F477038

General Info

Members Datasets Scaffolds Average Seq Length
716 208 716 299

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100076118|Ga0075430_1000761183
Length 330
Sequence MASPIRALATRLGGGLRAPTGSVRSERAGAGVTRGETPTGVRRDTHWLTGAVISVGRFARRKPLGAIGGAIVVGMIVMAVFAEQIAPYGYDDSIRGARMQPPSAQHWLGTDNLNRDMWSRIVYGARVSITIGFITIALATIASLAIGVSSGYFGGAYDLIVQRIVDAWLSFPYLIIILSVMSVLGPGRANLIISLAIILSATSSRVIRGATISVAQSPYIEAARAIGCRHGRIILRHVVPNLLATVIILATIGLGVVILAESALSFLGVGVPPPYPSWGAMLSGSGRTYMFRAPWMAVWPGVAISLAVFGFNMLGDALRDVLDPRLRSRG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10260852 3300005328 Bacteria 1160
2 Ga0070670_100007662 3300005331 Bacteria 9175
3 Ga0070680_100009882 3300005336 Bacteria 7344
4 Ga0070680_100012392 3300005336 Bacteria 6623
5 Ga0070680_100016378 3300005336 Bacteria 5834
6 Ga0070682_100002488 3300005337 Bacteria 10181
7 Ga0070660_100001362 3300005339 Bacteria 16608
8 Ga0070691_10001853 3300005341 Bacteria 9222
9 Ga0070661_100008347 3300005344 Bacteria 7155
10 Ga0070692_10002362 3300005345 Bacteria 7296
11 Ga0070669_100008529 3300005353 Bacteria 7316
12 Ga0070669_100109138 3300005353 Bacteria 2098
13 Ga0070669_100157969 3300005353 Bacteria 1760
14 Ga0070675_100102803 3300005354 Bacteria 2408
15 Ga0070659_100001252 3300005366 Bacteria 18434
16 Ga0070703_10016708 3300005406 Bacteria 2108
17 Ga0070709_10225202 3300005434 Bacteria 1339
18 Ga0070711_100283277 3300005439 Bacteria 1312
19 Ga0070711_100376141 3300005439 Bacteria 1147
20 Ga0070705_100000646 3300005440 Bacteria 19918
21 Ga0070705_100065040 3300005440 Bacteria 2181
22 Ga0070705_100085671 3300005440 Bacteria 1948
23 Ga0070700_100015528 3300005441 Bacteria 4321
24 Ga0070700_100081396 3300005441 Bacteria 2092
25 Ga0070700_100125886 3300005441 Bacteria 1723
26 Ga0070700_100163883 3300005441 Bacteria 1533
27 Ga0070694_100000095 3300005444 Bacteria 42448
28 Ga0070694_100042310 3300005444 Bacteria 3043
29 Ga0070694_100065273 3300005444 Bacteria 2493
30 Ga0070694_100083409 3300005444 Bacteria 2227
31 Ga0070694_100115976 3300005444 Bacteria 1915
32 Ga0070694_100173587 3300005444 Bacteria 1590
33 Ga0070694_100279297 3300005444 Bacteria 1273
34 Ga0070708_100008672 3300005445 Bacteria 8170
35 Ga0070708_100014830 3300005445 Bacteria 6423
36 Ga0070708_100037718 3300005445 Bacteria 4219
37 Ga0070708_100042162 3300005445 Bacteria 4004
38 Ga0070708_100049283 3300005445 Bacteria 3725
39 Ga0070708_100055060 3300005445 Bacteria 3536
40 Ga0070708_100116210 3300005445 Bacteria 2463
41 Ga0070708_100200565 3300005445 Bacteria 1868
42 Ga0070708_100273521 3300005445 Bacteria 1589
43 Ga0070708_100367196 3300005445 Bacteria 1356
44 Ga0070663_100003100 3300005455 Bacteria 9509
45 Ga0070662_100016214 3300005457 Bacteria 5000
46 Ga0070681_10029698 3300005458 Bacteria 5489
47 Ga0068867_100004668 3300005459 Bacteria 9639
48 Ga0068867_100036913 3300005459 Bacteria 3550
49 Ga0068867_100063958 3300005459 Bacteria 2735
50 Ga0068867_100099460 3300005459 Bacteria 2219
51 Ga0070706_100004490 3300005467 Bacteria 13454
52 Ga0070706_100006722 3300005467 Bacteria 10856
53 Ga0070706_100026529 3300005467 Bacteria 5330
54 Ga0070706_100031331 3300005467 Bacteria 4904
55 Ga0070706_100031886 3300005467 Bacteria 4859
56 Ga0070706_100040099 3300005467 Bacteria 4322
57 Ga0070706_100060155 3300005467 Bacteria 3506
58 Ga0070706_100064752 3300005467 Bacteria 3379
59 Ga0070706_100089152 3300005467 Bacteria 2860
60 Ga0070706_100101745 3300005467 Bacteria 2670
61 Ga0070706_100211254 3300005467 Bacteria 1812
62 Ga0070706_100214505 3300005467 Bacteria 1797
63 Ga0070706_100249665 3300005467 Bacteria 1656
64 Ga0070706_100279203 3300005467 Bacteria 1559
65 Ga0070707_100008820 3300005468 Bacteria 9352
66 Ga0070707_100013212 3300005468 Bacteria 7719
67 Ga0070707_100015154 3300005468 Bacteria 7238
68 Ga0070707_100024119 3300005468 Bacteria 5758
69 Ga0070707_100034009 3300005468 Bacteria 4862
70 Ga0070707_100041764 3300005468 Bacteria 4390
71 Ga0070707_100075285 3300005468 Unclassified 3255
72 Ga0070707_100081602 3300005468 Bacteria 3122
73 Ga0070707_100081707 3300005468 Bacteria 3120
74 Ga0070707_100086150 3300005468 Bacteria 3037
75 Ga0070707_100179586 3300005468 Bacteria 2063
76 Ga0070707_100234895 3300005468 Bacteria 1784
77 Ga0070698_100007245 3300005471 Bacteria 12014
78 Ga0070698_100008405 3300005471 Bacteria 11156
79 Ga0070698_100012854 3300005471 Bacteria 8865
80 Ga0070698_100034838 3300005471 Bacteria 5208
81 Ga0070698_100040626 3300005471 Bacteria 4779
82 Ga0070698_100065431 3300005471 Bacteria 3660
83 Ga0070698_100159853 3300005471 Bacteria 2197
84 Ga0070698_100324465 3300005471 Bacteria 1471
85 Ga0070698_100430291 3300005471 Bacteria 1254
86 Ga0070699_100001452 3300005518 Bacteria 21737
87 Ga0070699_100009967 3300005518 Bacteria 8231
88 Ga0070699_100025460 3300005518 Bacteria 5100
89 Ga0070699_100026087 3300005518 Bacteria 5040
90 Ga0070699_100029751 3300005518 Bacteria 4710
91 Ga0070699_100063462 3300005518 Bacteria 3203
92 Ga0070699_100066493 3300005518 Bacteria 3129
93 Ga0070699_100125719 3300005518 Bacteria 2257
94 Ga0070697_100003399 3300005536 Bacteria 12231
95 Ga0070697_100004905 3300005536 Bacteria 10267
96 Ga0070697_100016427 3300005536 Bacteria 5821
97 Ga0070697_100028268 3300005536 Bacteria 4490
98 Ga0070697_100076567 3300005536 Bacteria 2751
99 Ga0070697_100089834 3300005536 Bacteria 2538
100 Ga0070697_100130849 3300005536 Bacteria 2104
101 Ga0068853_100002672 3300005539 Bacteria 13436
102 Ga0068853_100628365 3300005539 Bacteria 1021
103 Ga0070672_100007626 3300005543 Bacteria 7362
104 Ga0070686_100337312 3300005544 Unclassified 1129
105 Ga0070695_100000329 3300005545 Bacteria 24417
106 Ga0070695_100000732 3300005545 Bacteria 17568
107 Ga0070695_100002803 3300005545 Bacteria 10123
108 Ga0070695_100048620 3300005545 Bacteria 2713
109 Ga0070696_100042798 3300005546 Bacteria 3131
110 Ga0070696_100046925 3300005546 Bacteria 2997
111 Ga0070696_100049190 3300005546 Bacteria 2928
112 Ga0070696_100053436 3300005546 Bacteria 2812
113 Ga0070696_100062488 3300005546 Bacteria 2606
114 Ga0070693_100001613 3300005547 Bacteria 10182
115 Ga0070693_100031175 3300005547 Viruses 2920
116 Ga0070693_100060070 3300005547 Bacteria 2206
117 Ga0070704_100002052 3300005549 Bacteria 11178
118 Ga0070704_100035916 3300005549 Bacteria 3372
119 Ga0070704_100064615 3300005549 Bacteria 2631
120 Ga0070704_100204968 3300005549 Bacteria 1594
121 Ga0070704_100237873 3300005549 Bacteria 1489
122 Ga0068857_100045295 3300005577 Bacteria 3902
123 Ga0068857_100681480 3300005577 Bacteria 976
124 Ga0068856_100016921 3300005614 Bacteria 7066
125 Ga0068859_100050217 3300005617 Bacteria 4190
126 Ga0068859_100509385 3300005617 Bacteria 1299
127 Ga0068864_100465224 3300005618 Unclassified 1211
128 Ga0068861_100084163 3300005719 Bacteria 2497
129 Ga0068861_100328781 3300005719 Bacteria 1334
130 Ga0068851_10146153 3300005834 Bacteria 1289
131 Ga0068870_10004961 3300005840 Bacteria 5769
132 Ga0068863_100035257 3300005841 Bacteria 4766
133 Ga0068863_100045008 3300005841 Bacteria 4188
134 Ga0068863_100064818 3300005841 Bacteria 3456
135 Ga0068863_100494501 3300005841 Bacteria 1204
136 Ga0068858_100394607 3300005842 Bacteria 1329
137 Ga0068860_100002067 3300005843 Bacteria 21147
138 Ga0068860_100026588 3300005843 Bacteria 5577
139 Ga0068860_100046083 3300005843 Bacteria 4158
140 Ga0068860_100064053 3300005843 Bacteria 3492
141 Ga0068860_100072360 3300005843 Bacteria 3276
142 Ga0068860_100095485 3300005843 Bacteria 2834
143 Ga0068860_100107907 3300005843 Bacteria 2661
144 Ga0068860_100108054 3300005843 Bacteria 2659
145 Ga0068860_100235489 3300005843 Bacteria 1780
146 Ga0068862_100020384 3300005844 Bacteria 5539
147 Ga0068862_100034387 3300005844 Bacteria 4288
148 Ga0068862_100075916 3300005844 Bacteria 2908
149 Ga0068862_100148427 3300005844 Bacteria 2085
150 Ga0068862_100303473 3300005844 Bacteria 1469
151 Ga0068862_100483288 3300005844 Bacteria 1173
152 Ga0081538_10021486 3300005981 Bacteria 4708
153 Ga0081538_10121241 3300005981 Bacteria 1256
154 Ga0081539_10000069 3300005985 Bacteria 236854
155 Ga0075432_10009286 3300006058 Bacteria 3349
156 Ga0070716_100000347 3300006173 Bacteria 18844
157 Ga0070712_100003832 3300006175 Bacteria 9259
158 Ga0070712_100025206 3300006175 Bacteria 3950
159 Ga0070712_100083473 3300006175 Bacteria 2320
160 Ga0075428_100000491 3300006844 Bacteria 39930
161 Ga0075428_100001210 3300006844 Bacteria 27596
162 Ga0075428_100007212 3300006844 Bacteria 12312
163 Ga0075428_100016676 3300006844 Bacteria 8111
164 Ga0075428_100020210 3300006844 Bacteria 7374
165 Ga0075428_100022271 3300006844 Bacteria 7015
166 Ga0075428_100191676 3300006844 Bacteria 2211
167 Ga0075428_100193288 3300006844 Bacteria 2201
168 Ga0075428_100269308 3300006844 Bacteria 1833
169 Ga0075428_100706512 3300006844 Bacteria 1074
170 Ga0075430_100034349 3300006846 Bacteria 4304
171 Ga0075430_100042613 3300006846 Bacteria 3838
172 Ga0075430_100076118 3300006846 Bacteria 2813
173 Ga0075430_100111695 3300006846 Bacteria 2279
174 Ga0075430_100185670 3300006846 Bacteria 1729
175 Ga0075431_100000016 3300006847 Bacteria 85421
176 Ga0075431_100000528 3300006847 Bacteria 32031
177 Ga0075431_100001628 3300006847 Bacteria 20991
178 Ga0075431_100005253 3300006847 Bacteria 12752
179 Ga0075431_100005649 3300006847 Bacteria 12358
180 Ga0075431_100007859 3300006847 Bacteria 10632
181 Ga0075431_100025392 3300006847 Bacteria 6074
182 Ga0075431_100034783 3300006847 Bacteria 5189
183 Ga0075431_100167152 3300006847 Bacteria 2261
184 Ga0075431_100214365 3300006847 Bacteria 1966
185 Ga0075431_100244582 3300006847 Bacteria 1824
186 Ga0075431_100324032 3300006847 Bacteria 1553
187 Ga0075433_10000062 3300006852 Bacteria 46932
188 Ga0075433_10003101 3300006852 Bacteria 12788
189 Ga0075433_10003303 3300006852 Bacteria 12453
190 Ga0075433_10012212 3300006852 Bacteria 6927
191 Ga0075433_10013053 3300006852 Bacteria 6738
192 Ga0075433_10016839 3300006852 Bacteria 6039
193 Ga0075433_10060786 3300006852 Viruses 3309
194 Ga0075433_10107238 3300006852 Bacteria 2476
195 Ga0075433_10142675 3300006852 Bacteria 2129
196 Ga0075433_10188339 3300006852 Bacteria 1836
197 Ga0075433_10310305 3300006852 Bacteria 1396
198 Ga0075434_100013178 3300006871 Bacteria 7855
