223409
1278 Ga0495674_0002245
1279 Ga0495676_0373977
1280 Ga0495680_0001116
1281 Ga0495680_0109017
1282 Ga0495675_0008949
1283 Ga0495675_0009772
1284 Ga0495684_0080283
1285 Ga0495684_0215571
1286 Ga0495602_0000398
1287 Ga0495602_0003277
1288 Ga0495602_0083357
1289 Ga0496100_0189029
1290 Ga0496100_0317406
1291 Ga0496101_0226698
1292 Ga0496102_0130395
1293 Ga0496102_0252018
1294 Ga0496104_0000182
1295 Ga0496104_0157687
1296 Ga0496104_0161275
1297 Ga0496104_0256037
1298 Ga0496104_0951254
1299 Ga0496105_0018209
1300 Ga0496106_0042250
1301 Ga0496107_0084564
1302 Ga0496108_0014116
1303 Ga0496108_0144705
1304 Ga0496108_0338840
1305 Ga0496109_0004093
1306 Ga0496109_0084299
1307 Ga0496109_0311928
1308 Ga0496110_0009439
1309 Ga0496110_0062738
1310 Ga0496111_0006863
1311 Ga0496111_0069536
1312 Ga0496111_0089794
1313 Ga0496112_0022376
1314 Ga0496112_0045592
1315 Ga0496112_0072626
1316 Ga0496112_0142143
1317 Ga0496112_0231401
1318 Ga0496113_0008368
1319 Ga0496113_0770174
1320 Ga0496115_0219333
1321 Ga0496115_0368809
1322 Ga0496119_0021644
1323 Ga0496120_0010331
1324 Ga0496126_0019977
1325 Ga0501034_0015519
1326 Ga0501036_0585873
1327 Ga0501037_0543421
1328 Ga0501039_0507502
1329 Ga0501040_0014149
1330 Ga0501046_0331248
1331 Ga0501047_0049032
1332 Ga0501048_0254716
1333 Ga0501070_0001514
1334 Ga0501072_0015465
1335 Ga0501072_0043292
1336 Ga0501072_0055740
1337 Ga0501072_0368856
1338 Ga0501073_0109984
1339 Ga0501074_0024883
1340 Ga0501075_0096213
1341 Ga0501075_0135227
1342 Ga0501075_0330944
1343 Ga0501076_0009242
1344 Ga0501076_0502018
1345 Ga0501077_0046065
1346 Ga0501077_0262511
1347 Ga0501079_0006102
1348 Ga0501079_0017971
1349 Ga0501079_0139779
1350 Ga0501079_0679599
1351 Ga0501080_0109882
1352 Ga0501080_0318290
1353 Ga0501080_0346834
1354 Ga0501081_0016815
1355 Ga0501081_0182537
1356 Ga0501035_0313992
1357 Ga0501044_0141440
1358 Ga0501044_0444430
1359 Ga0501045_0249183
1360 nmdc:mga03683_103395_c1
1361 nmdc:mga03683_32200_c1
1362 nmdc:mga03683_58390_c1
1363 nmdc:mga03n38_40237_c1
1364 nmdc:mga00v17_49624_c1
1365 nmdc:mga0yw44_157233_c1
1366 nmdc:mga0yw44_2874_c1
1367 nmdc:mga0yw44_85847_c1
1368 nmdc:mga0yw44_9815_c1
1369 nmdc:mga0k408_213338_c1
1370 nmdc:mga06z11_103120_c1
1371 nmdc:mga06z11_45433_c1
1372 nmdc:mga06z11_65071_c1
1373 nmdc:mga06z11_90393_c1
1374 nmdc:mga04h51_5824_c1
1375 nmdc:mga09592_373772_c1
1376 nmdc:mga0qj67_21559_c1
1377 nmdc:mga0qj67_229684_c1
1378 nmdc:mga0qj67_34476_c1
1379 nmdc:mga0qj67_382766_c1
1380 nmdc:mga0qj67_39099_c1
1381 nmdc:mga0qj67_95065_c1
1382 nmdc:mga06r32_32644_c1
1383 nmdc:mga06r32_33534_c1
1384 nmdc:mga06r32_3463_c1
1385 nmdc:mga06r32_46521_c1
1386 nmdc:mga06r32_47421_c1
1387 nmdc:mga06r32_607844_c1
1388 nmdc:mga06r32_93534_c1
1389 nmdc:mga08y16_13096_c1
1390 nmdc:mga08y16_334135_c1
1391 nmdc:mga08y16_70455_c1
1392 nmdc:mga08y16_864617_c1
1393 nmdc:mga08y16_87880_c1
1394 nmdc:mga0n895_207504_c1
1395 nmdc:mga0n895_896_c1
1396 nmdc:mga0rr50_455280_c1
1397 nmdc:mga0rr50_5196_c1
1398 nmdc:mga0rr50_8180_c1
1399 nmdc:mga08x19_15172_c1
1400 nmdc:mga0a205_206901_c1
1401 nmdc:mga0a205_2921_c1
1402 nmdc:mga0sz30_1852_c2
1403 nmdc:mga0sz30_498_c1
1404 Ga0495601_0000712
1405 Ga0495601_0002860
1406 Ga0495601_0297200
1407 Ga0495612_0001184
1408 Ga0495612_0118627
1409 Ga0495612_0199031
1410 Ga0495595_0000196
1411 Ga0495595_0006523
1412 Ga0495595_0016485
1413 Ga0495595_0021033
1414 Ga0495595_0146977
1415 Ga0495595_0296113
1416 Ga0495619_0004840
1417 Ga0495619_0009682
1418 Ga0495619_0116253
1419 Ga0500651_0223322
1420 Ga0500577_0129207
1421 Ga0500616_0002029
1422 Ga0500620_010418
1423 Ga0500552_000491
1424 Ga0501084_0071843
1425 Ga0501084_0104908
1426 Ga0501082_0042769
1427 Ga0501082_0053454
1428 Ga0501082_0409096
1429 Ga0501082_0456676
1430 Ga0530510_0024319
1431 Ga0530510_0035765
1432 Ga0530510_0297382
1433 2929200466
1434 8055914638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

68

280

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ml0-assembly1.cif.gz_A crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) s69a mutant from salmonella typhimurium 0.8302 13 229
6mlv-assembly1.cif.gz_A crystal structure of the periplasmic lysine-, arginine-, ornithine-binding protein (lao) y14a mutant from salmonella typhimurium 0.8221 13 229
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8133 101 188
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.8101 13 95
5wjp-assembly1.cif.gz_A crystal structure of the cyclohexadienyl dehydratase-like solute-binding protein sar11_1068 from candidatus pelagibacter ubique. 0.8026 6 234
ID Description Score Start End Superfamily
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8896 99 191 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8818 102 186 3.40.190.10
2y7iB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8793 101 191 3.40.190.10
2yjpC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8661 102 191 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8612 101 184 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2D7SK89-F1-model_v4 ABC transporter substrate-binding protein 0.9505 68 239
AF-A0A2D7SK89-F1-model_v4 ABC transporter substrate-binding protein 0.9348 68 239
AF-A0A2V6TN13-F1-model_v4 Uncharacterized protein 0.9176 90 239
AF-A0A7S3TEX8-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.8752 4 239
AF-A0A2V6TN13-F1-model_v4 Uncharacterized protein 0.869 90 239

Map