F477014

General Info

Members Datasets Scaffolds Average Seq Length
715 419 604 259

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0260384|Ga0501046_0260384_282_1184
Length 300
Sequence MSAHGLARLCATVRTQDDGTHRRRTMASPEHDHEPVRTSAPDPVLDQDGVRLTVDDAIATVTLTNPAKRNAQSPALWRALTAAGRLLPGSVRVVQLRAEGKSFSAGLDRQAFTPEGFDGEPSFIDLARGADAELDAAVAEYQEAFTWWRRSDIVSVAAVQGHAIGAGFQLALACDLRVVADDAQFAMRETGLGLVPDLAGTHPLVGLVGYARALQICVTGRFVAAEEAVHTGLANLAVPREQLDATVADLTSAILAAPRSAVIETKALLQGAQGRSYEEQRAAERQAQARRLRDLAGLGE

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
6 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
7 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
8 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
9 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
10 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
11 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
12 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
13 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
14 2643221578 Streptomyces sp. Root63 Isolate Unclassified
15 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
16 2643221647 Streptomyces sp. Root369 Isolate Unclassified
17 2643221670 Streptomyces sp. Root431 Isolate Unclassified
18 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
19 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
20 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
21 2643221714 Streptomyces sp. Root264 Isolate Unclassified
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
27 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606448 Streptomyces sp. 193411 Isolate Unclassified
30 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
31 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
32 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
33 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
34 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
35 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
36 2858868258 Micromonospora sp. MH33 Isolate Unclassified
37 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
38 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
39 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
40 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
41 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
42 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
43 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
44 2862574272 Streptomyces sp. AcE210 Isolate Nodule
45 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
46 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
47 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
48 2867369537 Streptomyces sp. Z26 Isolate Unclassified
49 2867428634 Streptomyces sp. RP5T Isolate Unclassified
50 2867475112 Streptomyces sp. TM32 Isolate Unclassified
51 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
52 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
53 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
54 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
55 2902582711 Micromonospora sp. AP08 Isolate Unclassified
56 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
57 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
58 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
59 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
60 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
61 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
62 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
63 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
64 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
65 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
66 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
67 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
68 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
69 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
70 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
71 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
72 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
73 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
74 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
75 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
76 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
77 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
78 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
79 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
80 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
81 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
82 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
83 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
84 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
85 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
86 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
87 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
88 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
89 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
90 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
91 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
92 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
93 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
94 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
95 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
99 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
100 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
105 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
106 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
154 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
155 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
239 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
240 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
241 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
242 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
243 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
244 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
380 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
381 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
388 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
389 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
390 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
391 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
392 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
398 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
399 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
400 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
401 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
402 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
403 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
404 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
405 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
406 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
407 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
408 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
409 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
410 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
411 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
412 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
413 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
414 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
415 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
416 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
417 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
418 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
419 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.52
Metatranscriptomes 1.96
Isolates 15.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.84
Rhizoplane 2.24
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002243 3300001989 Bacteria 7429
2 JGI24735J21928_10019146 3300002067 Bacteria 2105