199 Ga0075434_100014019 3300006871 Bacteria 7653
200 Ga0075434_100016013 3300006871 Bacteria 7203
201 Ga0075434_100026371 3300006871 Bacteria 5692
202 Ga0075434_100049285 3300006871 Bacteria 4181
203 Ga0075434_100051721 3300006871 Bacteria 4082
204 Ga0075434_100057480 3300006871 Bacteria 3866
205 Ga0075434_100066147 3300006871 Bacteria 3600
206 Ga0075434_100115790 3300006871 Bacteria 2693
207 Ga0075434_100120509 3300006871 Bacteria 2639
208 Ga0075434_100193730 3300006871 Bacteria 2053
209 Ga0075434_100286557 3300006871 Viruses 1667
210 Ga0075434_100420560 3300006871 Bacteria 1357
211 Ga0075429_100000504 3300006880 Bacteria 29446
212 Ga0075429_100001042 3300006880 Bacteria 22166
213 Ga0075429_100002145 3300006880 Bacteria 16455
214 Ga0075429_100003244 3300006880 Bacteria 13845
215 Ga0075429_100007037 3300006880 Bacteria 9768
216 Ga0075429_100012163 3300006880 Bacteria 7461
217 Ga0075429_100037238 3300006880 Bacteria 4236
218 Ga0075429_100058151 3300006880 Bacteria 3367
219 Ga0075429_100078466 3300006880 Bacteria 2878
220 Ga0075429_100171421 3300006880 Bacteria 1901
221 Ga0075429_100177766 3300006880 Bacteria 1865
222 Ga0075429_100419846 3300006880 Bacteria 1171
223 Ga0075436_100007799 3300006914 Bacteria 7322
224 Ga0075436_100009936 3300006914 Bacteria 6508
225 Ga0075436_100040392 3300006914 Bacteria 3219
226 Ga0075436_100046972 3300006914 Bacteria 2978
227 Ga0097620_100050220 3300006931 Bacteria 4190
228 Ga0097620_100509386 3300006931 Bacteria 1299
229 Ga0075435_100008409 3300007076 Bacteria 7403
230 Ga0075435_100016419 3300007076 Bacteria 5582
231 Ga0075435_100050528 3300007076 Bacteria 3346
232 Ga0075435_100094504 3300007076 Bacteria 2471
233 Ga0075435_100100056 3300007076 Bacteria 2402
234 Ga0075435_100141405 3300007076 Bacteria 2019
235 Ga0075435_100370253 3300007076 Bacteria 1230
236 Ga0099794_10003531 3300007265 Bacteria 5990
237 Ga0099794_10005128 3300007265 Bacteria 5226
238 Ga0099794_10008201 3300007265 Bacteria 4330
239 Ga0111539_10000055 3300009094 Bacteria 115027
240 Ga0111539_10007719 3300009094 Bacteria 13744
241 Ga0111539_10007770 3300009094 Bacteria 13690
242 Ga0111539_10023738 3300009094 Bacteria 7535
243 Ga0111539_10058066 3300009094 Bacteria 4592
244 Ga0111539_10118127 3300009094 Viruses 3108
245 Ga0105245_10316545 3300009098 Bacteria 1536
246 Ga0105247_10058551 3300009101 Bacteria 2384
247 Ga0105247_10353979 3300009101 Bacteria 1033
248 Ga0114129_10000002 3300009147 Bacteria 204413
249 Ga0114129_10000093 3300009147 Bacteria 85690
250 Ga0114129_10001170 3300009147 Bacteria 34810
251 Ga0114129_10003126 3300009147 Bacteria 23222
252 Ga0114129_10004018 3300009147 Bacteria 20754
253 Ga0114129_10008371 3300009147 Bacteria 14739
254 Ga0114129_10011271 3300009147 Bacteria 12741
255 Ga0114129_10022090 3300009147 Bacteria 9029
256 Ga0114129_10080513 3300009147 Bacteria 4527
257 Ga0114129_10118889 3300009147 Bacteria 3640
258 Ga0114129_10166401 3300009147 Bacteria 3009
259 Ga0114129_10168653 3300009147 Bacteria 2986
260 Ga0114129_10198221 3300009147 Bacteria 2721
261 Ga0114129_10236238 3300009147 Bacteria 2459
262 Ga0114129_10252709 3300009147 Bacteria 2366
263 Ga0114129_10254693 3300009147 Bacteria 2355
264 Ga0114129_10260287 3300009147 Bacteria 2325
265 Ga0114129_10267349 3300009147 Bacteria 2289
266 Ga0114129_10322619 3300009147 Bacteria 2053
267 Ga0114129_10330413 3300009147 Bacteria 2024
268 Ga0114129_10356067 3300009147 Bacteria 1938
269 Ga0114129_10537803 3300009147 Bacteria 1521
270 Ga0114129_10604559 3300009147 Bacteria 1420
271 Ga0105243_10074922 3300009148 Bacteria 2746
272 Ga0105241_10007196 3300009174 Bacteria 8190
273 Ga0105241_10201564 3300009174 Bacteria 1662
274 Ga0105242_10018161 3300009176 Bacteria 5494
275 Ga0105242_10135353 3300009176 Bacteria 2132
276 Ga0105242_10150789 3300009176 Bacteria 2027
277 Ga0105242_10181364 3300009176 Bacteria 1858
278 Ga0105248_10308229 3300009177 Bacteria 1783
279 Ga0105238_10099552 3300009551 Bacteria 2890
280 Ga0105249_10097766 3300009553 Bacteria 2756
281 Ga0105249_10176622 3300009553 Bacteria 2075
282 Ga0105249_10214148 3300009553 Bacteria 1892
283 Ga0105249_10253602 3300009553 Bacteria 1745
284 Ga0105249_10265930 3300009553 Bacteria 1706
285 Ga0105249_10371440 3300009553 Bacteria 1454
286 Ga0105239_10130851 3300010375 Bacteria 2791
287 Ga0105239_10334110 3300010375 Bacteria 1710
288 Ga0105246_10005911 3300011119 Bacteria 7463
289 Ga0157373_10001034 3300013100 Bacteria 21422
290 Ga0157371_10062022 3300013102 Bacteria 2651
291 Ga0157370_10137899 3300013104 Bacteria 2273
292 Ga0157369_10005081 3300013105 Bacteria 15400
293 Ga0157378_10151921 3300013297 Bacteria 2158
294 Ga0157378_10245603 3300013297 Bacteria 1712
295 Ga0157378_10333564 3300013297 Bacteria 1477
296 Ga0163162_10095261 3300013306 Bacteria 3063
297 Ga0163162_10219085 3300013306 Bacteria 2033
298 Ga0163162_10334981 3300013306 Bacteria 1646
299 Ga0163162_10513191 3300013306 Bacteria 1328
300 Ga0157372_10005280 3300013307 Bacteria 13709
301 Ga0157375_10036155 3300013308 Bacteria 4721
302 Ga0157375_10049351 3300013308 Bacteria 4123
303 Ga0157375_10068507 3300013308 Bacteria 3551
304 Ga0157380_10057264 3300014326 Bacteria 3103
305 Ga0157380_10317544 3300014326 Bacteria 1443
306 Ga0157377_10095784 3300014745 Bacteria 1760
307 Ga0213876_10000893 3300021384 Bacteria 19920
308 Ga0213876_10029235 3300021384 Bacteria 2905
309 Ga0213876_10040154 3300021384 Bacteria 2471
310 Ga0207653_10019834 3300025885 Bacteria 2122
311 Ga0207710_10142870 3300025900 Bacteria 1156
312 Ga0207710_10164654 3300025900 Bacteria 1082
313 Ga0207688_10014656 3300025901 Bacteria 4258
314 Ga0207645_10001742 3300025907 Bacteria 17657
315 Ga0207645_10115844 3300025907 Bacteria 1738
316 Ga0207643_10001703 3300025908 Bacteria 12337
317 Ga0207684_10001720 3300025910 Bacteria 23190
318 Ga0207684_10002664 3300025910 Bacteria 17851
319 Ga0207684_10003586 3300025910 Bacteria 15109
320 Ga0207684_10005785 3300025910 Bacteria 11346
321 Ga0207684_10006640 3300025910 Bacteria 10516
322 Ga0207684_10007115 3300025910 Bacteria 10114
323 Ga0207684_10008761 3300025910 Bacteria 8982
324 Ga0207684_10009585 3300025910 Bacteria 8541
325 Ga0207684_10016628 3300025910 Bacteria 6315
326 Ga0207684_10020213 3300025910 Bacteria 5687
327 Ga0207684_10020333 3300025910 Bacteria 5672
328 Ga0207684_10035766 3300025910 Bacteria 4217
329 Ga0207684_10059919 3300025910 Bacteria 3233
330 Ga0207684_10103413 3300025910 Bacteria 2435
331 Ga0207684_10188618 3300025910 Bacteria 1778
332 Ga0207654_10004670 3300025911 Bacteria 6927
333 Ga0207654_10059722 3300025911 Bacteria 2225
334 Ga0207707_10001042 3300025912 Bacteria 26569
335 Ga0207693_10004091 3300025915 Bacteria 12395
336 Ga0207693_10006243 3300025915 Bacteria 9882
337 Ga0207693_10135068 3300025915 Bacteria 1939
338 Ga0207663_10051045 3300025916 Bacteria 2573
339 Ga0207660_10001685 3300025917 Bacteria 14809
340 Ga0207660_10232198 3300025917 Bacteria 1451
341 Ga0207662_10139903 3300025918 Bacteria 1533
342 Ga0207657_10000799 3300025919 Bacteria 33318
343 Ga0207649_10003347 3300025920 Bacteria 8768
344 Ga0207652_10002136 3300025921 Bacteria 16953
345 Ga0207646_10000396 3300025922 Bacteria 58529
346 Ga0207646_10001625 3300025922 Bacteria 27437
347 Ga0207646_10003475 3300025922 Bacteria 17792
348 Ga0207646_10007959 3300025922 Bacteria 10693
349 Ga0207646_10008922 3300025922 Bacteria 9985
350 Ga0207646_10012959 3300025922 Bacteria 7992
351 Ga0207646_10013408 3300025922 Bacteria 7841
352 Ga0207646_10058131 3300025922 Bacteria 3454
353 Ga0207646_10066516 3300025922 Unclassified 3218
354 Ga0207646_10115006 3300025922 Bacteria 2416
355 Ga0207646_10150928 3300025922 Bacteria 2095
356 Ga0207646_10157316 3300025922 Bacteria 2050
357 Ga0207681_10080704 3300025923 Bacteria 2295
358 Ga0207681_10215107 3300025923 Bacteria 1484
359 Ga0207690_10006402 3300025932 Bacteria 6980
360 Ga0207706_10014475 3300025933 Bacteria 7150
361 Ga0207706_10019895 3300025933 Bacteria 6034
362 Ga0207686_10076532 3300025934 Bacteria 2170
363 Ga0207709_10079771 3300025935 Bacteria 2106
364 Ga0207709_10130822 3300025935 Bacteria 1710
365 Ga0207670_10010879 3300025936 Bacteria 5254
366 Ga0207704_10237351 3300025938 Unclassified 1360
367 Ga0207665_10002068 3300025939 Bacteria 13533
368 Ga0207691_10022310 3300025940 Bacteria 5971
369 Ga0207711_10085055 3300025941 Bacteria 2770
370 Ga0207689_10000047 3300025942 Bacteria 91275
371 Ga0207689_10000923 3300025942 Bacteria 28231
372 Ga0207689_10007053 3300025942 Bacteria 9878
373 Ga0207689_10067905 3300025942 Bacteria 2930
374 Ga0207679_10001010 3300025945 Bacteria 18020
375 Ga0207712_10014433 3300025961 Bacteria 5084
376 Ga0207712_10085394 3300025961 Bacteria 2309
377 Ga0207712_10099597 3300025961 Bacteria 2158
378 Ga0207712_10456980 3300025961 Bacteria 1084
379 Ga0207668_10026410 3300025972 Bacteria 3770
380 Ga0207668_10279671 3300025972 Bacteria 1368
381 Ga0207640_10009557 3300025981 Bacteria 5434
382 Ga0207703_10338244 3300026035 Bacteria 1383
383 Ga0207639_10497959 3300026041 Bacteria 1113
384 Ga0207678_10007208 3300026067 Bacteria 9858
385 Ga0207708_10038934 3300026075 Bacteria 3622
386 Ga0207708_10043577 3300026075 Bacteria 3420
387 Ga0207708_10064176 3300026075 Bacteria 2805
388 Ga0207708_10309030 3300026075 Bacteria 1288
389 Ga0207641_10073576 3300026088 Bacteria 2945
390 Ga0207641_10331143 3300026088 Bacteria 1446
391 Ga0207641_10374227 3300026088 Bacteria 1362
392 Ga0207641_10460427 3300026088 Bacteria 1230
393 Ga0207648_10004900 3300026089 Bacteria 13646
394 Ga0207648_10047539 3300026089 Bacteria 3761
395 Ga0207648_10057964 3300026089 Bacteria 3378
396 Ga0207648_10074104 3300026089 Bacteria 2966
397 Ga0207648_10211209 3300026089 Bacteria 1723
398 Ga0207648_10419845 3300026089 Bacteria 1214
399 Ga0207674_10005427 3300026116 Bacteria 15155
400 Ga0207674_10110664 3300026116 Bacteria 2721
401 Ga0207674_10210137 3300026116 Bacteria 1895
402 Ga0207674_10270648 3300026116 Bacteria 1646
403 Ga0207674_10694570 3300026116 Bacteria 982
404 Ga0207675_100010761 3300026118 Bacteria 8573
405 Ga0207675_100031368 3300026118 Bacteria 4951
406 Ga0207675_100050236 3300026118 Bacteria 3892
407 Ga0207675_100256486 3300026118 Bacteria 1694
408 Ga0207675_100720189 3300026118 Bacteria 1008
409 Ga0209995_1000436 3300027471 Bacteria 6445
410 Ga0209999_1023926 3300027543 Bacteria 1126
411 Ga0209983_1000724 3300027665 Bacteria 7144
412 Ga0209588_1006112 3300027671 Bacteria 3481
413 Ga0209971_1000170 3300027682 Bacteria 19572
414 Ga0209971_1012295 3300027682 Bacteria 2025
415 Ga0209966_1000209 3300027695 Bacteria 23892
416 Ga0209966_1011288 3300027695 Bacteria 1627
417 Ga0209998_10000107 3300027717 Bacteria 33030
418 Ga0209974_10000119 3300027876 Bacteria 23142
419 Ga0207428_10000204 3300027907 Bacteria 82492
420 Ga0207428_10000284 3300027907 Bacteria 68587
421 Ga0207428_10023913 3300027907 Bacteria 5132
422 Ga0207428_10058154 3300027907 Bacteria 3069
423 Ga0207428_10072288 3300027907 Bacteria 2708
424 Ga0207428_10105247 3300027907 Bacteria 2176
425 Ga0207428_10182403 3300027907 Viruses 1585
426 Ga0268265_10041089 3300028380 Bacteria 3419
427 Ga0268265_10049335 3300028380 Bacteria 3165
428 Ga0268265_10156951 3300028380 Bacteria 1927
429 Ga0268265_10211024 3300028380 Bacteria 1692
430 Ga0268265_10226096 3300028380 Bacteria 1641
431 Ga0268265_10479517 3300028380 Bacteria 1168
432 Ga0268264_10012130 3300028381 Bacteria 7094
433 Ga0268264_10030727 3300028381 Bacteria 4403
434 Ga0268264_10033369 3300028381 Bacteria 4228
435 Ga0268264_10363499 3300028381 Bacteria 1381
436 Ga0268264_10557046 3300028381 Bacteria 1125
437 Ga0307408_100018171 3300031548 Bacteria 4719
438 Ga0307408_100061687 3300031548 Bacteria 2737
439 Ga0307408_100117053 3300031548 Bacteria 2058
440 Ga0307408_100143761 3300031548 Bacteria 1875
441 Ga0307412_10115224 3300031911 Bacteria 1926
442 Ga0307409_100039986 3300031995 Bacteria 3486
443 Ga0307416_100298542 3300032002 Bacteria 1599
444 Ga0307416_100613627 3300032002 Bacteria 1169
445 Ga0307411_10117843 3300032005 Bacteria 1914
446 Ga0373952_0030911 3300035092 Bacteria 1188
447 Ga0373939_0048772 3300035114 Bacteria 1306
448 Ga0373943_0107087 3300035170 Bacteria 1470
449 Ga0373931_0015992 3300035691 Bacteria 3687
450 Ga0373931_0262723 3300035691 Bacteria 1054
451 Ga0395899_0012673 3300037312 Bacteria 6462
452 Ga0395899_0035516 3300037312 Bacteria 3741
453 Ga0395900_0010745 3300037418 Bacteria 9364
454 Ga0395900_0019100 3300037418 Bacteria 6989
455 Ga0395900_0064079 3300037418 Bacteria 3778
456 Ga0395898_0014095 3300037466 Bacteria 8215
457 Ga0395898_0020417 3300037466 Bacteria 6727
458 Ga0395898_0697982 3300037466 Bacteria 957
459 Ga0395905_0066427 3300037471 Bacteria 3378
460 Ga0436364_0006345 3300037853 Bacteria 4509
461 Ga0436364_0229557 3300037853 Bacteria 42557
462 Ga0436364_1090762 3300037853 Bacteria 1041
463 Ga0395901_0001247 3300038443 Bacteria 27074
464 Ga0395901_0003931 3300038443 Bacteria 14948
465 Ga0395901_0131822 3300038443 Bacteria 2626
466 Ga0395901_0383712 3300038443 Bacteria 1446
467 Ga0242420_005818 3300038996 Bacteria 1928
468 Ga0436365_1020871 3300039437 Bacteria 2046
469 Ga0436365_1431743 3300039437 Bacteria 29560
470 Ga0436365_1525709 3300039437 Bacteria 1114
471 Ga0436365_1913791 3300039437 Bacteria 42482
472 Ga0436363_0215015 3300039450 Bacteria 2914
473 Ga0439437_010764 3300042000 Bacteria 1042
474 Ga0439450_003745 3300042008 Bacteria 2544
475 Ga0439455_0012273 3300042012 Bacteria 1921
476 Ga0439455_0023173 3300042012 Bacteria 1493
477 Ga0450889_006874 3300042144 Bacteria 1144
478 Ga0439459_0014251 3300042438 Bacteria 1442
479 Ga0439460_0005448 3300042461 Bacteria 3123
480 Ga0439460_0009289 3300042461 Bacteria 2496
481 Ga0451577_0001400 3300042876 Bacteria 32340
482 Ga0451577_0010001 3300042876 Bacteria 9089
483 Ga0451577_0057095 3300042876 Bacteria 3480
484 Ga0451577_0101881 3300042876 Bacteria 2565
485 Ga0453683_0010129 3300044673 Bacteria 6261
486 Ga0453683_0012087 3300044673 Bacteria 5669
487 Ga0453683_0020822 3300044673 Bacteria 4190
488 Ga0453683_0025934 3300044673 Bacteria 3722
489 Ga0453683_0041364 3300044673 Bacteria 2894
490 Ga0453683_0098241 3300044673 Bacteria 1838
491 Ga0453683_0099197 3300044673 Bacteria 1829
492 Ga0453683_0107740 3300044673 Bacteria 1751
493 Ga0453684_0103699 3300044712 Bacteria 3474
494 Ga0453684_0114215 3300044712 Bacteria 3274
495 Ga0453684_0195399 3300044712 Bacteria 2363
496 Ga0451576_0001673 3300045051 Bacteria 36781
497 Ga0451576_0012104 3300045051 Bacteria 9731
498 Ga0451576_0097074 3300045051 Bacteria 3065
499 Ga0451576_0147686 3300045051 Bacteria 2451
500 Ga0451576_0162786 3300045051 Bacteria 2328
501 Ga0451576_0442136 3300045051 Bacteria 1365
502 Ga0495603_0153963 3300046455 Bacteria 1335
503 Ga0495580_0001048 3300046472 Bacteria 24302
504 Ga0495580_0036339 3300046472 Bacteria 3537
505 Ga0495580_0273572 3300046472 Bacteria 1153
506 Ga0495594_0068991 3300046499 Bacteria 1964
507 Ga0495663_0086575 3300046525 Bacteria 1016
508 Ga0495642_0027816 3300046528 Bacteria 2251
509 Ga0495669_0013996 3300046684 Bacteria 3427
510 Ga0495669_0021073 3300046684 Bacteria 2826
511 Ga0496102_0006292 3300048905 Bacteria 10120
512 Ga0496102_0014220 3300048905 Bacteria 6915
513 Ga0496110_0028366 3300048913 Bacteria 4808
514 Ga0496112_0459949 3300048915 Bacteria 1210
515 Ga0501031_0073792 3300049568 Bacteria 2222
516 Ga0501032_0058901 3300049569 Bacteria 2578
517 Ga0501036_0035225 3300049572 Bacteria 4235
518 Ga0501036_0075560 3300049572 Bacteria 2849
519 Ga0501036_0306616 3300049572 Bacteria 1328
520 Ga0501037_0052921 3300049573 Bacteria 2969
521 Ga0501038_0008436 3300049574 Bacteria 9476
522 Ga0501038_0119241 3300049574 Bacteria 2178
523 Ga0501039_0010071 3300049575 Bacteria 7207
524 Ga0501039_0082936 3300049575 Bacteria 2496
525 Ga0501040_0216952 3300049576 Bacteria 1361
526 Ga0501041_0015693 3300049577 Bacteria 4499
527 Ga0501041_0057584 3300049577 Bacteria 2377
528 Ga0501041_0058276 3300049577 Bacteria 2362
529 Ga0501041_0117680 3300049577 Bacteria 1650
530 Ga0501041_0166578 3300049577 Bacteria 1378
531 Ga0501042_0031591 3300049578 Bacteria 3746
532 Ga0501042_0039587 3300049578 Bacteria 3350
533 Ga0501042_0055911 3300049578 Bacteria 2816
534 Ga0501042_0264848 3300049578 Bacteria 1241
535 Ga0501043_0068009 3300049579 Bacteria 2797
536 Ga0501043_0193428 3300049579 Bacteria 1581
537 Ga0501046_0000296 3300049580 Bacteria 50413
538 Ga0501046_0109924 3300049580 Bacteria 2107
539 Ga0501046_0204721 3300049580 Bacteria 1467
540 Ga0501048_0008913 3300049582 Bacteria 7553
541 Ga0501048_0053607 3300049582 Bacteria 2867
542 Ga0501048_0065692 3300049582 Bacteria 2565
543 Ga0501069_0113744 3300049585 Bacteria 1543
544 Ga0501070_0258393 3300049586 Bacteria 1424
545 Ga0501070_0305396 3300049586 Bacteria 1296
546 Ga0501071_0060254 3300049587 Bacteria 2747
547 Ga0501071_0067175 3300049587 Bacteria 2607
548 Ga0501072_0003390 3300049588 Bacteria 11990
549 Ga0501072_0005590 3300049588 Bacteria 9565
550 Ga0501072_0034048 3300049588 Bacteria 3991
551 Ga0501072_0078372 3300049588 Bacteria 2616
552 Ga0501072_0189567 3300049588 Bacteria 1640
553 Ga0501072_0483668 3300049588 Bacteria 979
554 Ga0501074_0002114 3300049590 Bacteria 13716
555 Ga0501074_0070435 3300049590 Bacteria 2514
556 Ga0501074_0364175 3300049590 Bacteria 1026
557 Ga0501075_0000012 3300049591 Bacteria 81271
558 Ga0501075_0003222 3300049591 Bacteria 10914
559 Ga0501075_0037256 3300049591 Bacteria 3632
560 Ga0501075_0085548 3300049591 Bacteria 2389
561 Ga0501075_0140379 3300049591 Bacteria 1841
562 Ga0501075_0143651 3300049591 Bacteria 1819
563 Ga0501075_0236669 3300049591 Bacteria 1392
564 Ga0501075_0307439 3300049591 Bacteria 1208
565 Ga0501076_0000017 3300049592 Bacteria 94144
566 Ga0501076_0022199 3300049592 Bacteria 4876
567 Ga0501076_0186823 3300049592 Bacteria 1690
568 Ga0501076_0228470 3300049592 Bacteria 1521
569 Ga0501077_0021665 3300049593 Bacteria 4068
570 Ga0501077_0025963 3300049593 Bacteria 3716
571 Ga0501077_0054930 3300049593 Bacteria 2529
572 Ga0501077_0077353 3300049593 Bacteria 2108
573 Ga0501077_0102597 3300049593 Bacteria 1812
574 Ga0501077_0200494 3300049593 Bacteria 1268
575 Ga0501079_0000145 3300049741 Bacteria 39282
576 Ga0501079_0002150 3300049741 Bacteria 14188
577 Ga0501079_0008767 3300049741 Bacteria 7665
578 Ga0501079_0023129 3300049741 Bacteria 4771
579 Ga0501079_0049215 3300049741 Bacteria 3253
580 Ga0501079_0055104 3300049741 Bacteria 3068
581 Ga0501079_0080871 3300049741 Bacteria 2512
582 Ga0501079_0112852 3300049741 Bacteria 2112
583 Ga0501080_0027317 3300049742 Bacteria 5307
584 Ga0501080_0060265 3300049742 Bacteria 3532
585 Ga0501080_0219584 3300049742 Bacteria 1740
586 Ga0501081_0006170 3300049743 Bacteria 7762
587 Ga0501081_0007370 3300049743 Bacteria 7140
588 Ga0501081_0012753 3300049743 Bacteria 5528
589 Ga0501081_0017169 3300049743 Bacteria 4787
590 Ga0501081_0073717 3300049743 Bacteria 2381
591 Ga0501081_0126523 3300049743 Bacteria 1823
592 Ga0501081_0256954 3300049743 Bacteria 1276
593 Ga0501083_0068917 3300049744 Bacteria 2354
594 Ga0501083_0169312 3300049744 Bacteria 1428
595 Ga0501035_0062045 3300049822 Bacteria 3326
596 Ga0501045_0000107 3300049824 Bacteria 41626
597 Ga0501045_0003102 3300049824 Bacteria 11365
598 Ga0501045_0041849 3300049824 Bacteria 3334
599 Ga0501045_0042865 3300049824 Bacteria 3294
600 Ga0501045_0082513 3300049824 Bacteria 2371
601 Ga0501045_0235522 3300049824 Bacteria 1363
602 Ga0501045_0239769 3300049824 Bacteria 1350
603 Ga0501045_0321204 3300049824 Bacteria 1152
604 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
605 nmdc:mga05p37_10922_c1 3300050507 Bacteria 10779
606 nmdc:mga05p37_11770_c1 3300050507 Bacteria 10429
607 nmdc:mga05p37_122984_c1 3300050507 Bacteria 3188
608 nmdc:mga05p37_144939_c1 3300050507 Bacteria 2909
609 nmdc:mga05p37_15739_c1 3300050507 Bacteria 9096
610 nmdc:mga05p37_204837_c1 3300050507 Bacteria 2387
611 nmdc:mga05p37_21068_c1 3300050507 Bacteria 7891
612 nmdc:mga05p37_224471_c1 3300050507 Bacteria 2266
613 nmdc:mga05p37_235659_c1 3300050507 Bacteria 2203
614 nmdc:mga05p37_24334_c2 3300050507 Bacteria 5217
615 nmdc:mga05p37_25795_c1 3300050507 Bacteria 7147
616 nmdc:mga05p37_281139_c1 3300050507 Bacteria 1985
617 nmdc:mga05p37_29613_c1 3300050507 Bacteria 1718
618 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
619 nmdc:mga05p37_32857_c1 3300050507 Bacteria 6350
620 nmdc:mga05p37_346929_c1 3300050507 Bacteria 1749
621 nmdc:mga05p37_3929_c1 3300050507 Bacteria 17410
622 nmdc:mga05p37_93087_c1 3300050507 Bacteria 3714