3 JGI24735J21928_10020594 3300002067 Bacteria 2019
4 rootH1_10040607 3300003316 Bacteria 5372
5 rootL2_10026369 3300003322 Bacteria 4525
6 rootH1_10042801 3300003323 Bacteria 4898
7 rootH1_10051479 3300003323 Bacteria 5611
8 JGI25160J50197_1005533 3300003354 Bacteria 5243
9 Ga0070658_10000119 3300005327 Bacteria 71128
10 Ga0070658_10067691 3300005327 Bacteria 2918
11 Ga0070658_10154233 3300005327 Bacteria 1925
12 Ga0070658_10364508 3300005327 Bacteria 1238
13 Ga0070683_100163068 3300005329 Bacteria 2115
14 Ga0068869_100122383 3300005334 Bacteria 1991
15 Ga0070680_100011790 3300005336 Bacteria 6779
16 Ga0070680_100017571 3300005336 Bacteria 5642
17 Ga0070692_10044010 3300005345 Bacteria 2298
18 Ga0070671_100286970 3300005355 Bacteria 1400
19 Ga0070673_100191516 3300005364 Bacteria 1757
20 Ga0070659_100000362 3300005366 Bacteria 34592
21 Ga0070709_10037259 3300005434 Bacteria 2969
22 Ga0070709_10083032 3300005434 Bacteria 2095
23 Ga0070714_100457753 3300005435 Bacteria 1212
24 Ga0070713_100008754 3300005436 Bacteria 7201
25 Ga0070663_100284716 3300005455 Bacteria 1318
26 Ga0070681_10320784 3300005458 Bacteria 1459
27 Ga0070685_10251434 3300005466 Bacteria 1171
28 Ga0070679_100092767 3300005530 Bacteria 3007
29 Ga0070679_100366819 3300005530 Bacteria 1387
30 Ga0070684_100150005 3300005535 Bacteria 2111
31 Ga0070684_100157725 3300005535 Bacteria 2058
32 Ga0068853_100037542 3300005539 Bacteria 4122
33 Ga0068853_100045056 3300005539 Bacteria 3778
34 Ga0070665_100066681 3300005548 Bacteria 3610
35 Ga0068855_100012299 3300005563 Bacteria 10341
36 Ga0068855_100454258 3300005563 Bacteria 1397
37 Ga0068854_100064116 3300005578 Bacteria 2669
38 Ga0068852_100157836 3300005616 Bacteria 2115
39 Ga0068859_100059737 3300005617 Bacteria 3841
40 Ga0068870_10001458 3300005840 Bacteria 9574
41 Ga0068870_10191954 3300005840 Bacteria 1233
42 Ga0081540_1001328 3300005983 Bacteria 21591
43 Ga0081540_1005111 3300005983 Bacteria 9842
44 Ga0070717_10298340 3300006028 Bacteria 1432
45 Ga0075365_10163336 3300006038 Bacteria 1552
46 Ga0075368_10001944 3300006042 Bacteria 6655
47 Ga0075363_100027879 3300006048 Bacteria 2900
48 Ga0070716_100091100 3300006173 Bacteria 1846
49 Ga0075367_10013085 3300006178 Bacteria 4446
50 Ga0075428_100013985 3300006844 Bacteria 8934
51 Ga0075430_100001131 3300006846 Bacteria 21253
52 Ga0075431_100037399 3300006847 Bacteria 5001
53 Ga0075429_100003197 3300006880 Bacteria 13930
54 Ga0097620_100059737 3300006931 Bacteria 3841
55 Ga0099826_10052161 3300006948 Bacteria 2735
56 Ga0105251_10032904 3300009011 Bacteria 2579
57 Ga0105244_10128650 3300009036 Bacteria 1223
58 Ga0105250_10030904 3300009092 Bacteria 2152
59 Ga0105240_10058110 3300009093 Bacteria 4829
60 Ga0105245_10281268 3300009098 Bacteria 1626
61 Ga0114129_10026919 3300009147 Bacteria 8140
62 Ga0114129_10214171 3300009147 Bacteria 2602
63 Ga0105241_10005515 3300009174 Bacteria 9349
64 Ga0105248_10363585 3300009177 Bacteria 1629
65 Ga0105237_10123767 3300009545 Bacteria 2580
66 Ga0105237_10196552 3300009545 Bacteria 2017
67 Ga0105238_10009385 3300009551 Bacteria 9792
68 Ga0105238_10644227 3300009551 Bacteria 1069
69 Ga0105249_10070800 3300009553 Bacteria 3220
70 Ga0105239_10066106 3300010375 Bacteria 3972
71 Ga0105246_10024357 3300011119 Bacteria 3931
72 Ga0105246_10156675 3300011119 Bacteria 1730
73 Ga0157371_10198127 3300013102 Bacteria 1439
74 Ga0157369_10000797 3300013105 Bacteria 40264
75 Ga0157369_10001259 3300013105 Bacteria 31492
76 Ga0157369_10134630 3300013105 Bacteria 2617
77 Ga0157369_10200329 3300013105 Bacteria 2096
78 Ga0157369_10215827 3300013105 Bacteria 2009
79 Ga0157369_10490256 3300013105 Bacteria 1272
80 Ga0157378_10238951 3300013297 Bacteria 1735
81 Ga0157372_10168322 3300013307 Bacteria 2535
82 Ga0157372_10256350 3300013307 Bacteria 2031
83 Ga0157372_10308935 3300013307 Bacteria 1840
84 Ga0157375_10761319 3300013308 Bacteria 1119
85 Ga0157380_10072340 3300014326 Bacteria 2792
86 Ga0182008_10006694 3300014497 Bacteria 6415
87 Ga0157376_10083823 3300014969 Bacteria 2743
88 Ga0182007_10002052 3300015262 Bacteria 10343
89 Ga0183367_1007 3300015688 Bacteria 498079
90 Ga0197907_10194450 3300020069 Bacteria 1138
91 Ga0197907_11404546 3300020069 Bacteria 2956
92 Ga0206356_11157171 3300020070 Bacteria 985
93 Ga0206356_11557667 3300020070 Bacteria 1124
94 Ga0206356_11754385 3300020070 Bacteria 989
95 Ga0206352_10458276 3300020078 Bacteria 1103
96 Ga0206350_10992698 3300020080 Bacteria 1789
97 Ga0206354_10608928 3300020081 Bacteria 2289
98 Ga0206353_10245330 3300020082 Bacteria 2282
99 Ga0224712_10012653 3300022467 Bacteria 2661
100 Ga0224712_10017830 3300022467 Bacteria 2361
101 Ga0224712_10141230 3300022467 Bacteria 1060
102 Ga0224712_10141777 3300022467 Bacteria 1058
103 Ga0209758_1009625 3300025297 Bacteria 5960
104 Ga0207426_1001708 3300025302 Bacteria 16860
105 Ga0207426_1002372 3300025302 Bacteria 12199
106 Ga0207713_1022981 3300025735 Bacteria 2946
107 Ga0207647_10001793 3300025904 Bacteria 16439
108 Ga0207647_10008441 3300025904 Bacteria 7388
109 Ga0207647_10019779 3300025904 Bacteria 4522
110 Ga0207647_10130559 3300025904 Bacteria 1477
111 Ga0207699_10051951 3300025906 Bacteria 2424
112 Ga0207643_10000642 3300025908 Bacteria 21849
113 Ga0207705_10002817 3300025909 Bacteria 13293
114 Ga0207705_10024594 3300025909 Bacteria 4297
115 Ga0207705_10157882 3300025909 Bacteria 1702
116 Ga0207695_10001103 3300025913 Bacteria 46908
117 Ga0207695_10456643 3300025913 Bacteria 1161
118 Ga0207671_10000389 3300025914 Bacteria 61710
119 Ga0207660_10014899 3300025917 Bacteria 5125
120 Ga0207660_10185982 3300025917 Bacteria 1616
121 Ga0207657_10015561 3300025919 Bacteria 7365
122 Ga0207657_10107522 3300025919 Bacteria 2307
123 Ga0207649_10149166 3300025920 Bacteria 1609
124 Ga0207652_10073273 3300025921 Bacteria 2979
125 Ga0207652_10129549 3300025921 Bacteria 2249
126 Ga0207694_10000549 3300025924 Bacteria 34007
127 Ga0207700_10004997 3300025928 Bacteria 7884
128 Ga0207664_10041633 3300025929 Bacteria 3580
129 Ga0207690_10003378 3300025932 Bacteria 9539
130 Ga0207690_10012941 3300025932 Bacteria 5000
131 Ga0207690_10156077 3300025932 Bacteria 1696
132 Ga0207691_10112322 3300025940 Bacteria 2422
133 Ga0207689_10117215 3300025942 Bacteria 2189
134 Ga0207661_10025764 3300025944 Bacteria 4475
135 Ga0207661_10097167 3300025944 Bacteria 2466
136 Ga0207661_10686343 3300025944 Bacteria 942
137 Ga0207667_10078377 3300025949 Bacteria 3424
138 Ga0207667_10332896 3300025949 Bacteria 1550
139 Ga0207703_10546639 3300026035 Bacteria 1092
140 Ga0207639_10061430 3300026041 Bacteria 2902
141 Ga0207678_10050866 3300026067 Bacteria 3579
142 Ga0207678_10053356 3300026067 Bacteria 3484
143 Ga0207702_10033501 3300026078 Bacteria 4291
144 Ga0207702_10347367 3300026078 Bacteria 1418
145 Ga0207641_10284676 3300026088 Bacteria 1556
146 Ga0207698_10016593 3300026142 Bacteria 4970
147 Ga0207698_10292764 3300026142 Bacteria 1512
148 Ga0209371_1007004 3300027312 Bacteria 4030
149 Ga0209813_10003133 3300027866 Bacteria 3844
150 Ga0268266_10164251 3300028379 Bacteria 2010
151 Ga0307517_10084604 3300028786 Bacteria 2668
152 Ga0307515_10001938 3300028794 Bacteria 45899
153 Ga0307515_10033218 3300028794 Bacteria 8505
154 Ga0307515_10188196 3300028794 Bacteria 1985
155 Ga0268256_1006497 3300030500 Bacteria 4335
156 Ga0307511_10003550 3300030521 Bacteria 16000
157 Ga0307511_10180594 3300030521 Bacteria 1138
158 Ga0307512_10060873 3300030522 Bacteria 2914
159 Ga0307513_10018658 3300031456 Bacteria 8284
160 Ga0307513_10044671 3300031456 Bacteria 4851
161 Ga0307513_10054304 3300031456 Bacteria 4297
162 Ga0307513_10157480 3300031456 Bacteria 2169
163 Ga0307513_10454171 3300031456 Bacteria 1005
164 Ga0307509_10018531 3300031507 Bacteria 7979
165 Ga0307408_100119461 3300031548 Bacteria 2040
166 Ga0307508_10049368 3300031616 Bacteria 3748
167 Ga0307508_10165784 3300031616 Bacteria 1812
168 Ga0307514_10034295 3300031649 Bacteria 4045
169 Ga0307514_10102841 3300031649 Bacteria 2047
170 Ga0307514_10158100 3300031649 Bacteria 1506