623 nmdc:mga09592_102486_c1 3300050508 Bacteria 2452
624 nmdc:mga09592_1315_c1 3300050508 Bacteria 19931
625 nmdc:mga09592_138785_c1 3300050508 Bacteria 2095
626 nmdc:mga09592_156622_c1 3300050508 Bacteria 1966
627 nmdc:mga09592_17382_c1 3300050508 Bacteria 5892
628 nmdc:mga09592_209975_c1 3300050508 Bacteria 1687
629 nmdc:mga09592_239480_c1 3300050508 Bacteria 1572
630 nmdc:mga09592_251861_c1 3300050508 Bacteria 1531
631 nmdc:mga09592_299615_c1 3300050508 Bacteria 1394
632 nmdc:mga09592_4199_c1 3300050508 Bacteria 11639
633 nmdc:mga09592_4857_c1 3300050508 Bacteria 10889
634 nmdc:mga09592_63484_c1 3300050508 Bacteria 3126
635 nmdc:mga09592_78307_c1 3300050508 Bacteria 2813
636 nmdc:mga09592_8539_c1 3300050508 Bacteria 8333
637 nmdc:mga09592_96776_c1 3300050508 Bacteria 2525
638 nmdc:mga0qj67_11395_c1 3300050509 Bacteria 6662
639 nmdc:mga0qj67_122239_c1 3300050509 Bacteria 2106
640 nmdc:mga0qj67_171668_c1 3300050509 Bacteria 1761
641 nmdc:mga0qj67_316680_c1 3300050509 Bacteria 1263
642 nmdc:mga0qj67_3986_c1 3300050509 Bacteria 10688
643 nmdc:mga06r32_1250_c1 3300050510 Bacteria 22866
644 nmdc:mga06r32_147768_c1 3300050510 Bacteria 2328
645 nmdc:mga06r32_169226_c1 3300050510 Bacteria 2168
646 nmdc:mga06r32_2327_c1 3300050510 Bacteria 17011
647 nmdc:mga06r32_3158_c1 3300050510 Bacteria 14763
648 nmdc:mga06r32_3173_c1 3300050510 Bacteria 14721
649 nmdc:mga06r32_411_c1 3300050510 Bacteria 36017
650 nmdc:mga06r32_425920_c1 3300050510 Bacteria 1308
651 nmdc:mga06r32_56379_c1 3300050510 Bacteria 3772
652 nmdc:mga06r32_64997_c1 3300050510 Bacteria 3518
653 nmdc:mga06r32_72743_c1 3300050510 Bacteria 3328
654 nmdc:mga08y16_14007_c1 3300050511 Bacteria 8441
655 nmdc:mga08y16_14722_c1 3300050511 Bacteria 8225
656 nmdc:mga08y16_390065_c1 3300050511 Bacteria 1427
657 nmdc:mga08y16_440556_c1 3300050511 Bacteria 1330
658 nmdc:mga08y16_48092_c1 3300050511 Bacteria 4463
659 nmdc:mga08y16_717367_c1 3300050511 Bacteria 998
660 nmdc:mga08y16_88144_c1 3300050511 Bacteria 3234
661 nmdc:mga08y16_93690_c1 3300050511 Viruses 3129
662 nmdc:mga0n895_156990_c1 3300050512 Bacteria 2306
663 nmdc:mga0n895_183048_c1 3300050512 Bacteria 2127
664 nmdc:mga0n895_18470_c1 3300050512 Bacteria 6453
665 nmdc:mga0n895_235618_c1 3300050512 Bacteria 1858
666 nmdc:mga0n895_24031_c1 3300050512 Bacteria 5737
667 nmdc:mga0n895_27887_c1 3300050512 Bacteria 5365
668 nmdc:mga0n895_282525_c1 3300050512 Bacteria 1683
669 nmdc:mga0n895_354799_c1 3300050512 Bacteria 1485
670 nmdc:mga0n895_362190_c1 3300050512 Bacteria 1468
671 nmdc:mga0n895_36358_c1 3300050512 Bacteria 4755
672 nmdc:mga0n895_37538_c1 3300050512 Bacteria 4688
673 nmdc:mga0n895_45234_c1 3300050512 Bacteria 4295
674 nmdc:mga0n895_466158_c1 3300050512 Bacteria 1275
675 nmdc:mga0n895_52778_c1 3300050512 Viruses 3992
676 nmdc:mga0n895_538_c1 3300050512 Bacteria 25886
677 nmdc:mga0n895_599_c1 3300050512 Bacteria 24923
678 nmdc:mga0n895_76697_c1 3300050512 Bacteria 3324
679 nmdc:mga0n895_97207_c1 3300050512 Bacteria 2950
680 nmdc:mga0rr50_16675_c1 3300050513 Bacteria 4886
681 nmdc:mga0rr50_264_c1 3300050513 Bacteria 28384
682 nmdc:mga0rr50_31670_c1 3300050513 Bacteria 3760
683 nmdc:mga0rr50_334006_c1 3300050513 Bacteria 1273
684 nmdc:mga0rr50_47384_c1 3300050513 Bacteria 3170
685 nmdc:mga0rr50_50253_c1 3300050513 Bacteria 3089
686 nmdc:mga0rr50_516969_c1 3300050513 Bacteria 1016
687 nmdc:mga08x19_32944_c1 3300050514 Bacteria 3268
688 nmdc:mga0a205_10599_c1 3300050515 Bacteria 8471
689 nmdc:mga0a205_134016_c1 3300050515 Bacteria 2378
690 nmdc:mga0a205_142_c1 3300050515 Bacteria 45750
691 nmdc:mga0a205_152795_c1 3300050515 Bacteria 2207
692 nmdc:mga0a205_1579_c1 3300050515 Bacteria 19522
693 nmdc:mga0a205_182147_c1 3300050515 Bacteria 1995
694 nmdc:mga0a205_19427_c1 3300050515 Bacteria 6405
695 nmdc:mga0a205_2130_c1 3300050515 Bacteria 17375
696 nmdc:mga0a205_334911_c1 3300050515 Bacteria 1383
697 nmdc:mga0a205_490_c1 3300050515 Bacteria 31013
698 nmdc:mga0a205_53829_c1 3300050515 Bacteria 3885
699 nmdc:mga0a205_77984_c1 3300050515 Viruses 3200
700 Ga0501084_0002436 3300054114 Bacteria 14981
701 Ga0501084_0027626 3300054114 Bacteria 4742
702 Ga0501084_0052787 3300054114 Bacteria 3400
703 Ga0501084_0060108 3300054114 Bacteria 3182
704 Ga0501084_0060808 3300054114 Bacteria 3162
705 Ga0501084_0145376 3300054114 Bacteria 1997
706 Ga0501082_0000058 3300060353 Bacteria 78173
707 Ga0501082_0000567 3300060353 Bacteria 32890
708 Ga0501082_0006293 3300060353 Bacteria 10295
709 Ga0501082_0022117 3300060353 Bacteria 5481
710 Ga0501082_0341149 3300060353 Bacteria 1306
711 Ga0530510_0000004 3300061734 Bacteria 256134
712 Ga0530510_0000190 3300061734 Bacteria 37810
713 Ga0530510_0001639 3300061734 Bacteria 15131
714 Ga0530510_0004927 3300061734 Bacteria 9219
715 Ga0530510_0151896 3300061734 Bacteria 1710
716 Ga0530510_0222977 3300061734 Bacteria 1401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100089152 Ga0070706_1000891522 244
2 3300025910 Ga0207684_10059919 Ga0207684_100599193 244
3 3300006844 Ga0075428_100016676 Ga0075428_1000166763 250
4 3300009094 Ga0111539_10023738 Ga0111539_100237383 250
5 3300027907 Ga0207428_10105247 Ga0207428_101052472 250
6 3300050511 nmdc:mga08y16_88144_c1 nmdc:mga08y16_88144_c1_866_1798 250
7 3300006852 Ga0075433_10188339 Ga0075433_101883393 255
8 3300039437 Ga0436365_1020871 Ga0436365_1020871_1092_1919 255
9 3300050512 nmdc:mga0n895_18470_c1 nmdc:mga0n895_18470_c1_305_1228 255
10 3300006871 Ga0075434_100193730 Ga0075434_1001937302 256
11 3300035170 Ga0373943_0107087 Ga0373943_0107087_17_913 256
12 3300050512 nmdc:mga0n895_97207_c1 nmdc:mga0n895_97207_c1_742_1668 256
13 3300050513 nmdc:mga0rr50_47384_c1 nmdc:mga0rr50_47384_c1_592_1518 256
14 3300032002 Ga0307416_100298542 Ga0307416_1002985422 257
15 3300049586 Ga0501070_0305396 Ga0501070_0305396_130_1047 257
16 3300005445 Ga0070708_100008672 Ga0070708_1000086726 258
17 3300006852 Ga0075433_10310305 Ga0075433_103103052 258
18 3300009147 Ga0114129_10118889 Ga0114129_101188893 258
19 3300009176 Ga0105242_10150789 Ga0105242_101507892 258
20 3300014326 Ga0157380_10317544 Ga0157380_103175442 258
21 3300021384 Ga0213876_10029235 Ga0213876_100292353 258
22 3300039437 Ga0436365_1431743 Ga0436365_1431743_2202_3122 258
23 3300046455 Ga0495603_0153963 Ga0495603_0153963_92_964 258
24 3300049585 Ga0501069_0113744 Ga0501069_0113744_364_1284 258
25 3300050507 nmdc:mga05p37_24334_c2 nmdc:mga05p37_24334_c2_1430_2350 258
26 3300009147 Ga0114129_10011271 Ga0114129_1001127114 259
27 3300037853 Ga0436364_0006345 Ga0436364_0006345_302_1216 260
28 3300031995 Ga0307409_100039986 Ga0307409_1000399862 261
29 3300005467 Ga0070706_100026529 Ga0070706_1000265294 262
30 3300025910 Ga0207684_10035766 Ga0207684_100357664 262
31 3300027695 Ga0209966_1011288 Ga0209966_10112882 262
32 3300037853 Ga0436364_1090762 Ga0436364_1090762_88_1017 262
33 3300005441 Ga0070700_100125886 Ga0070700_1001258862 263
34 3300005539 Ga0068853_100628365 Ga0068853_1006283651 263
35 3300005843 Ga0068860_100026588 Ga0068860_1000265882 263
36 3300014326 Ga0157380_10057264 Ga0157380_100572643 263
37 3300025923 Ga0207681_10215107 Ga0207681_102151071 263
38 3300025936 Ga0207670_10010879 Ga0207670_100108792 263
39 3300026041 Ga0207639_10497959 Ga0207639_104979591 263
40 3300026116 Ga0207674_10110664 Ga0207674_101106642 263
41 3300026118 Ga0207675_100031368 Ga0207675_1000313683 263
42 3300049593 Ga0501077_0102597 Ga0501077_0102597_17_874 263
43 3300049743 Ga0501081_0073717 Ga0501081_0073717_1270_2106 263
44 3300049824 Ga0501045_0239769 Ga0501045_0239769_121_978 263
45 3300005445 Ga0070708_100200565 Ga0070708_1002005652 264
46 3300005467 Ga0070706_100279203 Ga0070706_1002792032 264
47 3300005468 Ga0070707_100041764 Ga0070707_1000417642 264
48 3300005468 Ga0070707_100081602 Ga0070707_1000816023 264
49 3300005471 Ga0070698_100065431 Ga0070698_1000654311 264
50 3300005536 Ga0070697_100028268 Ga0070697_1000282684 264
51 3300005536 Ga0070697_100076567 Ga0070697_1000765673 264
52 3300005546 Ga0070696_100042798 Ga0070696_1000427983 264
53 3300013306 Ga0163162_10513191 Ga0163162_105131912 264
54 3300025910 Ga0207684_10008761 Ga0207684_100087614 264
55 3300054114 Ga0501084_0145376 Ga0501084_0145376_703_1560 264
56 3300005445 Ga0070708_100037718 Ga0070708_1000377184 265
57 3300005459 Ga0068867_100036913 Ga0068867_1000369134 265
58 3300005467 Ga0070706_100064752 Ga0070706_1000647522 265
59 3300005468 Ga0070707_100086150 Ga0070707_1000861503 265
60 3300005471 Ga0070698_100008405 Ga0070698_1000084058 265
61 3300005518 Ga0070699_100066493 Ga0070699_1000664933 265
62 3300005985 Ga0081539_10000069 Ga0081539_10000069100 265
63 3300006852 Ga0075433_10003101 Ga0075433_100031016 265
64 3300006871 Ga0075434_100026371 Ga0075434_1000263712 265
65 3300006871 Ga0075434_100049285 Ga0075434_1000492854 265
66 3300006871 Ga0075434_100115790 Ga0075434_1001157902 265
67 3300006914 Ga0075436_100040392 Ga0075436_1000403922 265
68 3300006914 Ga0075436_100046972 Ga0075436_1000469723 265
69 3300007076 Ga0075435_100008409 Ga0075435_1000084093 265
70 3300009147 Ga0114129_10001170 Ga0114129_1000117026 265
71 3300009147 Ga0114129_10003126 Ga0114129_1000312611 265
72 3300025910 Ga0207684_10007115 Ga0207684_100071152 265
73 3300025922 Ga0207646_10013408 Ga0207646_100134084 265
74 3300042876 Ga0451577_0057095 Ga0451577_0057095_522_1442 265
75 3300044673 Ga0453683_0041364 Ga0453683_0041364_1885_2805 265
76 3300044712 Ga0453684_0103699 Ga0453684_0103699_2331_3251 265
77 3300050507 nmdc:mga05p37_144939_c1 nmdc:mga05p37_144939_c1_1531_2463 265
78 3300050507 nmdc:mga05p37_3929_c1 nmdc:mga05p37_3929_c1_6109_7038 265
79 3300050512 nmdc:mga0n895_27887_c1 nmdc:mga0n895_27887_c1_3508_4437 265
80 3300050512 nmdc:mga0n895_466158_c1 nmdc:mga0n895_466158_c1_81_1013 265
81 3300050512 nmdc:mga0n895_538_c1 nmdc:mga0n895_538_c1_14713_15642 265
82 3300050513 nmdc:mga0rr50_264_c1 nmdc:mga0rr50_264_c1_1581_2510 265
83 3300050515 nmdc:mga0a205_2130_c1 nmdc:mga0a205_2130_c1_14738_15667 265
84 3300005545 Ga0070695_100048620 Ga0070695_1000486201 266
85 3300005546 Ga0070696_100049190 Ga0070696_1000491904 266
86 3300013297 Ga0157378_10245603 Ga0157378_102456032 266
87 3300005468 Ga0070707_100179586 Ga0070707_1001795863 267
88 3300006914 Ga0075436_100007799 Ga0075436_1000077995 267
89 3300025922 Ga0207646_10008922 Ga0207646_100089223 267
90 3300046472 Ga0495580_0036339 Ga0495580_0036339_1278_2213 267
91 3300049588 Ga0501072_0034048 Ga0501072_0034048_2072_2983 267
92 3300049591 Ga0501075_0140379 Ga0501075_0140379_882_1793 267
93 3300049593 Ga0501077_0054930 Ga0501077_0054930_477_1388 267
94 3300049741 Ga0501079_0112852 Ga0501079_0112852_1007_1918 267
95 3300049742 Ga0501080_0219584 Ga0501080_0219584_287_1198 267
96 3300049824 Ga0501045_0082513 Ga0501045_0082513_629_1540 267
97 3300050514 nmdc:mga08x19_32944_c1 nmdc:mga08x19_32944_c1_1921_2814 267
98 3300054114 Ga0501084_0060108 Ga0501084_0060108_1541_2452 267
99 3300005843 Ga0068860_100064053 Ga0068860_1000640534 268
100 3300006871 Ga0075434_100013178 Ga0075434_1000131782 268
101 3300009147 Ga0114129_10168653 Ga0114129_101686532 268
102 3300013306 Ga0163162_10334981 Ga0163162_103349812 268
103 3300013308 Ga0157375_10068507 Ga0157375_100685073 268
104 3300025923 Ga0207681_10080704 Ga0207681_100807043 268
105 3300026089 Ga0207648_10074104 Ga0207648_100741043 268
106 3300037418 Ga0395900_0064079 Ga0395900_0064079_1712_2638 268
107 3300037466 Ga0395898_0014095 Ga0395898_0014095_2969_3895 268
108 3300038443 Ga0395901_0003931 Ga0395901_0003931_3386_4312 268
109 3300050507 nmdc:mga05p37_122984_c1 nmdc:mga05p37_122984_c1_1941_2867 268
110 3300050511 nmdc:mga08y16_440556_c1 nmdc:mga08y16_440556_c1_116_1015 268
111 3300050512 nmdc:mga0n895_24031_c1 nmdc:mga0n895_24031_c1_419_1318 268
112 3300050512 nmdc:mga0n895_362190_c1 nmdc:mga0n895_362190_c1_468_1394 268
113 3300005336 Ga0070680_100016378 Ga0070680_1000163784 269
114 3300005353 Ga0070669_100008529 Ga0070669_1000085292 269
115 3300005444 Ga0070694_100042310 Ga0070694_1000423102 269
116 3300005445 Ga0070708_100273521 Ga0070708_1002735211 269
117 3300005457 Ga0070662_100016214 Ga0070662_1000162143 269
118 3300005467 Ga0070706_100006722 Ga0070706_1000067223 269
119 3300005468 Ga0070707_100075285 Ga0070707_1000752852 269
120 3300005471 Ga0070698_100012854 Ga0070698_1000128542 269
121 3300005536 Ga0070697_100003399 Ga0070697_10000339916 269
122 3300005536 Ga0070697_100089834 Ga0070697_1000898342 269
123 3300005543 Ga0070672_100007626 Ga0070672_1000076263 269
124 3300005843 Ga0068860_100046083 Ga0068860_1000460832 269
125 3300013308 Ga0157375_10049351 Ga0157375_100493514 269
126 3300021384 Ga0213876_10040154 Ga0213876_100401542 269
127 3300025910 Ga0207684_10020333 Ga0207684_100203333 269
128 3300025922 Ga0207646_10066516 Ga0207646_100665163 269
129 3300025933 Ga0207706_10019895 Ga0207706_100198956 269
130 3300025935 Ga0207709_10130822 Ga0207709_101308222 269
131 3300025940 Ga0207691_10022310 Ga0207691_100223105 269
132 3300026089 Ga0207648_10211209 Ga0207648_102112091 269
133 3300026118 Ga0207675_100050236 Ga0207675_1000502362 269
134 3300028381 Ga0268264_10033369 Ga0268264_100333692 269
135 3300035114 Ga0373939_0048772 Ga0373939_0048772_399_1253 269
136 3300035691 Ga0373931_0015992 Ga0373931_0015992_2419_3273 269
137 3300044673 Ga0453683_0012087 Ga0453683_0012087_511_1437 269
138 3300046472 Ga0495580_0273572 Ga0495580_0273572_115_1035 269
139 3300046499 Ga0495594_0068991 Ga0495594_0068991_40_960 269
140 3300048905 Ga0496102_0006292 Ga0496102_0006292_2024_2950 269
141 3300049591 Ga0501075_0143651 Ga0501075_0143651_874_1791 269
142 3300049592 Ga0501076_0228470 Ga0501076_0228470_286_1203 269
143 3300050515 nmdc:mga0a205_334911_c1 nmdc:mga0a205_334911_c1_391_1290 269
144 3300005445 Ga0070708_100042162 Ga0070708_1000421623 270
145 3300005467 Ga0070706_100101745 Ga0070706_1001017452 270
146 3300005468 Ga0070707_100081707 Ga0070707_1000817072 270
147 3300006844 Ga0075428_100000491 Ga0075428_10000049116 270
148 3300006847 Ga0075431_100000016 Ga0075431_10000001621 270
149 3300006847 Ga0075431_100324032 Ga0075431_1003240321 270
150 3300006880 Ga0075429_100002145 Ga0075429_1000021454 270
151 3300009147 Ga0114129_10000093 Ga0114129_1000009312 270
152 3300009147 Ga0114129_10080513 Ga0114129_100805132 270
153 3300013297 Ga0157378_10333564 Ga0157378_103335642 270
154 3300025910 Ga0207684_10009585 Ga0207684_100095856 270
155 3300025922 Ga0207646_10003475 Ga0207646_1000347512 270
156 3300044712 Ga0453684_0195399 Ga0453684_0195399_58_903 270
157 3300046528 Ga0495642_0027816 Ga0495642_0027816_99_1019 270
158 3300050507 nmdc:mga05p37_100_c1 nmdc:mga05p37_100_c1_31412_32320 270
159 3300050508 nmdc:mga09592_4857_c1 nmdc:mga09592_4857_c1_2002_2910 270
160 3300050510 nmdc:mga06r32_1250_c1 nmdc:mga06r32_1250_c1_19025_19933 270
161 3300050511 nmdc:mga08y16_390065_c1 nmdc:mga08y16_390065_c1_234_1055 270
162 3300050513 nmdc:mga0rr50_31670_c1 nmdc:mga0rr50_31670_c1_2075_3007 270
163 3300050508 nmdc:mga09592_156622_c1 nmdc:mga09592_156622_c1_804_1625 271
164 3300005445 Ga0070708_100049283 Ga0070708_1000492832 273
165 3300005467 Ga0070706_100060155 Ga0070706_1000601552 273
166 3300005467 Ga0070706_100211254 Ga0070706_1002112541 273
167 3300005468 Ga0070707_100234895 Ga0070707_1002348952 273
168 3300005471 Ga0070698_100007245 Ga0070698_1000072452 273
169 3300005471 Ga0070698_100040626 Ga0070698_1000406261 273
170 3300007265 Ga0099794_10005128 Ga0099794_100051282 273
171 3300009101 Ga0105247_10058551 Ga0105247_100585512 273
172 3300009553 Ga0105249_10097766 Ga0105249_100977663 273
173 3300021384 Ga0213876_10000893 Ga0213876_100008933 273
174 3300025910 Ga0207684_10005785 Ga0207684_100057857 273
175 3300025922 Ga0207646_10000396 Ga0207646_1000039632 273
176 3300037853 Ga0436364_0229557 Ga0436364_0229557_3021_3896 273
177 3300039437 Ga0436365_1525709 Ga0436365_1525709_234_1070 273
178 3300039437 Ga0436365_1913791 Ga0436365_1913791_18340_19215 273
179 3300042876 Ga0451577_0010001 Ga0451577_0010001_1602_2540 273
180 3300042876 Ga0451577_0101881 Ga0451577_0101881_1375_2205 273
181 3300044673 Ga0453683_0098241 Ga0453683_0098241_363_1271 273
182 3300045051 Ga0451576_0097074 Ga0451576_0097074_2083_2913 273
183 3300046525 Ga0495663_0086575 Ga0495663_0086575_159_989 273
184 3300049741 Ga0501079_0049215 Ga0501079_0049215_1120_1947 273
185 3300005439 Ga0070711_100283277 Ga0070711_1002832772 274
186 3300005841 Ga0068863_100045008 Ga0068863_1000450086 274
187 3300006175 Ga0070712_100003832 Ga0070712_10000383211 274
188 3300025915 Ga0207693_10006243 Ga0207693_100062433 274
189 3300026088 Ga0207641_10073576 Ga0207641_100735762 274
190 3300037466 Ga0395898_0697982 Ga0395898_0697982_110_943 275
191 3300005353 Ga0070669_100109138 Ga0070669_1001091381 276
192 3300005353 Ga0070669_100157969 Ga0070669_1001579692 276
193 3300005445 Ga0070708_100055060 Ga0070708_1000550601 276
194 3300005467 Ga0070706_100214505 Ga0070706_1002145052 276
195 3300005467 Ga0070706_100249665 Ga0070706_1002496651 276
196 3300005471 Ga0070698_100430291 Ga0070698_1004302911 276
197 3300005518 Ga0070699_100025460 Ga0070699_1000254603 276
198 3300005546 Ga0070696_100053436 Ga0070696_1000534363 276
199 3300005547 Ga0070693_100031175 Ga0070693_1000311754 276
200 3300005549 Ga0070704_100064615 Ga0070704_1000646153 276
201 3300005549 Ga0070704_100237873 Ga0070704_1002378732 276
202 3300005844 Ga0068862_100483288 Ga0068862_1004832881 276
203 3300005981 Ga0081538_10121241 Ga0081538_101212411 276
204 3300006058 Ga0075432_10009286 Ga0075432_100092863 276
205 3300006844 Ga0075428_100001210 Ga0075428_10000121019 276
206 3300006844 Ga0075428_100193288 Ga0075428_1001932881 276
207 3300006844 Ga0075428_100706512 Ga0075428_1007065121 276
208 3300006846 Ga0075430_100042613 Ga0075430_1000426131 276
209 3300006847 Ga0075431_100000528 Ga0075431_10000052829 276
210 3300006847 Ga0075431_100005649 Ga0075431_10000564912 276
211 3300006847 Ga0075431_100167152 Ga0075431_1001671522 276
212 3300006847 Ga0075431_100244582 Ga0075431_1002445821 276
213 3300006852 Ga0075433_10000062 Ga0075433_1000006240 276
214 3300006852 Ga0075433_10060786 Ga0075433_100607863 276
215 3300006871 Ga0075434_100051721 Ga0075434_1000517215 276
216 3300006871 Ga0075434_100286557 Ga0075434_1002865572 276
217 3300006871 Ga0075434_100420560 Ga0075434_1004205601 276
218 3300006880 Ga0075429_100000504 Ga0075429_10000050427 276
219 3300006880 Ga0075429_100171421 Ga0075429_1001714212 276
220 3300007265 Ga0099794_10003531 Ga0099794_100035314 276
221 3300009094 Ga0111539_10007719 Ga0111539_100077192 276
222 3300009094 Ga0111539_10007770 Ga0111539_1000777014 276
223 3300009094 Ga0111539_10118127 Ga0111539_101181272 276
224 3300009101 Ga0105247_10353979 Ga0105247_103539791 276
225 3300009147 Ga0114129_10004018 Ga0114129_100040189 276
226 3300009147 Ga0114129_10022090 Ga0114129_100220902 276
227 3300009147 Ga0114129_10236238 Ga0114129_102362383 276
228 3300009147 Ga0114129_10260287 Ga0114129_102602872 276
229 3300009176 Ga0105242_10135353 Ga0105242_101353532 276
230 3300009553 Ga0105249_10176622 Ga0105249_101766221 276
231 3300010375 Ga0105239_10334110 Ga0105239_103341102 276
232 3300014745 Ga0157377_10095784 Ga0157377_100957842 276
233 3300025910 Ga0207684_10188618 Ga0207684_101886182 276
234 3300025918 Ga0207662_10139903 Ga0207662_101399031 276
235 3300025922 Ga0207646_10115006 Ga0207646_101150062 276
236 3300025961 Ga0207712_10085394 Ga0207712_100853942 276
237 3300026075 Ga0207708_10038934 Ga0207708_100389343 276
238 3300026116 Ga0207674_10210137 Ga0207674_102101371 276
239 3300027907 Ga0207428_10000284 Ga0207428_1000028425 276
240 3300027907 Ga0207428_10058154 Ga0207428_100581543 276
241 3300027907 Ga0207428_10182403 Ga0207428_101824032 276
242 3300028380 Ga0268265_10211024 Ga0268265_102110241 276
243 3300028380 Ga0268265_10479517 Ga0268265_104795171 276
244 3300031548 Ga0307408_100018171 Ga0307408_1000181714 276
245 3300031548 Ga0307408_100117053 Ga0307408_1001170532 276
246 3300031911 Ga0307412_10115224 Ga0307412_101152242 276
247 3300032005 Ga0307411_10117843 Ga0307411_101178431 276
248 3300038443 Ga0395901_0383712 Ga0395901_0383712_539_1399 276
249 3300039450 Ga0436363_0215015 Ga0436363_0215015_1134_2066 276
250 3300042461 Ga0439460_0009289 Ga0439460_0009289_760_1671 276
251 3300044673 Ga0453683_0020822 Ga0453683_0020822_2231_3160 276
252 3300049572 Ga0501036_0035225 Ga0501036_0035225_2240_3169 276
253 3300049572 Ga0501036_0306616 Ga0501036_0306616_237_1076 276