171 Ga0307514_10229729 3300031649 Bacteria 1126
172 Ga0316576_10003510 3300031727 Bacteria 9210
173 Ga0307516_10004291 3300031730 Bacteria 17697
174 Ga0307516_10208241 3300031730 Bacteria 1671
175 Ga0307405_10014517 3300031731 Bacteria 4238
176 Ga0307405_10356312 3300031731 Bacteria 1130
177 Ga0307413_10298328 3300031824 Bacteria 1221
178 Ga0307410_10031789 3300031852 Bacteria 3391
179 Ga0307410_10032066 3300031852 Bacteria 3377
180 Ga0307410_10089745 3300031852 Bacteria 2178
181 Ga0307406_10194509 3300031901 Bacteria 1488
182 Ga0307406_10548398 3300031901 Bacteria 945
183 Ga0307407_10035351 3300031903 Bacteria 2744
184 Ga0307407_10101498 3300031903 Bacteria 1787
185 Ga0307407_10233344 3300031903 Bacteria 1251
186 Ga0307412_10284096 3300031911 Bacteria 1300
187 Ga0307409_100013836 3300031995 Bacteria 5216
188 Ga0307409_100028034 3300031995 Bacteria 4004
189 Ga0307409_100078736 3300031995 Bacteria 2653
190 Ga0307409_100082463 3300031995 Bacteria 2603
191 Ga0307409_100170756 3300031995 Bacteria 1914
192 Ga0307409_100180311 3300031995 Bacteria 1869
193 Ga0307409_100181099 3300031995 Bacteria 1865
194 Ga0307409_100210291 3300031995 Bacteria 1748
195 Ga0307416_100026483 3300032002 Bacteria 4274
196 Ga0307416_100052841 3300032002 Bacteria 3255
197 Ga0307416_100114809 3300032002 Bacteria 2383
198 Ga0307416_100133476 3300032002 Bacteria 2240
199 Ga0307414_10046683 3300032004 Bacteria 2975
200 Ga0307414_10088751 3300032004 Bacteria 2289
201 Ga0307414_10120395 3300032004 Bacteria 2017
202 Ga0307411_10178979 3300032005 Bacteria 1607
203 Ga0307411_10252921 3300032005 Bacteria 1386
204 Ga0307415_100006290 3300032126 Bacteria 6384
205 Ga0307415_100052350 3300032126 Bacteria 2776
206 Ga0307415_100085707 3300032126 Bacteria 2264
207 Ga0307415_100166149 3300032126 Bacteria 1716
208 Ga0307415_100193515 3300032126 Bacteria 1607
209 Ga0307415_100345676 3300032126 Bacteria 1250
210 Ga0316585_10017413 3300032137 Bacteria 2172
211 Ga0316585_10019269 3300032137 Bacteria 2079
212 Ga0307507_10049533 3300033179 Bacteria 4069
213 Ga0307507_10119453 3300033179 Bacteria 2115
214 Ga0307510_10051295 3300033180 Bacteria 4364
215 Ga0307510_10067663 3300033180 Bacteria 3593
216 Ga0307510_10073100 3300033180 Bacteria 3400
217 Ga0307510_10233274 3300033180 Bacteria 1341
218 Ga0373951_0000211 3300035091 Bacteria 20847
219 Ga0373954_0039353 3300035118 Bacteria 2201
220 Ga0316574_0024247 3300035398 Bacteria 3629
221 Ga0316574_0026269 3300035398 Bacteria 3500
222 Ga0316584_0027632 3300036712 Bacteria 4177
223 Ga0395899_0110433 3300037312 Bacteria 1978
224 Ga0395899_0200255 3300037312 Bacteria 1393
225 Ga0395900_0055090 3300037418 Bacteria 4094
226 Ga0395898_0003059 3300037466 Bacteria 18948
227 Ga0395898_0015951 3300037466 Bacteria 7698
228 Ga0395905_0139086 3300037471 Bacteria 2285
229 Ga0316581_0000691 3300037588 Bacteria 6864
230 Ga0436364_0586317 3300037853 Bacteria 24910
231 Ga0395901_0093166 3300038443 Bacteria 3154
232 Ga0395901_0103238 3300038443 Bacteria 2991
233 Ga0395901_0440555 3300038443 Bacteria 1334
234 Ga0436363_1668436 3300039450 Bacteria 1668
235 Ga0439436_0000389 3300041404 Bacteria 10964
236 Ga0439436_0025102 3300041404 Bacteria 1753
237 Ga0439439_0009805 3300041406 Bacteria 2284
238 Ga0451837_1623308 3300041494 Bacteria 2521
239 Ga0451853_0695299 3300041512 Bacteria 1441
240 Ga0451853_1849776 3300041512 Bacteria 2270
241 Ga0451853_1912804 3300041512 Bacteria 3257
242 Ga0439433_0000389 3300041999 Bacteria 7892
243 Ga0439448_0079160 3300042005 Bacteria 1102
244 Ga0439432_062307 3300042006 Bacteria 1148
245 Ga0439449_0000989 3300042007 Bacteria 11165
246 Ga0439457_000487 3300042014 Bacteria 11471
247 Ga0439457_002703 3300042014 Bacteria 4993
248 Ga0439457_017355 3300042014 Bacteria 1598
249 Ga0450894_000118 3300042131 Bacteria 13523
250 Ga0450896_001022 3300042133 Bacteria 3270
251 Ga0450898_001468 3300042134 Bacteria 3112
252 Ga0450906_004237 3300042145 Bacteria 3018
253 Ga0439458_0003052 3300042157 Bacteria 3990
254 Ga0466969_0001961 3300044656 Bacteria 11000
255 Ga0466969_0003315 3300044656 Bacteria 8564
256 Ga0466969_0029153 3300044656 Bacteria 2820
257 Ga0466969_0085596 3300044656 Bacteria 1498
258 Ga0466972_0006482 3300044658 Bacteria 5877
259 Ga0466972_0024209 3300044658 Bacteria 3013
260 Ga0466972_0085269 3300044658 Bacteria 1501
261 Ga0466972_0097482 3300044658 Bacteria 1392
262 Ga0466965_0013412 3300044683 Bacteria 3867
263 Ga0466965_0057981 3300044683 Bacteria 1931
264 Ga0466965_0112909 3300044683 Bacteria 1398
265 Ga0466966_0000938 3300044684 Bacteria 18615
266 Ga0466966_0018211 3300044684 Bacteria 4634
267 Ga0466966_0019368 3300044684 Bacteria 4477
268 Ga0466966_0119600 3300044684 Bacteria 1619
269 Ga0466961_0000931 3300044693 Bacteria 18166
270 Ga0466961_0003176 3300044693 Bacteria 10229
271 Ga0466961_0013288 3300044693 Bacteria 5269
272 Ga0466961_0023414 3300044693 Bacteria 3974
273 Ga0466961_0113162 3300044693 Bacteria 1706
274 Ga0466961_0355004 3300044693 Bacteria 892
275 Ga0466963_0000235 3300044694 Bacteria 23900
276 Ga0466963_0000589 3300044694 Bacteria 17310
277 Ga0466963_0197104 3300044694 Unclassified 1408
278 Ga0466964_0037189 3300044706 Bacteria 1954
279 Ga0466971_0000129 3300044719 Bacteria 27584
280 Ga0466971_0000182 3300044719 Bacteria 23765
281 Ga0466970_0000333 3300044765 Bacteria 23058
282 Ga0466970_0001880 3300044765 Bacteria 10156
283 Ga0466970_0081512 3300044765 Bacteria 1749
284 Ga0466970_0194658 3300044765 Bacteria 1127
285 Ga0466957_0012768 3300044842 Bacteria 4867
286 Ga0466957_0244560 3300044842 Bacteria 1191
287 Ga0466960_0003073 3300044901 Bacteria 6380
288 Ga0466960_0019918 3300044901 Bacteria 2964
289 Ga0466959_0002069 3300045049 Bacteria 12688
290 Ga0466959_0021527 3300045049 Bacteria 4756
291 Ga0466959_0045828 3300045049 Bacteria 3219
292 Ga0466959_0132432 3300045049 Bacteria 1766
293 Ga0466959_0235795 3300045049 Bacteria 1265
294 Ga0466959_0256308 3300045049 Bacteria 1205
295 Ga0466958_0040184 3300045836 Bacteria 2811
296 Ga0466958_0092900 3300045836 Bacteria 1868
297 Ga0466958_0142156 3300045836 Bacteria 1511
298 Ga0466958_0209196 3300045836 Bacteria 1242
299 Ga0466967_0018743 3300045976 Bacteria 5542
300 Ga0466967_0022099 3300045976 Bacteria 5183
301 Ga0466967_0099938 3300045976 Bacteria 2650
302 Ga0466967_0144214 3300045976 Bacteria 2220
303 Ga0466967_0577177 3300045976 Bacteria 1108
304 Ga0495617_019949 3300046452 Bacteria 2265
305 Ga0495627_011288 3300046453 Bacteria 3210
306 Ga0495603_0000346 3300046455 Bacteria 24860
307 Ga0495603_0001138 3300046455 Bacteria 15534
308 Ga0495603_0025888 3300046455 Bacteria 3546
309 Ga0495603_0086739 3300046455 Bacteria 1832
310 Ga0495590_0108040 3300046457 Bacteria 991
311 Ga0495629_0004470 3300046459 Bacteria 10480
312 Ga0495629_0033791 3300046459 Bacteria 3616
313 Ga0495629_0139175 3300046459 Bacteria 1689
314 Ga0495629_0292823 3300046459 Bacteria 1115
315 Ga0495638_0132150 3300046460 Bacteria 1465
316 Ga0495651_0000439 3300046462 Bacteria 32028
317 Ga0495651_0002038 3300046462 Bacteria 15612
318 Ga0495651_0011488 3300046462 Bacteria 6799
319 Ga0495651_0138717 3300046462 Bacteria 1766
320 Ga0495651_0164587 3300046462 Bacteria 1585
321 Ga0495653_0003878 3300046463 Bacteria 12087
322 Ga0495653_0142906 3300046463 Bacteria 1681
323 Ga0495580_0043463 3300046472 Bacteria 3198
324 Ga0495582_0239317 3300046473 Bacteria 1040
325 Ga0495605_0007393 3300046474 Bacteria 6236
326 Ga0495662_0006099 3300046476 Bacteria 6024
327 Ga0495662_0029742 3300046476 Bacteria 2636
328 Ga0495662_0133567 3300046476 Bacteria 1220
329 Ga0495664_0003683 3300046477 Bacteria 8351
330 Ga0495664_0027249 3300046477 Bacteria 3330
331 Ga0495664_0138831 3300046477 Bacteria 1473
332 Ga0495585_0041446 3300046492 Bacteria 2582
333 Ga0495585_0109717 3300046492 Bacteria 1468
334 Ga0495585_0124801 3300046492 Bacteria 1359
335 Ga0495594_0023051 3300046499 Bacteria 3334
336 Ga0495596_0126585 3300046500 Bacteria 992
337 Ga0495607_0041936 3300046501 Bacteria 2715
338 Ga0495607_0118011 3300046501 Bacteria 1397