254 3300049574 Ga0501038_0008436 Ga0501038_0008436_3170_4099 276
255 3300049575 Ga0501039_0010071 Ga0501039_0010071_94_1023 276
256 3300049576 Ga0501040_0216952 Ga0501040_0216952_153_1067 276
257 3300049577 Ga0501041_0015693 Ga0501041_0015693_509_1438 276
258 3300049577 Ga0501041_0117680 Ga0501041_0117680_550_1464 276
259 3300049577 Ga0501041_0166578 Ga0501041_0166578_260_1174 276
260 3300049578 Ga0501042_0039587 Ga0501042_0039587_1937_2866 276
261 3300049578 Ga0501042_0264848 Ga0501042_0264848_204_1118 276
262 3300049579 Ga0501043_0068009 Ga0501043_0068009_1234_2163 276
263 3300049580 Ga0501046_0109924 Ga0501046_0109924_91_1020 276
264 3300049582 Ga0501048_0008913 Ga0501048_0008913_3888_4817 276
265 3300049587 Ga0501071_0060254 Ga0501071_0060254_626_1555 276
266 3300049588 Ga0501072_0003390 Ga0501072_0003390_4609_5538 276
267 3300049588 Ga0501072_0189567 Ga0501072_0189567_164_1078 276
268 3300049590 Ga0501074_0364175 Ga0501074_0364175_94_1008 276
269 3300049591 Ga0501075_0000012 Ga0501075_0000012_51758_52687 276
270 3300049591 Ga0501075_0307439 Ga0501075_0307439_162_1076 276
271 3300049592 Ga0501076_0000017 Ga0501076_0000017_42258_43187 276
272 3300049592 Ga0501076_0186823 Ga0501076_0186823_113_1027 276
273 3300049593 Ga0501077_0021665 Ga0501077_0021665_1854_2768 276
274 3300049741 Ga0501079_0023129 Ga0501079_0023129_3245_4159 276
275 3300049741 Ga0501079_0080871 Ga0501079_0080871_1295_2224 276
276 3300049742 Ga0501080_0027317 Ga0501080_0027317_3248_4177 276
277 3300049743 Ga0501081_0012753 Ga0501081_0012753_4391_5320 276
278 3300049744 Ga0501083_0068917 Ga0501083_0068917_224_1153 276
279 3300049822 Ga0501035_0062045 Ga0501035_0062045_741_1670 276
280 3300049824 Ga0501045_0042865 Ga0501045_0042865_2213_3127 276
281 3300049824 Ga0501045_0321204 Ga0501045_0321204_154_1068 276
282 3300050507 nmdc:mga05p37_15739_c1 nmdc:mga05p37_15739_c1_205_1122 276
283 3300050507 nmdc:mga05p37_21068_c1 nmdc:mga05p37_21068_c1_6833_7753 276
284 3300050507 nmdc:mga05p37_25795_c1 nmdc:mga05p37_25795_c1_4166_5095 276
285 3300050508 nmdc:mga09592_209975_c1 nmdc:mga09592_209975_c1_561_1478 276
286 3300050508 nmdc:mga09592_8539_c1 nmdc:mga09592_8539_c1_6139_7059 276
287 3300050509 nmdc:mga0qj67_3986_c1 nmdc:mga0qj67_3986_c1_4702_5631 276
288 3300050510 nmdc:mga06r32_169226_c1 nmdc:mga06r32_169226_c1_483_1409 276
289 3300050510 nmdc:mga06r32_2327_c1 nmdc:mga06r32_2327_c1_10783_11712 276
290 3300050510 nmdc:mga06r32_64997_c1 nmdc:mga06r32_64997_c1_1774_2697 276
291 3300050510 nmdc:mga06r32_72743_c1 nmdc:mga06r32_72743_c1_812_1732 276
292 3300050511 nmdc:mga08y16_14007_c1 nmdc:mga08y16_14007_c1_6471_7388 276
293 3300050511 nmdc:mga08y16_93690_c1 nmdc:mga08y16_93690_c1_2052_2966 276
294 3300050512 nmdc:mga0n895_282525_c1 nmdc:mga0n895_282525_c1_618_1541 276
295 3300050512 nmdc:mga0n895_52778_c1 nmdc:mga0n895_52778_c1_2533_3447 276
296 3300050512 nmdc:mga0n895_599_c1 nmdc:mga0n895_599_c1_372_1292 276
297 3300050515 nmdc:mga0a205_142_c1 nmdc:mga0a205_142_c1_31521_32441 276
298 3300050515 nmdc:mga0a205_77984_c1 nmdc:mga0a205_77984_c1_1251_2165 276
299 3300054114 Ga0501084_0002436 Ga0501084_0002436_7661_8590 276
300 3300054114 Ga0501084_0027626 Ga0501084_0027626_613_1527 276
301 3300060353 Ga0501082_0000567 Ga0501082_0000567_6705_7634 276
302 3300061734 Ga0530510_0000004 Ga0530510_0000004_121965_122894 276
303 3300061734 Ga0530510_0000190 Ga0530510_0000190_28679_29593 276
304 3300061734 Ga0530510_0001639 Ga0530510_0001639_12390_13304 276
305 3300005441 Ga0070700_100163883 Ga0070700_1001638832 277
306 3300005445 Ga0070708_100116210 Ga0070708_1001162102 277
307 3300005459 Ga0068867_100063958 Ga0068867_1000639583 277
308 3300005459 Ga0068867_100099460 Ga0068867_1000994602 277
309 3300005467 Ga0070706_100031331 Ga0070706_1000313315 277
310 3300005467 Ga0070706_100040099 Ga0070706_1000400995 277
311 3300005468 Ga0070707_100008820 Ga0070707_1000088203 277
312 3300005468 Ga0070707_100034009 Ga0070707_1000340093 277
313 3300005471 Ga0070698_100034838 Ga0070698_1000348382 277
314 3300005471 Ga0070698_100159853 Ga0070698_1001598533 277
315 3300005518 Ga0070699_100001452 Ga0070699_10000145219 277
316 3300005518 Ga0070699_100026087 Ga0070699_1000260873 277
317 3300005518 Ga0070699_100063462 Ga0070699_1000634623 277
318 3300005536 Ga0070697_100004905 Ga0070697_10000490510 277
319 3300005536 Ga0070697_100130849 Ga0070697_1001308492 277
320 3300005545 Ga0070695_100002803 Ga0070695_1000028036 277
321 3300005546 Ga0070696_100062488 Ga0070696_1000624882 277
322 3300005841 Ga0068863_100494501 Ga0068863_1004945011 277
323 3300005844 Ga0068862_100034387 Ga0068862_1000343873 277
324 3300005844 Ga0068862_100075916 Ga0068862_1000759163 277
325 3300006173 Ga0070716_100000347 Ga0070716_1000003475 277
326 3300006175 Ga0070712_100083473 Ga0070712_1000834731 277
327 3300006844 Ga0075428_100007212 Ga0075428_10000721213 277
328 3300006844 Ga0075428_100020210 Ga0075428_1000202103 277
329 3300006844 Ga0075428_100022271 Ga0075428_1000222716 277
330 3300006846 Ga0075430_100034349 Ga0075430_1000343494 277
331 3300006846 Ga0075430_100076118 Ga0075430_1000761183 277
332 3300006846 Ga0075430_100111695 Ga0075430_1001116952 277
333 3300006846 Ga0075430_100185670 Ga0075430_1001856701 277
334 3300006847 Ga0075431_100001628 Ga0075431_10000162811 277
335 3300006847 Ga0075431_100005253 Ga0075431_1000052533 277
336 3300006847 Ga0075431_100025392 Ga0075431_1000253927 277
337 3300006852 Ga0075433_10016839 Ga0075433_100168393 277
338 3300006852 Ga0075433_10142675 Ga0075433_101426751 277
339 3300006871 Ga0075434_100014019 Ga0075434_1000140192 277
340 3300006871 Ga0075434_100066147 Ga0075434_1000661476 277
341 3300006880 Ga0075429_100001042 Ga0075429_1000010423 277
342 3300006880 Ga0075429_100003244 Ga0075429_10000324414 277
343 3300006880 Ga0075429_100007037 Ga0075429_1000070379 277
344 3300006880 Ga0075429_100037238 Ga0075429_1000372384 277
345 3300006880 Ga0075429_100058151 Ga0075429_1000581514 277
346 3300006880 Ga0075429_100177766 Ga0075429_1001777662 277
347 3300007076 Ga0075435_100050528 Ga0075435_1000505283 277
348 3300007076 Ga0075435_100094504 Ga0075435_1000945042 277
349 3300007076 Ga0075435_100370253 Ga0075435_1003702531 277
350 3300009147 Ga0114129_10000002 Ga0114129_1000000282 277
351 3300009147 Ga0114129_10166401 Ga0114129_101664014 277
352 3300009147 Ga0114129_10198221 Ga0114129_101982212 277
353 3300009147 Ga0114129_10254693 Ga0114129_102546934 277
354 3300009147 Ga0114129_10322619 Ga0114129_103226192 277
355 3300025910 Ga0207684_10002664 Ga0207684_100026644 277
356 3300025910 Ga0207684_10006640 Ga0207684_100066406 277
357 3300025910 Ga0207684_10020213 Ga0207684_100202132 277
358 3300025910 Ga0207684_10103413 Ga0207684_101034132 277
359 3300025915 Ga0207693_10135068 Ga0207693_101350682 277
360 3300025922 Ga0207646_10007959 Ga0207646_100079593 277
361 3300025922 Ga0207646_10157316 Ga0207646_101573162 277
362 3300025939 Ga0207665_10002068 Ga0207665_1000206810 277
363 3300025942 Ga0207689_10007053 Ga0207689_100070535 277
364 3300026075 Ga0207708_10309030 Ga0207708_103090302 277
365 3300026088 Ga0207641_10460427 Ga0207641_104604271 277
366 3300026089 Ga0207648_10047539 Ga0207648_100475393 277
367 3300027671 Ga0209588_1006112 Ga0209588_10061123 277
368 3300027682 Ga0209971_1012295 Ga0209971_10122952 277
369 3300027907 Ga0207428_10023913 Ga0207428_100239135 277
370 3300028380 Ga0268265_10041089 Ga0268265_100410892 277
371 3300031548 Ga0307408_100143761 Ga0307408_1001437611 277
372 3300032002 Ga0307416_100613627 Ga0307416_1006136271 277
373 3300037471 Ga0395905_0066427 Ga0395905_0066427_532_1449 277
374 3300049574 Ga0501038_0119241 Ga0501038_0119241_1186_2028 277
375 3300049577 Ga0501041_0057584 Ga0501041_0057584_321_1205 277
376 3300049577 Ga0501041_0058276 Ga0501041_0058276_250_1092 277
377 3300049580 Ga0501046_0204721 Ga0501046_0204721_261_1103 277
378 3300049582 Ga0501048_0053607 Ga0501048_0053607_120_962 277
379 3300049586 Ga0501070_0258393 Ga0501070_0258393_244_1086 277
380 3300049587 Ga0501071_0067175 Ga0501071_0067175_274_1116 277
381 3300049588 Ga0501072_0005590 Ga0501072_0005590_8092_8934 277
382 3300049590 Ga0501074_0070435 Ga0501074_0070435_1589_2431 277
383 3300049591 Ga0501075_0003222 Ga0501075_0003222_9067_9909 277
384 3300049741 Ga0501079_0002150 Ga0501079_0002150_10661_11503 277
385 3300049743 Ga0501081_0007370 Ga0501081_0007370_236_1078 277
386 3300049743 Ga0501081_0256954 Ga0501081_0256954_85_927 277
387 3300049744 Ga0501083_0169312 Ga0501083_0169312_564_1406 277
388 3300049824 Ga0501045_0003102 Ga0501045_0003102_48_890 277
389 3300049824 Ga0501045_0235522 Ga0501045_0235522_101_943 277
390 3300050507 nmdc:mga05p37_10922_c1 nmdc:mga05p37_10922_c1_9406_10308 277
391 3300050507 nmdc:mga05p37_11770_c1 nmdc:mga05p37_11770_c1_5829_6755 277
392 3300050507 nmdc:mga05p37_224471_c1 nmdc:mga05p37_224471_c1_940_1875 277
393 3300050507 nmdc:mga05p37_2_c1 nmdc:mga05p37_2_c1_128753_129682 277
394 3300050507 nmdc:mga05p37_93087_c1 nmdc:mga05p37_93087_c1_1146_2081 277
395 3300050508 nmdc:mga09592_102486_c1 nmdc:mga09592_102486_c1_492_1469 277
396 3300050508 nmdc:mga09592_1315_c1 nmdc:mga09592_1315_c1_918_1820 277
397 3300050508 nmdc:mga09592_138785_c1 nmdc:mga09592_138785_c1_1043_1978 277
398 3300050508 nmdc:mga09592_239480_c1 nmdc:mga09592_239480_c1_479_1405 277
399 3300050508 nmdc:mga09592_4199_c1 nmdc:mga09592_4199_c1_3706_4635 277
400 3300050508 nmdc:mga09592_63484_c1 nmdc:mga09592_63484_c1_914_1837 277
401 3300050509 nmdc:mga0qj67_11395_c1 nmdc:mga0qj67_11395_c1_5371_6273 277
402 3300050509 nmdc:mga0qj67_122239_c1 nmdc:mga0qj67_122239_c1_202_1128 277
403 3300050509 nmdc:mga0qj67_171668_c1 nmdc:mga0qj67_171668_c1_142_1065 277
404 3300050510 nmdc:mga06r32_3158_c1 nmdc:mga06r32_3158_c1_6574_7476 277
405 3300050510 nmdc:mga06r32_3173_c1 nmdc:mga06r32_3173_c1_5594_6523 277
406 3300050510 nmdc:mga06r32_56379_c1 nmdc:mga06r32_56379_c1_1009_1932 277
407 3300050512 nmdc:mga0n895_183048_c1 nmdc:mga0n895_183048_c1_96_944 277
408 3300050512 nmdc:mga0n895_37538_c1 nmdc:mga0n895_37538_c1_1590_2525 277
409 3300050512 nmdc:mga0n895_76697_c1 nmdc:mga0n895_76697_c1_1568_2479 277
410 3300050513 nmdc:mga0rr50_16675_c1 nmdc:mga0rr50_16675_c1_697_1545 277