339 Ga0495583_0012198 3300046506 Bacteria 4879
340 Ga0495583_0072072 3300046506 Bacteria 1516
341 Ga0495583_0154112 3300046506 Bacteria 951
342 Ga0495606_0009840 3300046507 Bacteria 8022
343 Ga0495608_0007650 3300046511 Bacteria 7616
344 Ga0495618_0013838 3300046514 Bacteria 4910
345 Ga0495618_0019166 3300046514 Bacteria 4207
346 Ga0495620_0006186 3300046515 Bacteria 6594
347 Ga0495620_0007325 3300046515 Bacteria 6004
348 Ga0495628_0110958 3300046516 Bacteria 2109
349 Ga0495628_0372912 3300046516 Bacteria 1046
350 Ga0495630_0274611 3300046517 Bacteria 1287
351 Ga0495631_0008128 3300046518 Bacteria 5297
352 Ga0495632_0090721 3300046519 Bacteria 1449
353 Ga0495643_0006578 3300046522 Bacteria 7642
354 Ga0495648_0062861 3300046524 Bacteria 2196
355 Ga0495666_0000038 3300046526 Bacteria 49268
356 Ga0495666_0023752 3300046526 Bacteria 3031
357 Ga0495652_0000641 3300046529 Bacteria 40645
358 Ga0495652_0001811 3300046529 Bacteria 22721
359 Ga0495652_0018707 3300046529 Bacteria 6174
360 Ga0495652_0073859 3300046529 Bacteria 2838
361 Ga0495652_0154085 3300046529 Bacteria 1791
362 Ga0495665_0000846 3300046531 Bacteria 16034
363 Ga0495640_0000604 3300046533 Bacteria 26433
364 Ga0495640_0012019 3300046533 Bacteria 6635
365 Ga0495640_0042414 3300046533 Bacteria 3175
366 Ga0495640_0195634 3300046533 Bacteria 1284
367 Ga0495586_0008446 3300046535 Bacteria 5480
368 Ga0495586_0060304 3300046535 Bacteria 2063
369 Ga0495587_0026773 3300046536 Bacteria 3512
370 Ga0495587_0163115 3300046536 Bacteria 1268
371 Ga0495597_0026787 3300046542 Bacteria 2647
372 Ga0495645_0007791 3300046543 Bacteria 7449
373 Ga0495645_0015660 3300046543 Bacteria 5394
374 Ga0495645_0201940 3300046543 Bacteria 1348
375 Ga0495667_0005401 3300046559 Bacteria 8644
376 Ga0495667_0020998 3300046559 Bacteria 4405
377 Ga0495667_0272240 3300046559 Bacteria 1076
378 Ga0495668_0050625 3300046616 Bacteria 2301
379 Ga0495634_0000101 3300046642 Bacteria 70643
380 Ga0495634_0038825 3300046642 Bacteria 3244
381 Ga0495611_0014769 3300046648 Bacteria 3338
382 Ga0495625_0003505 3300046660 Bacteria 15553
383 Ga0495625_0076350 3300046660 Bacteria 2342
384 Ga0495635_0010250 3300046663 Bacteria 6552
385 Ga0495635_0035280 3300046663 Bacteria 3467
386 Ga0495635_0047456 3300046663 Bacteria 2962
387 Ga0495635_0190819 3300046663 Bacteria 1391
388 Ga0495661_0011434 3300046665 Bacteria 6025
389 Ga0495661_0112189 3300046665 Bacteria 1518
390 Ga0495588_0004893 3300046674 Bacteria 5940
391 Ga0495588_0006042 3300046674 Bacteria 5432
392 Ga0495588_0058055 3300046674 Bacteria 2000
393 Ga0495657_0007395 3300046675 Bacteria 8488
394 Ga0495657_0026616 3300046675 Bacteria 4094
395 Ga0495623_0012861 3300046679 Bacteria 5421
396 Ga0495623_0037985 3300046679 Bacteria 3079
397 Ga0495646_0002319 3300046680 Bacteria 11651
398 Ga0495646_0020503 3300046680 Bacteria 4182
399 Ga0495658_0031545 3300046683 Bacteria 2887
400 Ga0495613_0000709 3300046689 Bacteria 26118
401 Ga0495613_0005664 3300046689 Bacteria 9359
402 Ga0495613_0022738 3300046689 Bacteria 4671
403 Ga0495613_0226624 3300046689 Bacteria 1310
404 Ga0495624_0184081 3300046690 Bacteria 1272
405 Ga0495671_0015852 3300046692 Bacteria 4033
406 Ga0495649_0039674 3300046694 Bacteria 2581
407 Ga0495589_0003707 3300046794 Bacteria 8239
408 Ga0495589_0018742 3300046794 Bacteria 3547
409 Ga0495589_0134409 3300046794 Bacteria 1186
410 Ga0495589_0197374 3300046794 Bacteria 950
411 Ga0495600_0012847 3300046809 Bacteria 5245
412 Ga0495600_0019339 3300046809 Bacteria 4349
413 Ga0495600_0028378 3300046809 Bacteria 3620
414 Ga0495660_0047520 3300046810 Bacteria 2349
415 Ga0495581_0001118 3300047315 Bacteria 14677
416 Ga0495581_0029662 3300047315 Bacteria 3170
417 Ga0495581_0093113 3300047315 Bacteria 1749
418 Ga0495581_0124239 3300047315 Bacteria 1502
419 Ga0495604_0000157 3300047317 Bacteria 59668
420 Ga0495604_0001183 3300047317 Bacteria 21530
421 Ga0495604_0270179 3300047317 Bacteria 1152
422 Ga0495636_0002685 3300047318 Bacteria 6870
423 Ga0495636_0006916 3300047318 Bacteria 4461
424 Ga0495636_0149393 3300047318 Bacteria 1047
425 Ga0495674_0130790 3300047319 Unclassified 2115
426 Ga0495676_0012848 3300047321 Bacteria 7529
427 Ga0495676_0015066 3300047321 Bacteria 6902
428 Ga0495676_0025899 3300047321 Bacteria 5055
429 Ga0495676_0028506 3300047321 Bacteria 4765
430 Ga0495676_0072169 3300047321 Bacteria 2651
431 Ga0495676_0072316 3300047321 Bacteria 2648
432 Ga0495680_0046786 3300047322 Bacteria 3408
433 Ga0495687_000830 3300047443 Bacteria 33048
434 Ga0495687_095925 3300047443 Bacteria 1123
435 Ga0495675_0033019 3300047444 Bacteria 3303
436 Ga0495675_0080595 3300047444 Bacteria 2050
437 Ga0495675_0204873 3300047444 Bacteria 1199
438 Ga0495677_0120826 3300047445 Bacteria 999
439 Ga0495685_066434 3300047447 Bacteria 1211
440 Ga0495685_082174 3300047447 Bacteria 1073
441 Ga0495685_088917 3300047447 Bacteria 1025
442 Ga0495681_0004221 3300047470 Bacteria 9856
443 Ga0495681_0031125 3300047470 Bacteria 2707
444 Ga0495681_0109039 3300047470 Bacteria 1201
445 Ga0495684_0029675 3300047471 Bacteria 4196
446 Ga0495686_0046841 3300047472 Bacteria 2732
447 Ga0495593_0025313 3300047673 Bacteria 3285
448 Ga0495593_0080220 3300047673 Bacteria 1688
449 Ga0495602_0071117 3300048088 Bacteria 2973
450 Ga0495614_0001144 3300048089 Bacteria 11371
451 Ga0495614_0046450 3300048089 Bacteria 1861
452 Ga0495626_0129889 3300048091 Bacteria 1076
453 Ga0496101_0533306 3300048904 Bacteria 928
454 Ga0496102_0000164 3300048905 Bacteria 89355
455 Ga0496103_0001561 3300048906 Bacteria 15145
456 Ga0496104_0109526 3300048907 Bacteria 2647
457 Ga0496104_0140269 3300048907 Bacteria 2322
458 Ga0496106_0098428 3300048909 Bacteria 2266
459 Ga0496108_0124877 3300048911 Bacteria 2209
460 Ga0496108_0293992 3300048911 Bacteria 1414
461 Ga0496109_0155240 3300048912 Bacteria 2144
462 Ga0496109_0157242 3300048912 Bacteria 2129
463 Ga0496113_0068423 3300048916 Bacteria 2694
464 Ga0496114_0003598 3300048917 Bacteria 11908
465 Ga0496114_0242156 3300048917 Bacteria 1586
466 Ga0496114_0408633 3300048917 Bacteria 1202
467 Ga0496115_0221633 3300048918 Bacteria 1561
468 Ga0496118_0008577 3300048921 Bacteria 10521
469 Ga0496126_0000006 3300048929 Bacteria 798804
470 Ga0501308_008026 3300049128 Bacteria 1120
471 Ga0501031_0033051 3300049568 Bacteria 3373
472 Ga0501031_0196399 3300049568 Bacteria 1317
473 Ga0501032_0005828 3300049569 Bacteria 9112
474 Ga0501032_0029582 3300049569 Bacteria 3758
475 Ga0501032_0035790 3300049569 Bacteria 3392
476 Ga0501033_0001964 3300049570 Bacteria 17900
477 Ga0501033_0008400 3300049570 Bacteria 7998
478 Ga0501033_0103465 3300049570 Bacteria 2076
479 Ga0501033_0267635 3300049570 Bacteria 1208
480 Ga0501033_0317098 3300049570 Bacteria 1095
481 Ga0501034_0004159 3300049571 Bacteria 16188
482 Ga0501034_0011223 3300049571 Bacteria 9304
483 Ga0501034_0027632 3300049571 Bacteria 5770
484 Ga0501034_0028951 3300049571 Bacteria 5633
485 Ga0501034_0185864 3300049571 Bacteria 2041
486 Ga0501034_0486015 3300049571 Bacteria 1150
487 Ga0501036_0002938 3300049572 Bacteria 13533
488 Ga0501036_0026454 3300049572 Bacteria 4897
489 Ga0501036_0124736 3300049572 Bacteria 2174
490 Ga0501036_0173465 3300049572 Bacteria 1816
491 Ga0501036_0214853 3300049572 Bacteria 1615
492 Ga0501037_0004856 3300049573 Bacteria 9780
493 Ga0501037_0005983 3300049573 Bacteria 8887
494 Ga0501037_0264859 3300049573 Bacteria 1200
495 Ga0501037_0274650 3300049573 Bacteria 1175
496 Ga0501037_0423079 3300049573 Bacteria 911
497 Ga0501038_0016566 3300049574 Bacteria 6682
498 Ga0501038_0037839 3300049574 Bacteria 4228
499 Ga0501038_0048752 3300049574 Bacteria 3664
500 Ga0501039_0011139 3300049575 Bacteria 6853
501 Ga0501039_0018223 3300049575 Bacteria 5389
502 Ga0501039_0107064 3300049575 Bacteria 2184
503 Ga0501039_0144004 3300049575 Bacteria 1872
504 Ga0501039_0154811 3300049575 Bacteria 1801
505 Ga0501039_0247627 3300049575 Bacteria 1401
506 Ga0501040_0009695 3300049576 Bacteria 6288
507 Ga0501040_0012035 3300049576 Bacteria 5661
508 Ga0501040_0148045 3300049576 Bacteria 1656
509 Ga0501041_0000342 3300049577 Bacteria 22862
510 Ga0501042_0082943 3300049578 Bacteria 2298
511 Ga0501042_0483732 3300049578 Bacteria 898
512 Ga0501043_0001119 3300049579 Bacteria 23527
513 Ga0501043_0002270 3300049579 Bacteria 16350
514 Ga0501043_0012175 3300049579 Bacteria 6723
515 Ga0501043_0395965 3300049579 Bacteria 1044
516 Ga0501046_0015939 3300049580 Bacteria 6302
517 Ga0501046_0017948 3300049580 Bacteria 5897
518 Ga0501046_0199432 3300049580 Bacteria 1489
519 Ga0501046_0260384 3300049580 Bacteria 1274
520 Ga0501047_0000055 3300049581 Bacteria 144149
521 Ga0501047_0002325 3300049581 Bacteria 18159
522 Ga0501047_0025359 3300049581 Bacteria 5698
523 Ga0501047_0108182 3300049581 Bacteria 2662
524 Ga0501047_0125811 3300049581 Bacteria 2443
525 Ga0501047_0208539 3300049581 Bacteria 1813
526 Ga0501048_0009621 3300049582 Bacteria 7252
527 Ga0501048_0009686 3300049582 Bacteria 7228
528 Ga0501067_0007213 3300049583 Bacteria 6175
529 Ga0501068_0001227 3300049584 Bacteria 13610
530 Ga0501069_0266565 3300049585 Bacteria 1000
531 Ga0501070_0015698 3300049586 Bacteria 6367
532 Ga0501070_0039469 3300049586 Bacteria 3938
533 Ga0501070_0135970 3300049586 Bacteria 2029
534 Ga0501070_0272429 3300049586 Bacteria 1382
535 Ga0501071_0010072 3300049587 Bacteria 6319
536 Ga0501072_0006034 3300049588 Bacteria 9243
537 Ga0501072_0009706 3300049588 Bacteria 7320
538 Ga0501073_0020233 3300049589 Bacteria 4800
539 Ga0501074_0040978 3300049590 Bacteria 3353
540 Ga0501074_0073420 3300049590 Bacteria 2457
541 Ga0501075_0012744 3300049591 Bacteria 5983
542 Ga0501076_0015064 3300049592 Bacteria 5838
543 Ga0501076_0614064 3300049592 Bacteria 897
544 Ga0501077_0112064 3300049593 Bacteria 1729
545 Ga0501077_0142108 3300049593 Bacteria 1522
546 Ga0501079_0001125 3300049741 Bacteria 18628
547 Ga0501079_0024022 3300049741 Bacteria 4676
548 Ga0501080_0009424 3300049742 Bacteria 8906
549 Ga0501080_0251487 3300049742 Bacteria 1611
550 Ga0501035_0003717 3300049822 Bacteria 14549
551 Ga0501035_0076126 3300049822 Bacteria 2967
552 Ga0501035_0151575 3300049822 Bacteria 2011
553 Ga0501044_0001280 3300049823 Bacteria 29717
554 Ga0501044_0003673 3300049823 Bacteria 17257
555 Ga0501044_0014813 3300049823 Bacteria 8406
556 Ga0501044_0073080 3300049823 Bacteria 3486
557 Ga0501044_0140646 3300049823 Bacteria 2402
558 Ga0501044_0174026 3300049823 Bacteria 2122
559 Ga0501044_0409672 3300049823 Bacteria 1267
560 Ga0501044_0640362 3300049823 Bacteria 953
561 Ga0501045_0006195 3300049824 Bacteria 8282
562 Ga0501045_0256243 3300049824 Bacteria 1302
563 Ga0501045_0373973 3300049824 Bacteria 1060
564 nmdc:mga03n38_8846_c1 3300050490 Bacteria 3633
565 nmdc:mga0yw44_161365_c1 3300050492 Bacteria 1467
566 nmdc:mga04h51_1911_c1 3300050495 Bacteria 4867
567 nmdc:mga07m45_198089_c1 3300050496 Bacteria 1168
568 nmdc:mga05p37_10699_c1 3300050507 Bacteria 10890
569 nmdc:mga05p37_650239_c1 3300050507 Bacteria 1181
570 nmdc:mga09592_5735_c1 3300050508 Bacteria 10126
571 nmdc:mga0qj67_40175_c1 3300050509 Bacteria 3677
572 nmdc:mga06r32_24334_c1 3300050510 Bacteria 5619
573 Ga0495601_0006666 3300053077 Bacteria 6759
574 Ga0495601_0045368 3300053077 Bacteria 2763
575 Ga0495601_0064359 3300053077 Bacteria 2332
576 Ga0495601_0091398 3300053077 Bacteria 1959
577 Ga0495612_0001094 3300053078 Bacteria 11097
578 Ga0495612_0012093 3300053078 Bacteria 3477
579 Ga0495612_0150042 3300053078 Bacteria 1014
580 Ga0495655_0007409 3300053083 Bacteria 2039
581 Ga0495655_0080842 3300053083 Bacteria 929
582 Ga0495619_0027418 3300053085 Bacteria 3668
583 Ga0495619_0113087 3300053085 Bacteria 1856
584 Ga0495619_0124003 3300053085 Bacteria 1772
585 Ga0495619_0193453 3300053085 Bacteria 1408
586 Ga0495619_0213089 3300053085 Bacteria 1338
587 Ga0500583_0175554 3300053092 Bacteria 1067
588 Ga0500640_004906 3300053095 Bacteria 4918
589 Ga0500553_103176 3300053101 Bacteria 1221
590 Ga0500560_009278 3300053107 Bacteria 2411
591 Ga0500572_006859 3300053111 Bacteria 2619
592 Ga0500580_111849 3300053113 Bacteria 1055
593 Ga0500573_0036186 3300053140 Bacteria 2850
594 Ga0500573_0169886 3300053140 Bacteria 1180
595 Ga0501084_0026251 3300054114 Bacteria 4858
596 Ga0501084_0125367 3300054114 Bacteria 2161
597 Ga0590075_033321 3300059424 Bacteria 1308
598 Ga0501082_0005865 3300060353 Bacteria 10662
599 Ga0501082_0024474 3300060353 Bacteria 5204
600 Ga0466962_0000045 3300061719 Bacteria 52271
601 Ga0466962_0000304 3300061719 Bacteria 21075
602 Ga0466962_0061629 3300061719 Bacteria 1790
603 Ga0466962_0065834 3300061719 Bacteria 1730
604 Ga0530510_0160929 3300061734 Bacteria 1660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10548398 Ga0307406_105483981 205
2 3300035398 Ga0316574_0024247 Ga0316574_0024247_668_1471 207
3 3300020078 Ga0206352_10458276 Ga0206352_104582761 208
4 3300032002 Ga0307416_100114809 Ga0307416_1001148092 208
5 3300031995 Ga0307409_100028034 Ga0307409_1000280342 209
6 3300032002 Ga0307416_100026483 Ga0307416_1000264832 209
7 3300032004 Ga0307414_10046683 Ga0307414_100466832 209
8 3300046500 Ga0495596_0126585 Ga0495596_0126585_196_975 209
9 3300025944 Ga0207661_10686343 Ga0207661_106863431 210
10 3300009177 Ga0105248_10363585 Ga0105248_103635852 211
11 3300048912 Ga0496109_0155240 Ga0496109_0155240_1427_2104 211
12 iso_pu_bacteria 2929219909 2929224514 211
13 3300005563 Ga0068855_100454258 Ga0068855_1004542582 213
14 3300020082 Ga0206353_10245330 Ga0206353_102453303 213
15 3300013105 Ga0157369_10001259 Ga0157369_1000125911 214
16 3300020069 Ga0197907_11404546 Ga0197907_114045462 214
17 3300020081 Ga0206354_10608928 Ga0206354_106089282 214
18 3300022467 Ga0224712_10012653 Ga0224712_100126532 214
19 3300025949 Ga0207667_10332896 Ga0207667_103328962 214
20 3300048918 Ga0496115_0221633 Ga0496115_0221633_423_1079 214
21 3300037312 Ga0395899_0110433 Ga0395899_0110433_625_1446 215
22 3300037466 Ga0395898_0015951 Ga0395898_0015951_3437_4258 215
23 3300038443 Ga0395901_0103238 Ga0395901_0103238_541_1362 215
24 3300031995 Ga0307409_100181099 Ga0307409_1001810992 216
25 3300006844 Ga0075428_100013985 Ga0075428_1000139852 217
26 3300006846 Ga0075430_100001131 Ga0075430_10000113123 217
27 3300006847 Ga0075431_100037399 Ga0075431_1000373994 217
28 3300006880 Ga0075429_100003197 Ga0075429_1000031977 217
29 3300009147 Ga0114129_10026919 Ga0114129_100269194 217
30 3300050507 nmdc:mga05p37_10699_c1 nmdc:mga05p37_10699_c1_9065_9721 217
31 3300050508 nmdc:mga09592_5735_c1 nmdc:mga09592_5735_c1_8341_8997 217
32 3300050509 nmdc:mga0qj67_40175_c1 nmdc:mga0qj67_40175_c1_1023_1679 217
33 3300050510 nmdc:mga06r32_24334_c1 nmdc:mga06r32_24334_c1_1553_2209 217
34 3300005327 Ga0070658_10067691 Ga0070658_100676912 218
35 3300005455 Ga0070663_100284716 Ga0070663_1002847161 218
36 3300005539 Ga0068853_100045056 Ga0068853_1000450561 218
37 3300005548 Ga0070665_100066681 Ga0070665_1000666813 218
38 3300005563 Ga0068855_100012299 Ga0068855_1000122997 218
39 3300005616 Ga0068852_100157836 Ga0068852_1001578362 218
40 3300009093 Ga0105240_10058110 Ga0105240_100581102 218
41 3300009551 Ga0105238_10009385 Ga0105238_100093853 218
42 3300010375 Ga0105239_10066106 Ga0105239_100661062 218
43 3300014969 Ga0157376_10083823 Ga0157376_100838232 218
44 3300025904 Ga0207647_10001793 Ga0207647_1000179313 218
45 3300025913 Ga0207695_10001103 Ga0207695_1000110339 218
46 3300025914 Ga0207671_10000389 Ga0207671_1000038919 218
47 3300025924 Ga0207694_10000549 Ga0207694_100005494 218
48 3300025949 Ga0207667_10078377 Ga0207667_100783773 218
49 3300026067 Ga0207678_10053356 Ga0207678_100533562 218
50 3300026142 Ga0207698_10016593 Ga0207698_100165932 218
51 3300028379 Ga0268266_10164251 Ga0268266_101642512 218
52 3300045049 Ga0466959_0235795 Ga0466959_0235795_339_1115 218
53 3300031903 Ga0307407_10101498 Ga0307407_101014982 219
54 3300005327 Ga0070658_10000119 Ga0070658_1000011932 220
55 3300005336 Ga0070680_100017571 Ga0070680_1000175714 220
56 3300005530 Ga0070679_100366819 Ga0070679_1003668192 220
57 3300025909 Ga0207705_10002817 Ga0207705_100028174 220