411 3300050513 nmdc:mga0rr50_334006_c1 nmdc:mga0rr50_334006_c1_297_1232 277
412 3300050513 nmdc:mga0rr50_516969_c1 nmdc:mga0rr50_516969_c1_58_966 277
413 3300050515 nmdc:mga0a205_134016_c1 nmdc:mga0a205_134016_c1_96_944 277
414 3300050515 nmdc:mga0a205_182147_c1 nmdc:mga0a205_182147_c1_42_977 277
415 3300050515 nmdc:mga0a205_53829_c1 nmdc:mga0a205_53829_c1_152_1087 277
416 3300054114 Ga0501084_0060808 Ga0501084_0060808_2089_2931 277
417 3300060353 Ga0501082_0006293 Ga0501082_0006293_243_1085 277
418 3300061734 Ga0530510_0004927 Ga0530510_0004927_8193_9035 277
419 3300005577 Ga0068857_100681480 Ga0068857_1006814802 278
420 3300006844 Ga0075428_100269308 Ga0075428_1002693081 278
421 3300006847 Ga0075431_100034783 Ga0075431_1000347834 278
422 3300006880 Ga0075429_100419846 Ga0075429_1004198462 278
423 3300007265 Ga0099794_10008201 Ga0099794_100082012 278
424 3300026116 Ga0207674_10694570 Ga0207674_106945702 278
425 3300046472 Ga0495580_0001048 Ga0495580_0001048_7132_8064 278
426 3300049588 Ga0501072_0483668 Ga0501072_0483668_44_895 278
427 3300050508 nmdc:mga09592_251861_c1 nmdc:mga09592_251861_c1_62_907 278
428 3300050510 nmdc:mga06r32_147768_c1 nmdc:mga06r32_147768_c1_893_1738 278
429 3300050511 nmdc:mga08y16_717367_c1 nmdc:mga08y16_717367_c1_92_937 278
430 3300005467 Ga0070706_100004490 Ga0070706_1000044902 279
431 3300005468 Ga0070707_100013212 Ga0070707_1000132125 279
432 3300006880 Ga0075429_100012163 Ga0075429_1000121637 279
433 3300025910 Ga0207684_10001720 Ga0207684_100017203 279
434 3300025922 Ga0207646_10012959 Ga0207646_100129594 279
435 3300044673 Ga0453683_0025934 Ga0453683_0025934_2061_2915 279
436 3300050508 nmdc:mga09592_17382_c1 nmdc:mga09592_17382_c1_433_1338 279
437 3300005440 Ga0070705_100065040 Ga0070705_1000650402 280
438 3300005441 Ga0070700_100081396 Ga0070700_1000813961 280
439 3300005444 Ga0070694_100173587 Ga0070694_1001735872 280
440 3300005444 Ga0070694_100279297 Ga0070694_1002792971 280
441 3300005468 Ga0070707_100015154 Ga0070707_1000151543 280
442 3300005518 Ga0070699_100009967 Ga0070699_1000099678 280
443 3300005536 Ga0070697_100016427 Ga0070697_1000164273 280
444 3300005544 Ga0070686_100337312 Ga0070686_1003373122 280
445 3300005617 Ga0068859_100050217 Ga0068859_1000502173 280
446 3300005617 Ga0068859_100509385 Ga0068859_1005093852 280
447 3300005618 Ga0068864_100465224 Ga0068864_1004652242 280
448 3300005842 Ga0068858_100394607 Ga0068858_1003946071 280
449 3300005843 Ga0068860_100072360 Ga0068860_1000723603 280
450 3300005843 Ga0068860_100107907 Ga0068860_1001079072 280
451 3300005843 Ga0068860_100108054 Ga0068860_1001080542 280
452 3300005844 Ga0068862_100303473 Ga0068862_1003034732 280
453 3300006871 Ga0075434_100016013 Ga0075434_1000160136 280
454 3300006931 Ga0097620_100050220 Ga0097620_1000502203 280
455 3300006931 Ga0097620_100509386 Ga0097620_1005093862 280
456 3300007076 Ga0075435_100141405 Ga0075435_1001414052 280
457 3300009148 Ga0105243_10074922 Ga0105243_100749222 280
458 3300009174 Ga0105241_10201564 Ga0105241_102015642 280
459 3300009553 Ga0105249_10253602 Ga0105249_102536022 280
460 3300009553 Ga0105249_10265930 Ga0105249_102659302 280
461 3300009553 Ga0105249_10371440 Ga0105249_103714402 280
462 3300013306 Ga0163162_10095261 Ga0163162_100952612 280
463 3300025900 Ga0207710_10142870 Ga0207710_101428701 280
464 3300025900 Ga0207710_10164654 Ga0207710_101646541 280
465 3300025910 Ga0207684_10003586 Ga0207684_100035861 280
466 3300025922 Ga0207646_10001625 Ga0207646_100016258 280
467 3300025922 Ga0207646_10150928 Ga0207646_101509283 280
468 3300025961 Ga0207712_10014433 Ga0207712_100144332 280
469 3300025972 Ga0207668_10026410 Ga0207668_100264103 280
470 3300026035 Ga0207703_10338244 Ga0207703_103382442 280
471 3300026075 Ga0207708_10043577 Ga0207708_100435773 280
472 3300026089 Ga0207648_10057964 Ga0207648_100579643 280
473 3300028380 Ga0268265_10226096 Ga0268265_102260961 280
474 3300045051 Ga0451576_0162786 Ga0451576_0162786_1135_2019 280
475 3300046684 Ga0495669_0021073 Ga0495669_0021073_281_1153 280
476 3300050512 nmdc:mga0n895_235618_c1 nmdc:mga0n895_235618_c1_877_1761 280
477 3300005336 Ga0070680_100012392 Ga0070680_1000123925 281
478 3300005341 Ga0070691_10001853 Ga0070691_100018535 281
479 3300005406 Ga0070703_10016708 Ga0070703_100167081 281
480 3300005440 Ga0070705_100085671 Ga0070705_1000856712 281
481 3300005441 Ga0070700_100015528 Ga0070700_1000155284 281
482 3300005444 Ga0070694_100065273 Ga0070694_1000652732 281
483 3300005471 Ga0070698_100324465 Ga0070698_1003244652 281
484 3300005518 Ga0070699_100029751 Ga0070699_1000297514 281
485 3300005577 Ga0068857_100045295 Ga0068857_1000452954 281
486 3300005844 Ga0068862_100148427 Ga0068862_1001484272 281
487 3300005981 Ga0081538_10021486 Ga0081538_100214865 281
488 3300006844 Ga0075428_100191676 Ga0075428_1001916762 281
489 3300006847 Ga0075431_100007859 Ga0075431_1000078593 281
490 3300006847 Ga0075431_100214365 Ga0075431_1002143652 281
491 3300006852 Ga0075433_10012212 Ga0075433_100122125 281
492 3300006852 Ga0075433_10013053 Ga0075433_100130535 281
493 3300006871 Ga0075434_100120509 Ga0075434_1001205093 281
494 3300006880 Ga0075429_100078466 Ga0075429_1000784663 281
495 3300009094 Ga0111539_10000055 Ga0111539_100000553 281
496 3300009094 Ga0111539_10058066 Ga0111539_100580663 281
497 3300009098 Ga0105245_10316545 Ga0105245_103165452 281
498 3300009147 Ga0114129_10252709 Ga0114129_102527092 281
499 3300009147 Ga0114129_10330413 Ga0114129_103304132 281
500 3300009147 Ga0114129_10604559 Ga0114129_106045591 281
501 3300009176 Ga0105242_10018161 Ga0105242_100181612 281
502 3300009177 Ga0105248_10308229 Ga0105248_103082291 281
503 3300009553 Ga0105249_10214148 Ga0105249_102141482 281
504 3300013102 Ga0157371_10062022 Ga0157371_100620222 281
505 3300025885 Ga0207653_10019834 Ga0207653_100198341 281
506 3300025935 Ga0207709_10079771 Ga0207709_100797713 281
507 3300025941 Ga0207711_10085055 Ga0207711_100850552 281
508 3300025942 Ga0207689_10067905 Ga0207689_100679052 281
509 3300025961 Ga0207712_10099597 Ga0207712_100995972 281
510 3300025961 Ga0207712_10456980 Ga0207712_104569801 281
511 3300026075 Ga0207708_10064176 Ga0207708_100641763 281
512 3300026116 Ga0207674_10270648 Ga0207674_102706482 281
513 3300027907 Ga0207428_10000204 Ga0207428_100002044 281
514 3300027907 Ga0207428_10072288 Ga0207428_100722882 281
515 3300028381 Ga0268264_10557046 Ga0268264_105570461 281
516 3300031548 Ga0307408_100061687 Ga0307408_1000616873 281
517 3300037312 Ga0395899_0012673 Ga0395899_0012673_395_1327 281
518 3300037418 Ga0395900_0019100 Ga0395900_0019100_3572_4504 281
519 3300037466 Ga0395898_0020417 Ga0395898_0020417_286_1218 281
520 3300038443 Ga0395901_0001247 Ga0395901_0001247_21193_22125 281
521 3300038996 Ga0242420_005818 Ga0242420_005818_153_1073 281
522 3300042008 Ga0439450_003745 Ga0439450_003745_1457_2332 281
523 3300042876 Ga0451577_0001400 Ga0451577_0001400_13651_14571 281
524 3300044673 Ga0453683_0107740 Ga0453683_0107740_187_1107 281
525 3300044712 Ga0453684_0114215 Ga0453684_0114215_1771_2694 281
526 3300045051 Ga0451576_0001673 Ga0451576_0001673_25067_25987 281
527 3300049593 Ga0501077_0077353 Ga0501077_0077353_1022_1954 281
528 3300050507 nmdc:mga05p37_235659_c1 nmdc:mga05p37_235659_c1_659_1582 281
529 3300050507 nmdc:mga05p37_281139_c1 nmdc:mga05p37_281139_c1_680_1612 281
530 3300050508 nmdc:mga09592_299615_c1 nmdc:mga09592_299615_c1_185_1105 281
531 3300050508 nmdc:mga09592_78307_c1 nmdc:mga09592_78307_c1_204_1124 281
532 3300050508 nmdc:mga09592_96776_c1 nmdc:mga09592_96776_c1_1568_2500 281
533 3300050509 nmdc:mga0qj67_316680_c1 nmdc:mga0qj67_316680_c1_51_974 281
534 3300050510 nmdc:mga06r32_411_c1 nmdc:mga06r32_411_c1_10488_11411 281
535 3300050510 nmdc:mga06r32_425920_c1 nmdc:mga06r32_425920_c1_107_1027 281
536 3300050511 nmdc:mga08y16_14722_c1 nmdc:mga08y16_14722_c1_2890_3810 281
537 3300050511 nmdc:mga08y16_48092_c1 nmdc:mga08y16_48092_c1_1302_2225 281
538 3300050512 nmdc:mga0n895_156990_c1 nmdc:mga0n895_156990_c1_1207_2127 281
539 3300050512 nmdc:mga0n895_354799_c1 nmdc:mga0n895_354799_c1_13_945 281
540 3300050512 nmdc:mga0n895_36358_c1 nmdc:mga0n895_36358_c1_1774_2697 281
541 3300050515 nmdc:mga0a205_1579_c1 nmdc:mga0a205_1579_c1_6953_7876 281
542 3300050515 nmdc:mga0a205_19427_c1 nmdc:mga0a205_19427_c1_3652_4575 281
543 3300050515 nmdc:mga0a205_490_c1 nmdc:mga0a205_490_c1_3013_3933 281
544 3300060353 Ga0501082_0341149 Ga0501082_0341149_26_958 281
545 3300061734 Ga0530510_0151896 Ga0530510_0151896_123_1055 281
546 3300005328 Ga0070676_10260852 Ga0070676_102608521 282
547 3300005331 Ga0070670_100007662 Ga0070670_1000076628 282
548 3300005336 Ga0070680_100009882 Ga0070680_1000098823 282
549 3300005337 Ga0070682_100002488 Ga0070682_1000024884 282
550 3300005339 Ga0070660_100001362 Ga0070660_10000136211 282
551 3300005344 Ga0070661_100008347 Ga0070661_1000083471 282
552 3300005345 Ga0070692_10002362 Ga0070692_100023625 282
553 3300005354 Ga0070675_100102803 Ga0070675_1001028032 282
554 3300005366 Ga0070659_100001252 Ga0070659_10000125211 282
555 3300005434 Ga0070709_10225202 Ga0070709_102252021 282
556 3300005439 Ga0070711_100376141 Ga0070711_1003761412 282
557 3300005440 Ga0070705_100000646 Ga0070705_10000064613 282
558 3300005444 Ga0070694_100000095 Ga0070694_10000009517 282
559 3300005444 Ga0070694_100083409 Ga0070694_1000834092 282
560 3300005444 Ga0070694_100115976 Ga0070694_1001159762 282
561 3300005445 Ga0070708_100014830 Ga0070708_1000148302 282
562 3300005445 Ga0070708_100367196 Ga0070708_1003671961 282
563 3300005455 Ga0070663_100003100 Ga0070663_1000031004 282
564 3300005458 Ga0070681_10029698 Ga0070681_100296984 282
565 3300005459 Ga0068867_100004668 Ga0068867_1000046684 282
566 3300005467 Ga0070706_100031886 Ga0070706_1000318864 282
567 3300005468 Ga0070707_100024119 Ga0070707_1000241195 282
568 3300005518 Ga0070699_100125719 Ga0070699_1001257192 282
569 3300005539 Ga0068853_100002672 Ga0068853_1000026721 282
570 3300005545 Ga0070695_100000329 Ga0070695_10000032919 282
571 3300005545 Ga0070695_100000732 Ga0070695_10000073213 282
572 3300005546 Ga0070696_100046925 Ga0070696_1000469252 282
573 3300005547 Ga0070693_100001613 Ga0070693_1000016131 282
574 3300005547 Ga0070693_100060070 Ga0070693_1000600702 282