58 3300025917 Ga0207660_10014899 Ga0207660_100148994 220
59 3300048917 Ga0496114_0242156 Ga0496114_0242156_27_704 220
60 3300045049 Ga0466959_0256308 Ga0466959_0256308_276_1028 222
61 iso_pu_bacteria 2831935698 2831937359 223
62 3300025940 Ga0207691_10112322 Ga0207691_101123223 225
63 3300044683 Ga0466965_0057981 Ga0466965_0057981_438_1214 225
64 3300046455 Ga0495603_0086739 Ga0495603_0086739_35_808 225
65 3300046463 Ga0495653_0142906 Ga0495653_0142906_483_1256 225
66 3300046533 Ga0495640_0195634 Ga0495640_0195634_390_1163 225
67 3300046559 Ga0495667_0272240 Ga0495667_0272240_293_1066 225
68 3300047319 Ga0495674_0130790 Ga0495674_0130790_643_1416 225
69 3300053085 Ga0495619_0193453 Ga0495619_0193453_132_905 225
70 3300009553 Ga0105249_10070800 Ga0105249_100708002 226
71 3300014326 Ga0157380_10072340 Ga0157380_100723402 226
72 3300049573 Ga0501037_0264859 Ga0501037_0264859_325_1116 227
73 3300049578 Ga0501042_0082943 Ga0501042_0082943_1370_2161 227
74 3300049581 Ga0501047_0000055 Ga0501047_0000055_96175_96966 227
75 3300049823 Ga0501044_0409672 Ga0501044_0409672_65_889 227
76 3300037471 Ga0395905_0139086 Ga0395905_0139086_240_956 228
77 3300005327 Ga0070658_10154233 Ga0070658_101542332 229
78 3300025909 Ga0207705_10157882 Ga0207705_101578821 229
79 3300025919 Ga0207657_10015561 Ga0207657_100155614 229
80 3300049580 Ga0501046_0017948 Ga0501046_0017948_2955_3680 230
81 3300005329 Ga0070683_100163068 Ga0070683_1001630681 232
82 3300009147 Ga0114129_10214171 Ga0114129_102141712 232
83 3300025944 Ga0207661_10025764 Ga0207661_100257644 232
84 3300031727 Ga0316576_10003510 Ga0316576_100035103 232
85 3300032137 Ga0316585_10019269 Ga0316585_100192692 232
86 3300036712 Ga0316584_0027632 Ga0316584_0027632_65_868 232
87 3300050507 nmdc:mga05p37_650239_c1 nmdc:mga05p37_650239_c1_44_868 232
88 3300003323 rootH1_10051479 rootH1_100514793 233
89 3300005364 Ga0070673_100191516 Ga0070673_1001915163 233
90 3300031456 Ga0307513_10044671 Ga0307513_100446711 233
91 3300044656 Ga0466969_0003315 Ga0466969_0003315_6074_6859 233
92 3300044684 Ga0466966_0018211 Ga0466966_0018211_2444_3229 233
93 3300044693 Ga0466961_0023414 Ga0466961_0023414_1645_2430 233
94 3300045049 Ga0466959_0002069 Ga0466959_0002069_9352_10137 233
95 3300045976 Ga0466967_0144214 Ga0466967_0144214_1305_2090 233
96 3300048907 Ga0496104_0109526 Ga0496104_0109526_851_1624 233
97 3300048909 Ga0496106_0098428 Ga0496106_0098428_79_819 233
98 3300048911 Ga0496108_0293992 Ga0496108_0293992_245_1018 233
99 3300005434 Ga0070709_10083032 Ga0070709_100830322 236
100 3300005436 Ga0070713_100008754 Ga0070713_1000087546 236
101 3300006173 Ga0070716_100091100 Ga0070716_1000911003 236
102 3300038443 Ga0395901_0440555 Ga0395901_0440555_21_824 236
103 3300005535 Ga0070684_100150005 Ga0070684_1001500052 237
104 3300005355 Ga0070671_100286970 Ga0070671_1002869702 238
105 3300005840 Ga0068870_10001458 Ga0068870_100014584 238
106 3300009174 Ga0105241_10005515 Ga0105241_100055154 238
107 3300009545 Ga0105237_10123767 Ga0105237_101237674 238
108 3300020080 Ga0206350_10992698 Ga0206350_109926982 238
109 3300025908 Ga0207643_10000642 Ga0207643_1000064214 238
110 3300042005 Ga0439448_0079160 Ga0439448_0079160_51_797 238
111 3300044901 Ga0466960_0019918 Ga0466960_0019918_1483_2232 238
112 3300048916 Ga0496113_0068423 Ga0496113_0068423_1790_2521 238
113 3300005458 Ga0070681_10320784 Ga0070681_103207841 240
114 3300025913 Ga0207695_10456643 Ga0207695_104566432 240
115 3300032137 Ga0316585_10017413 Ga0316585_100174133 240
116 3300037588 Ga0316581_0000691 Ga0316581_0000691_3282_4070 240
117 3300044684 Ga0466966_0119600 Ga0466966_0119600_209_976 240
118 3300044693 Ga0466961_0013288 Ga0466961_0013288_3988_4755 240
119 3300045836 Ga0466958_0040184 Ga0466958_0040184_365_1132 240
120 3300048911 Ga0496108_0124877 Ga0496108_0124877_273_1061 240
121 3300048917 Ga0496114_0408633 Ga0496114_0408633_344_1132 240
122 3300049572 Ga0501036_0173465 Ga0501036_0173465_698_1453 240
123 3300049574 Ga0501038_0037839 Ga0501038_0037839_2755_3510 240
124 3300049575 Ga0501039_0018223 Ga0501039_0018223_4445_5200 240
125 3300049576 Ga0501040_0009695 Ga0501040_0009695_3387_4142 240
126 3300049582 Ga0501048_0009621 Ga0501048_0009621_4881_5636 240
127 3300049588 Ga0501072_0006034 Ga0501072_0006034_4345_5100 240
128 3300049590 Ga0501074_0040978 Ga0501074_0040978_958_1713 240
129 3300049591 Ga0501075_0012744 Ga0501075_0012744_3933_4688 240
130 3300049592 Ga0501076_0015064 Ga0501076_0015064_1805_2560 240
131 3300049593 Ga0501077_0112064 Ga0501077_0112064_179_934 240
132 3300049741 Ga0501079_0024022 Ga0501079_0024022_3001_3756 240
133 3300049824 Ga0501045_0006195 Ga0501045_0006195_5635_6390 240
134 3300053113 Ga0500580_111849 Ga0500580_111849_84_875 240
135 3300060353 Ga0501082_0024474 Ga0501082_0024474_1062_1817 240
136 3300061734 Ga0530510_0160929 Ga0530510_0160929_526_1281 240
137 3300005466 Ga0070685_10251434 Ga0070685_102514342 241
138 3300009098 Ga0105245_10281268 Ga0105245_102812682 241
139 3300013297 Ga0157378_10238951 Ga0157378_102389513 241
140 3300020069 Ga0197907_10194450 Ga0197907_101944502 241
141 3300020070 Ga0206356_11157171 Ga0206356_111571712 241
142 3300022467 Ga0224712_10017830 Ga0224712_100178303 241
143 3300035091 Ga0373951_0000211 Ga0373951_0000211_12551_13336 241
144 iso_pu_bacteria 8057568493 8057572173 241
145 iso_pu_bacteria 2861520306 2861522048 242
146 3300005334 Ga0068869_100122383 Ga0068869_1001223833 243
147 3300005345 Ga0070692_10044010 Ga0070692_100440104 243
148 3300005366 Ga0070659_100000362 Ga0070659_10000036224 243
149 3300013102 Ga0157371_10198127 Ga0157371_101981272 243
150 3300013105 Ga0157369_10000797 Ga0157369_1000079713 243
151 3300013105 Ga0157369_10134630 Ga0157369_101346302 243
152 3300013105 Ga0157369_10215827 Ga0157369_102158272 243
153 3300025932 Ga0207690_10003378 Ga0207690_1000337811 243
154 3300025932 Ga0207690_10012941 Ga0207690_100129414 243
155 3300025942 Ga0207689_10117215 Ga0207689_101172152 243
156 3300005336 Ga0070680_100011790 Ga0070680_1000117909 244
157 3300005530 Ga0070679_100092767 Ga0070679_1000927672 244
158 3300005983 Ga0081540_1001328 Ga0081540_100132812 244
159 3300009545 Ga0105237_10196552 Ga0105237_101965522 244
160 3300022467 Ga0224712_10141777 Ga0224712_101417771 244
161 3300025917 Ga0207660_10185982 Ga0207660_101859822 244
162 3300025921 Ga0207652_10073273 Ga0207652_100732732 244
163 3300033179 Ga0307507_10119453 Ga0307507_101194532 244
164 3300044656 Ga0466969_0085596 Ga0466969_0085596_454_1230 244
165 3300044765 Ga0466970_0001880 Ga0466970_0001880_8490_9266 244
166 3300045836 Ga0466958_0209196 Ga0466958_0209196_38_814 244
167 3300046462 Ga0495651_0011488 Ga0495651_0011488_1515_2291 244
168 3300046516 Ga0495628_0372912 Ga0495628_0372912_19_795 244
169 3300046529 Ga0495652_0000641 Ga0495652_0000641_13166_13942 244
170 3300046809 Ga0495600_0028378 Ga0495600_0028378_468_1244 244
171 3300047315 Ga0495581_0093113 Ga0495581_0093113_891_1667 244
172 3300048904 Ga0496101_0533306 Ga0496101_0533306_10_783 244
173 3300048907 Ga0496104_0140269 Ga0496104_0140269_671_1444 244
174 3300048917 Ga0496114_0003598 Ga0496114_0003598_2554_3327 244
175 iso_pu_bacteria 2622736605 2623499910 244
176 3300005578 Ga0068854_100064116 Ga0068854_1000641163 245
177 3300046462 Ga0495651_0164587 Ga0495651_0164587_496_1272 245
178 3300046529 Ga0495652_0154085 Ga0495652_0154085_969_1745 245
179 3300053077 Ga0495601_0064359 Ga0495601_0064359_90_866 245
180 3300053078 Ga0495612_0012093 Ga0495612_0012093_471_1247 245
181 3300053085 Ga0495619_0124003 Ga0495619_0124003_951_1727 245
182 3300053140 Ga0500573_0169886 Ga0500573_0169886_290_1069 245
183 iso_pu_bacteria 2995463766 2995465002 245
184 3300005327 Ga0070658_10364508 Ga0070658_103645082 246
185 3300005535 Ga0070684_100157725 Ga0070684_1001577253 246
186 3300013105 Ga0157369_10200329 Ga0157369_102003293 246
187 3300013307 Ga0157372_10308935 Ga0157372_103089353 246
188 3300020070 Ga0206356_11754385 Ga0206356_117543851 246
189 3300025909 Ga0207705_10024594 Ga0207705_100245942 246
190 3300025919 Ga0207657_10107522 Ga0207657_101075223 246
191 3300025920 Ga0207649_10149166 Ga0207649_101491662 246
192 3300025921 Ga0207652_10129549 Ga0207652_101295492 246
193 3300025944 Ga0207661_10097167 Ga0207661_100971673 246
194 3300026035 Ga0207703_10546639 Ga0207703_105466391 246
195 3300026067 Ga0207678_10050866 Ga0207678_100508663 246
196 3300026078 Ga0207702_10347367 Ga0207702_103473673 246
197 3300026142 Ga0207698_10292764 Ga0207698_102927643 246
198 3300028794 Ga0307515_10033218 Ga0307515_100332187 246
199 3300031616 Ga0307508_10049368 Ga0307508_100493682 246
200 3300031731 Ga0307405_10014517 Ga0307405_100145173 246
201 3300031731 Ga0307405_10356312 Ga0307405_103563122 246
202 3300031824 Ga0307413_10298328 Ga0307413_102983282 246
203 3300031852 Ga0307410_10031789 Ga0307410_100317892 246
204 3300031852 Ga0307410_10032066 Ga0307410_100320664 246
205 3300031852 Ga0307410_10089745 Ga0307410_100897452 246
206 3300031901 Ga0307406_10194509 Ga0307406_101945092 246
207 3300031903 Ga0307407_10035351 Ga0307407_100353513 246
208 3300031903 Ga0307407_10233344 Ga0307407_102333442 246
209 3300031911 Ga0307412_10284096 Ga0307412_102840961 246
210 3300031995 Ga0307409_100013836 Ga0307409_1000138362 246
211 3300031995 Ga0307409_100082463 Ga0307409_1000824632 246
212 3300031995 Ga0307409_100170756 Ga0307409_1001707562 246
213 3300031995 Ga0307409_100180311 Ga0307409_1001803113 246
214 3300031995 Ga0307409_100210291 Ga0307409_1002102912 246
215 3300032002 Ga0307416_100052841 Ga0307416_1000528413 246
216 3300032004 Ga0307414_10088751 Ga0307414_100887513 246
217 3300032004 Ga0307414_10120395 Ga0307414_101203951 246
218 3300032005 Ga0307411_10178979 Ga0307411_101789792 246
219 3300032005 Ga0307411_10252921 Ga0307411_102529212 246
220 3300032126 Ga0307415_100006290 Ga0307415_1000062904 246
221 3300032126 Ga0307415_100052350 Ga0307415_1000523503 246
222 3300032126 Ga0307415_100085707 Ga0307415_1000857072 246
223 3300032126 Ga0307415_100166149 Ga0307415_1001661492 246
224 3300032126 Ga0307415_100193515 Ga0307415_1001935151 246
225 3300032126 Ga0307415_100345676 Ga0307415_1003456762 246
226 3300041512 Ga0451853_1912804 Ga0451853_1912804_881_1681 246
227 3300044683 Ga0466965_0112909 Ga0466965_0112909_494_1270 246
228 3300045976 Ga0466967_0022099 Ga0466967_0022099_2131_2904 246
229 iso_pu_bacteria 2501939600 2501939957 246
230 iso_pu_bacteria 2515154088 2515495283 246
231 iso_pu_bacteria 2515154129 2515722226 246
232 iso_pu_bacteria 2515154202 2516085364 246
233 iso_pu_bacteria 2622736626 2623590650 246
234 iso_pu_bacteria 2858868258 2858871862 246
235 iso_pu_bacteria 2858902515 2858906632 246
236 iso_pu_bacteria 2867312974 2867318796 246
237 iso_pu_bacteria 2867319477 2867320791 246
238 iso_pu_bacteria 2867507094 2867511939 246
239 iso_pu_bacteria 2902582711 2902585860 246
240 iso_pu_bacteria 2996221748 2996223099 246
241 iso_pu_bacteria 8003830390 8003832035 246
242 iso_pu_bacteria 8054727385 8054731396 246
243 iso_pu_bacteria 8055412473 8055414588 246
244 3300026078 Ga0207702_10033501 Ga0207702_100335013 247
245 3300026088 Ga0207641_10284676 Ga0207641_102846762 247
246 3300028786 Ga0307517_10084604 Ga0307517_100846042 247
247 3300032002 Ga0307416_100133476 Ga0307416_1001334762 247
248 3300044693 Ga0466961_0113162 Ga0466961_0113162_391_1167 247
249 3300044706 Ga0466964_0037189 Ga0466964_0037189_70_846 247
250 3300044765 Ga0466970_0194658 Ga0466970_0194658_172_948 247
251 3300045049 Ga0466959_0045828 Ga0466959_0045828_1202_1978 247
252 3300045976 Ga0466967_0099938 Ga0466967_0099938_1631_2392 247
253 3300049576 Ga0501040_0148045 Ga0501040_0148045_45_833 247
254 3300061719 Ga0466962_0061629 Ga0466962_0061629_891_1667 247
255 iso_pu_bacteria 3006425503 3006426335 247
256 iso_pu_bacteria 8056060235 8056066521 247
257 3300003354 JGI25160J50197_1005533 JGI25160J50197_10055332 248
258 3300025302 Ga0207426_1001708 Ga0207426_10017081 248
259 3300025302 Ga0207426_1002372 Ga0207426_10023723 248
260 3300035118 Ga0373954_0039353 Ga0373954_0039353_428_1231 248
261 3300035398 Ga0316574_0026269 Ga0316574_0026269_767_1561 248
262 3300039450 Ga0436363_1668436 Ga0436363_1668436_765_1595 248
263 3300044694 Ga0466963_0197104 Ga0466963_0197104_60_845 248
264 3300044842 Ga0466957_0244560 Ga0466957_0244560_99_878 248
265 3300046462 Ga0495651_0002038 Ga0495651_0002038_11082_11885 248
266 3300046463 Ga0495653_0003878 Ga0495653_0003878_2109_2912 248
267 3300046472 Ga0495580_0043463 Ga0495580_0043463_2092_2895 248
268 3300046477 Ga0495664_0027249 Ga0495664_0027249_2088_2891 248
269 3300046511 Ga0495608_0007650 Ga0495608_0007650_1400_2203 248
270 3300046517 Ga0495630_0274611 Ga0495630_0274611_298_1101 248
271 3300046526 Ga0495666_0000038 Ga0495666_0000038_25050_25853 248
272 3300046529 Ga0495652_0018707 Ga0495652_0018707_1307_2110 248
273 3300046531 Ga0495665_0000846 Ga0495665_0000846_1990_2793 248
274 3300046533 Ga0495640_0000604 Ga0495640_0000604_24965_25768 248
275 3300046535 Ga0495586_0008446 Ga0495586_0008446_4545_5348 248
276 3300046536 Ga0495587_0026773 Ga0495587_0026773_2133_2936 248
277 3300046543 Ga0495645_0015660 Ga0495645_0015660_1900_2703 248
278 3300046559 Ga0495667_0005401 Ga0495667_0005401_3787_4590 248
279 3300046642 Ga0495634_0038825 Ga0495634_0038825_354_1157 248
280 3300046663 Ga0495635_0035280 Ga0495635_0035280_577_1380 248
281 3300046675 Ga0495657_0007395 Ga0495657_0007395_3516_4319 248
282 3300046679 Ga0495623_0012861 Ga0495623_0012861_1690_2493 248
283 3300046689 Ga0495613_0022738 Ga0495613_0022738_3787_4590 248
284 3300046809 Ga0495600_0012847 Ga0495600_0012847_3659_4462 248
285 3300047315 Ga0495581_0029662 Ga0495581_0029662_1902_2705 248
286 3300047317 Ga0495604_0001183 Ga0495604_0001183_2411_3214 248
287 3300047444 Ga0495675_0204873 Ga0495675_0204873_210_1013 248
288 3300047471 Ga0495684_0029675 Ga0495684_0029675_1389_2192 248
289 3300047673 Ga0495593_0080220 Ga0495593_0080220_499_1302 248
290 3300048929 Ga0496126_0000006 Ga0496126_0000006_211966_212751 248
291 3300049569 Ga0501032_0005828 Ga0501032_0005828_7686_8471 248
292 3300049570 Ga0501033_0103465 Ga0501033_0103465_75_860 248
293 3300049571 Ga0501034_0004159 Ga0501034_0004159_15333_16118 248
294 3300049572 Ga0501036_0002938 Ga0501036_0002938_18_803 248
295 3300049573 Ga0501037_0004856 Ga0501037_0004856_8925_9710 248
296 3300049575 Ga0501039_0011139 Ga0501039_0011139_644_1429 248
297 3300049576 Ga0501040_0012035 Ga0501040_0012035_80_865 248
298 3300049577 Ga0501041_0000342 Ga0501041_0000342_156_941 248
299 3300049578 Ga0501042_0483732 Ga0501042_0483732_90_875 248
300 3300049579 Ga0501043_0002270 Ga0501043_0002270_259_1044 248
301 3300049580 Ga0501046_0015939 Ga0501046_0015939_5425_6210 248
302 3300049581 Ga0501047_0002325 Ga0501047_0002325_17304_18089 248
303 3300049582 Ga0501048_0009686 Ga0501048_0009686_4871_5656 248
304 3300049583 Ga0501067_0007213 Ga0501067_0007213_154_939 248
305 3300049584 Ga0501068_0001227 Ga0501068_0001227_147_932 248
306 3300049585 Ga0501069_0266565 Ga0501069_0266565_192_977 248
307 3300049586 Ga0501070_0015698 Ga0501070_0015698_191_976 248
308 3300049587 Ga0501071_0010072 Ga0501071_0010072_5365_6150 248
309 3300049588 Ga0501072_0009706 Ga0501072_0009706_1617_2402 248
310 3300049589 Ga0501073_0020233 Ga0501073_0020233_1612_2397 248
311 3300049593 Ga0501077_0142108 Ga0501077_0142108_518_1303 248
312 3300049741 Ga0501079_0001125 Ga0501079_0001125_57_842 248
313 3300049742 Ga0501080_0251487 Ga0501080_0251487_805_1590 248
314 3300049822 Ga0501035_0003717 Ga0501035_0003717_71_856 248
315 3300049823 Ga0501044_0001280 Ga0501044_0001280_28862_29647 248
316 3300049824 Ga0501045_0373973 Ga0501045_0373973_152_937 248
317 3300053077 Ga0495601_0006666 Ga0495601_0006666_5640_6443 248
318 3300053085 Ga0495619_0027418 Ga0495619_0027418_205_1008 248
319 3300054114 Ga0501084_0026251 Ga0501084_0026251_1694_2479 248
320 3300060353 Ga0501082_0005865 Ga0501082_0005865_9661_10446 248
321 iso_pu_bacteria 2547132111 2547411064 248
322 iso_pu_bacteria 2554235005 2554259212 248
323 iso_pu_bacteria 2582581312 2585298573 248