575 3300005549 Ga0070704_100002052 Ga0070704_1000020526 282
576 3300005549 Ga0070704_100035916 Ga0070704_1000359163 282
577 3300005549 Ga0070704_100204968 Ga0070704_1002049682 282
578 3300005614 Ga0068856_100016921 Ga0068856_1000169212 282
579 3300005719 Ga0068861_100084163 Ga0068861_1000841633 282
580 3300005719 Ga0068861_100328781 Ga0068861_1003287812 282
581 3300005834 Ga0068851_10146153 Ga0068851_101461532 282
582 3300005840 Ga0068870_10004961 Ga0068870_100049613 282
583 3300005841 Ga0068863_100035257 Ga0068863_1000352576 282
584 3300005841 Ga0068863_100064818 Ga0068863_1000648183 282
585 3300005843 Ga0068860_100002067 Ga0068860_1000020677 282
586 3300005843 Ga0068860_100095485 Ga0068860_1000954853 282
587 3300005843 Ga0068860_100235489 Ga0068860_1002354891 282
588 3300005844 Ga0068862_100020384 Ga0068862_1000203842 282
589 3300006175 Ga0070712_100025206 Ga0070712_1000252061 282
590 3300006852 Ga0075433_10003303 Ga0075433_100033038 282
591 3300006852 Ga0075433_10107238 Ga0075433_101072383 282
592 3300006871 Ga0075434_100057480 Ga0075434_1000574803 282
593 3300006914 Ga0075436_100009936 Ga0075436_1000099364 282
594 3300007076 Ga0075435_100016419 Ga0075435_1000164194 282
595 3300007076 Ga0075435_100100056 Ga0075435_1001000561 282
596 3300009147 Ga0114129_10008371 Ga0114129_100083719 282
597 3300009147 Ga0114129_10267349 Ga0114129_102673492 282
598 3300009147 Ga0114129_10356067 Ga0114129_103560672 282
599 3300009147 Ga0114129_10537803 Ga0114129_105378032 282
600 3300009174 Ga0105241_10007196 Ga0105241_100071965 282
601 3300009176 Ga0105242_10181364 Ga0105242_101813641 282
602 3300009551 Ga0105238_10099552 Ga0105238_100995523 282
603 3300010375 Ga0105239_10130851 Ga0105239_101308513 282
604 3300011119 Ga0105246_10005911 Ga0105246_100059116 282
605 3300013100 Ga0157373_10001034 Ga0157373_1000103413 282
606 3300013104 Ga0157370_10137899 Ga0157370_101378992 282
607 3300013105 Ga0157369_10005081 Ga0157369_1000508110 282
608 3300013297 Ga0157378_10151921 Ga0157378_101519211 282
609 3300013306 Ga0163162_10219085 Ga0163162_102190851 282
610 3300013307 Ga0157372_10005280 Ga0157372_1000528010 282
611 3300013308 Ga0157375_10036155 Ga0157375_100361552 282
612 3300025901 Ga0207688_10014656 Ga0207688_100146562 282
613 3300025907 Ga0207645_10001742 Ga0207645_100017427 282
614 3300025907 Ga0207645_10115844 Ga0207645_101158442 282
615 3300025908 Ga0207643_10001703 Ga0207643_100017033 282
616 3300025910 Ga0207684_10016628 Ga0207684_100166285 282
617 3300025911 Ga0207654_10004670 Ga0207654_100046706 282
618 3300025911 Ga0207654_10059722 Ga0207654_100597223 282
619 3300025912 Ga0207707_10001042 Ga0207707_1000104211 282
620 3300025915 Ga0207693_10004091 Ga0207693_100040917 282
621 3300025916 Ga0207663_10051045 Ga0207663_100510451 282
622 3300025917 Ga0207660_10001685 Ga0207660_1000168510 282
623 3300025917 Ga0207660_10232198 Ga0207660_102321981 282
624 3300025919 Ga0207657_10000799 Ga0207657_1000079912 282
625 3300025920 Ga0207649_10003347 Ga0207649_100033474 282
626 3300025921 Ga0207652_10002136 Ga0207652_100021367 282
627 3300025922 Ga0207646_10058131 Ga0207646_100581313 282
628 3300025932 Ga0207690_10006402 Ga0207690_100064022 282
629 3300025933 Ga0207706_10014475 Ga0207706_100144755 282
630 3300025934 Ga0207686_10076532 Ga0207686_100765322 282
631 3300025938 Ga0207704_10237351 Ga0207704_102373511 282
632 3300025942 Ga0207689_10000047 Ga0207689_1000004720 282
633 3300025942 Ga0207689_10000923 Ga0207689_100009236 282
634 3300025945 Ga0207679_10001010 Ga0207679_1000101010 282
635 3300025972 Ga0207668_10279671 Ga0207668_102796712 282
636 3300025981 Ga0207640_10009557 Ga0207640_100095574 282
637 3300026067 Ga0207678_10007208 Ga0207678_100072085 282
638 3300026088 Ga0207641_10331143 Ga0207641_103311431 282
639 3300026088 Ga0207641_10374227 Ga0207641_103742271 282
640 3300026089 Ga0207648_10004900 Ga0207648_100049008 282
641 3300026089 Ga0207648_10419845 Ga0207648_104198452 282
642 3300026116 Ga0207674_10005427 Ga0207674_100054274 282
643 3300026118 Ga0207675_100010761 Ga0207675_1000107615 282
644 3300026118 Ga0207675_100256486 Ga0207675_1002564862 282
645 3300026118 Ga0207675_100720189 Ga0207675_1007201892 282
646 3300027471 Ga0209995_1000436 Ga0209995_10004363 282
647 3300027543 Ga0209999_1023926 Ga0209999_10239261 282
648 3300027665 Ga0209983_1000724 Ga0209983_10007244 282
649 3300027682 Ga0209971_1000170 Ga0209971_10001707 282
650 3300027695 Ga0209966_1000209 Ga0209966_10002095 282
651 3300027717 Ga0209998_10000107 Ga0209998_1000010713 282
652 3300027876 Ga0209974_10000119 Ga0209974_1000011910 282
653 3300028380 Ga0268265_10049335 Ga0268265_100493353 282
654 3300028380 Ga0268265_10156951 Ga0268265_101569512 282
655 3300028381 Ga0268264_10012130 Ga0268264_100121305 282
656 3300028381 Ga0268264_10030727 Ga0268264_100307272 282
657 3300028381 Ga0268264_10363499 Ga0268264_103634991 282
658 3300035092 Ga0373952_0030911 Ga0373952_0030911_85_1023 282
659 3300035691 Ga0373931_0262723 Ga0373931_0262723_76_1014 282
660 3300037312 Ga0395899_0035516 Ga0395899_0035516_926_1849 282
661 3300037418 Ga0395900_0010745 Ga0395900_0010745_4419_5342 282
662 3300038443 Ga0395901_0131822 Ga0395901_0131822_176_1099 282
663 3300042000 Ga0439437_010764 Ga0439437_010764_35_913 282
664 3300042012 Ga0439455_0012273 Ga0439455_0012273_692_1630 282
665 3300042012 Ga0439455_0023173 Ga0439455_0023173_599_1477 282
666 3300042144 Ga0450889_006874 Ga0450889_006874_73_1011 282
667 3300042438 Ga0439459_0014251 Ga0439459_0014251_178_1116 282
668 3300042461 Ga0439460_0005448 Ga0439460_0005448_269_1147 282
669 3300044673 Ga0453683_0010129 Ga0453683_0010129_1391_2329 282
670 3300044673 Ga0453683_0099197 Ga0453683_0099197_134_1072 282
671 3300045051 Ga0451576_0012104 Ga0451576_0012104_6103_7038 282
672 3300045051 Ga0451576_0147686 Ga0451576_0147686_519_1457 282
673 3300045051 Ga0451576_0442136 Ga0451576_0442136_304_1227 282
674 3300046684 Ga0495669_0013996 Ga0495669_0013996_1852_2778 282
675 3300048905 Ga0496102_0014220 Ga0496102_0014220_5743_6681 282
676 3300048913 Ga0496110_0028366 Ga0496110_0028366_3599_4537 282
677 3300048915 Ga0496112_0459949 Ga0496112_0459949_214_1152 282
678 3300049568 Ga0501031_0073792 Ga0501031_0073792_1075_1956 282
679 3300049569 Ga0501032_0058901 Ga0501032_0058901_247_1128 282
680 3300049572 Ga0501036_0075560 Ga0501036_0075560_1203_2102 282
681 3300049573 Ga0501037_0052921 Ga0501037_0052921_1317_2198 282
682 3300049575 Ga0501039_0082936 Ga0501039_0082936_754_1635 282
683 3300049578 Ga0501042_0031591 Ga0501042_0031591_273_1172 282
684 3300049578 Ga0501042_0055911 Ga0501042_0055911_1171_2052 282
685 3300049579 Ga0501043_0193428 Ga0501043_0193428_636_1517 282
686 3300049580 Ga0501046_0000296 Ga0501046_0000296_30240_31121 282
687 3300049582 Ga0501048_0065692 Ga0501048_0065692_1661_2542 282
688 3300049588 Ga0501072_0078372 Ga0501072_0078372_1514_2413 282
689 3300049590 Ga0501074_0002114 Ga0501074_0002114_7203_8084 282
690 3300049591 Ga0501075_0037256 Ga0501075_0037256_1556_2455 282
691 3300049591 Ga0501075_0085548 Ga0501075_0085548_1139_2080 282
692 3300049591 Ga0501075_0236669 Ga0501075_0236669_261_1142 282
693 3300049592 Ga0501076_0022199 Ga0501076_0022199_2237_3118 282
694 3300049593 Ga0501077_0025963 Ga0501077_0025963_66_965 282
695 3300049593 Ga0501077_0200494 Ga0501077_0200494_145_1086 282
696 3300049741 Ga0501079_0000145 Ga0501079_0000145_2134_3015 282
697 3300049741 Ga0501079_0008767 Ga0501079_0008767_4126_5025 282
698 3300049741 Ga0501079_0055104 Ga0501079_0055104_1786_2727 282
699 3300049742 Ga0501080_0060265 Ga0501080_0060265_1463_2362 282
700 3300049743 Ga0501081_0006170 Ga0501081_0006170_5452_6351 282
701 3300049743 Ga0501081_0017169 Ga0501081_0017169_1206_2087 282
702 3300049743 Ga0501081_0126523 Ga0501081_0126523_746_1687 282
703 3300049824 Ga0501045_0000107 Ga0501045_0000107_18296_19177 282
704 3300049824 Ga0501045_0041849 Ga0501045_0041849_1467_2366 282
705 3300050507 nmdc:mga05p37_204837_c1 nmdc:mga05p37_204837_c1_1339_2262 282
706 3300050507 nmdc:mga05p37_29613_c1 nmdc:mga05p37_29613_c1_658_1599 282
707 3300050507 nmdc:mga05p37_32857_c1 nmdc:mga05p37_32857_c1_2573_3511 282
708 3300050507 nmdc:mga05p37_346929_c1 nmdc:mga05p37_346929_c1_85_942 282
709 3300050512 nmdc:mga0n895_45234_c1 nmdc:mga0n895_45234_c1_1564_2487 282
710 3300050513 nmdc:mga0rr50_50253_c1 nmdc:mga0rr50_50253_c1_76_1014 282
711 3300050515 nmdc:mga0a205_10599_c1 nmdc:mga0a205_10599_c1_1182_2120 282
712 3300050515 nmdc:mga0a205_152795_c1 nmdc:mga0a205_152795_c1_577_1491 282
713 3300054114 Ga0501084_0052787 Ga0501084_0052787_2416_3315 282
714 3300060353 Ga0501082_0000058 Ga0501082_0000058_33620_34501 282
715 3300060353 Ga0501082_0022117 Ga0501082_0022117_721_1620 282
716 3300061734 Ga0530510_0222977 Ga0530510_0222977_107_1048 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

143

328

0.97

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

55

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7722 74 269
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.75 68 269
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7462 79 205
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7407 68 263
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7154 68 263
ID Description Score Start End Superfamily
af_P0AEG1_88_295_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9244 62 270 1.10.3720.10
af_P0AEG1_88_295_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9202 62 270 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9113 65 270 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9097 63 270 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9056 63 270 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1F3AFX2-F1-model_v4 ABC transporter permease 0.9409 1 276 GO:0005886
GO:0055085
AF-A0A1W9IKS8-F1-model_v4 ABC transporter permease 0.9399 7 276 GO:0005886
GO:0055085
AF-A0A2V7BX52-F1-model_v4 ABC transporter permease 0.9396 7 278 GO:0005886
GO:0055085
AF-A8FBY1-F1-model_v4 Peptide ABC transporter permease 0.9393 13 274 GO:0005886
GO:0055085
AF-A0A6N6SX35-F1-model_v4 ABC transporter permease 0.9389 4 271 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
84.56 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map