324 iso_pu_bacteria 2582581314 2585317655 248
325 iso_pu_bacteria 2616644814 2616693931 248
326 iso_pu_bacteria 2616644941 2616899159 248
327 iso_pu_bacteria 2643221578 2643897098 248
328 iso_pu_bacteria 2643221673 2644408242 248
329 iso_pu_bacteria 2643221678 2644435442 248
330 iso_pu_bacteria 2643221714 2644630549 248
331 iso_pu_bacteria 2784132148 2784587092 248
332 iso_pu_bacteria 2784746763 2785345312 248
333 iso_pu_bacteria 2791355406 2793984212 248
334 iso_pu_bacteria 2808606359 2808848063 248
335 iso_pu_bacteria 2808606375 2808918830 248
336 iso_pu_bacteria 2808606448 2809230656 248
337 iso_pu_bacteria 2808606982 2811847340 248
338 iso_pu_bacteria 2811994879 2812359935 248
339 iso_pu_bacteria 2811994917 2812482004 248
340 iso_pu_bacteria 2852635781 2852638094 248
341 iso_pu_bacteria 2862281513 2862289064 248
342 iso_pu_bacteria 2862382967 2862390162 248
343 iso_pu_bacteria 2862507626 2862508490 248
344 iso_pu_bacteria 2862574272 2862583286 248
345 iso_pu_bacteria 2863404153 2863406559 248
346 iso_pu_bacteria 2867369537 2867370360 248
347 iso_pu_bacteria 2867475112 2867476993 248
348 iso_pu_bacteria 2873151551 2873157305 248
349 iso_pu_bacteria 2912715099 2912721984 248
350 iso_pu_bacteria 2912723979 2912725752 248
351 iso_pu_bacteria 2912757875 2912759231 248
352 iso_pu_bacteria 2919468124 2919475076 248
353 iso_pu_bacteria 2946045630 2946051647 248
354 iso_pu_bacteria 2946064051 2946065970 248
355 iso_pu_bacteria 2946072368 2946074294 248
356 iso_pu_bacteria 2947224130 2947231434 248
357 iso_pu_bacteria 2954002825 2954004689 248
358 iso_pu_bacteria 2966598605 2966604010 248
359 iso_pu_bacteria 2990044586 2990044624 248
360 iso_pu_bacteria 2990059506 2990066183 248
361 iso_pu_bacteria 2990088156 2990092319 248
362 iso_pu_bacteria 2997451912 2997458804 248
363 iso_pu_bacteria 2997600082 2997606842 248
364 iso_pu_bacteria 3006393351 3006394366 248
365 iso_pu_bacteria 3006486233 3006486372 248
366 iso_pu_bacteria 3006493962 3006496634 248
367 iso_pu_bacteria 8008558824 8008561748 248
368 iso_pu_bacteria 8008574985 8008580384 248
369 iso_pu_bacteria 8023623736 8023625064 248
370 iso_pu_bacteria 8025413630 8025418859 248
371 iso_pu_bacteria 8025478263 8025480037 248
372 iso_pu_bacteria 8025524527 8025527581 248
373 iso_pu_bacteria 8025530807 8025535768 248
374 iso_pu_bacteria 8047893842 8047899866 248
375 iso_pu_bacteria 8048127548 8048130995 248
376 iso_pu_bacteria 8048356638 8048359064 248
377 iso_pu_bacteria 8048369669 8048376814 248
378 iso_pu_bacteria 8048379754 8048385867 248
379 iso_pu_bacteria 8048406513 8048411601 248
380 iso_pu_bacteria 8054160619 8054163429 248
381 iso_pu_bacteria 8056667051 8056667564 248
382 iso_pu_bacteria 8056829672 8056832999 248
383 3300003316 rootH1_10040607 rootH1_100406073 249
384 3300003322 rootL2_10026369 rootL2_100263693 249
385 3300005434 Ga0070709_10037259 Ga0070709_100372593 249
386 3300005435 Ga0070714_100457753 Ga0070714_1004577531 249
387 3300005539 Ga0068853_100037542 Ga0068853_1000375426 249
388 3300005983 Ga0081540_1005111 Ga0081540_10051114 249
389 3300006028 Ga0070717_10298340 Ga0070717_102983401 249
390 3300006048 Ga0075363_100027879 Ga0075363_1000278793 249
391 3300009551 Ga0105238_10644227 Ga0105238_106442272 249
392 3300015688 Ga0183367_1007 Ga0183367_100770 249
393 3300025297 Ga0209758_1009625 Ga0209758_10096253 249
394 3300025906 Ga0207699_10051951 Ga0207699_100519512 249
395 3300026041 Ga0207639_10061430 Ga0207639_100614303 249
396 3300028794 Ga0307515_10188196 Ga0307515_101881961 249
397 3300030521 Ga0307511_10180594 Ga0307511_101805941 249
398 3300031507 Ga0307509_10018531 Ga0307509_100185311 249
399 3300031548 Ga0307408_100119461 Ga0307408_1001194611 249
400 3300041404 Ga0439436_0025102 Ga0439436_0025102_520_1311 249
401 3300041494 Ga0451837_1623308 Ga0451837_1623308_1277_2068 249
402 3300041512 Ga0451853_1849776 Ga0451853_1849776_1275_2066 249
403 3300042014 Ga0439457_000487 Ga0439457_000487_10076_10867 249
404 3300042014 Ga0439457_017355 Ga0439457_017355_336_1127 249
405 3300042131 Ga0450894_000118 Ga0450894_000118_9378_10169 249
406 3300042133 Ga0450896_001022 Ga0450896_001022_144_935 249
407 3300042134 Ga0450898_001468 Ga0450898_001468_21_812 249
408 3300042145 Ga0450906_004237 Ga0450906_004237_382_1173 249
409 3300044656 Ga0466969_0001961 Ga0466969_0001961_2313_3134 249
410 3300044658 Ga0466972_0006482 Ga0466972_0006482_4674_5465 249
411 3300044684 Ga0466966_0019368 Ga0466966_0019368_2728_3549 249
412 3300044693 Ga0466961_0000931 Ga0466961_0000931_3940_4761 249
413 3300044719 Ga0466971_0000129 Ga0466971_0000129_10039_10860 249
414 3300045049 Ga0466959_0021527 Ga0466959_0021527_3125_3946 249
415 3300046457 Ga0495590_0108040 Ga0495590_0108040_97_888 249
416 3300046462 Ga0495651_0000439 Ga0495651_0000439_19379_20200 249
417 3300046477 Ga0495664_0138831 Ga0495664_0138831_461_1282 249
418 3300046506 Ga0495583_0154112 Ga0495583_0154112_139_930 249
419 3300046516 Ga0495628_0110958 Ga0495628_0110958_403_1224 249
420 3300046529 Ga0495652_0001811 Ga0495652_0001811_8776_9597 249
421 3300046663 Ga0495635_0047456 Ga0495635_0047456_122_943 249
422 3300046674 Ga0495588_0058055 Ga0495588_0058055_1058_1864 249
423 3300046680 Ga0495646_0020503 Ga0495646_0020503_3251_4072 249
424 3300046794 Ga0495589_0134409 Ga0495589_0134409_272_1063 249
425 3300046809 Ga0495600_0019339 Ga0495600_0019339_1005_1826 249
426 3300047318 Ga0495636_0006916 Ga0495636_0006916_3030_3821 249
427 3300047318 Ga0495636_0149393 Ga0495636_0149393_159_950 249
428 3300047447 Ga0495685_082174 Ga0495685_082174_143_934 249
429 3300049128 Ga0501308_008026 Ga0501308_008026_157_948 249
430 3300049592 Ga0501076_0614064 Ga0501076_0614064_78_869 249
431 3300050490 nmdc:mga03n38_8846_c1 nmdc:mga03n38_8846_c1_1020_1814 249
432 3300053077 Ga0495601_0045368 Ga0495601_0045368_178_999 249
433 3300053077 Ga0495601_0091398 Ga0495601_0091398_999_1820 249
434 3300053078 Ga0495612_0001094 Ga0495612_0001094_4401_5222 249
435 3300053083 Ga0495655_0080842 Ga0495655_0080842_57_848 249
436 3300053085 Ga0495619_0113087 Ga0495619_0113087_295_1116 249
437 3300061719 Ga0466962_0000304 Ga0466962_0000304_19349_20170 249
438 3300061719 Ga0466962_0065834 Ga0466962_0065834_373_1164 249
439 iso_pu_bacteria 2643221587 2643945436 249
440 iso_pu_bacteria 2643221670 2644387660 249
441 iso_pu_bacteria 2643221677 2644432335 249
442 iso_pu_bacteria 2818991472 2819740001 249
443 iso_pu_bacteria 2862178590 2862183231 249
444 iso_pu_bacteria 2918501144 2918502916 249
445 3300002067 JGI24735J21928_10020594 JGI24735J21928_100205943 250
446 3300003323 rootH1_10042801 rootH1_100428013 250
447 3300005617 Ga0068859_100059737 Ga0068859_1000597371 250
448 3300006038 Ga0075365_10163336 Ga0075365_101633361 250
449 3300006042 Ga0075368_10001944 Ga0075368_100019443 250
450 3300006178 Ga0075367_10013085 Ga0075367_100130852 250
451 3300006931 Ga0097620_100059737 Ga0097620_1000597371 250
452 3300006948 Ga0099826_10052161 Ga0099826_100521614 250
453 3300009011 Ga0105251_10032904 Ga0105251_100329042 250
454 3300009036 Ga0105244_10128650 Ga0105244_101286502 250
455 3300009092 Ga0105250_10030904 Ga0105250_100309042 250
456 3300011119 Ga0105246_10024357 Ga0105246_100243573 250
457 3300011119 Ga0105246_10156675 Ga0105246_101566751 250
458 3300014497 Ga0182008_10006694 Ga0182008_100066943 250
459 3300015262 Ga0182007_10002052 Ga0182007_1000205215 250
460 3300022467 Ga0224712_10141230 Ga0224712_101412301 250
461 3300025735 Ga0207713_1022981 Ga0207713_10229813 250
462 3300025904 Ga0207647_10019779 Ga0207647_100197792 250
463 3300025928 Ga0207700_10004997 Ga0207700_100049976 250
464 3300025929 Ga0207664_10041633 Ga0207664_100416332 250
465 3300027312 Ga0209371_1007004 Ga0209371_10070046 250
466 3300027866 Ga0209813_10003133 Ga0209813_100031334 250
467 3300028794 Ga0307515_10001938 Ga0307515_100019383 250
468 3300030500 Ga0268256_1006497 Ga0268256_10064973 250
469 3300030521 Ga0307511_10003550 Ga0307511_1000355018 250
470 3300030522 Ga0307512_10060873 Ga0307512_100608735 250
471 3300031456 Ga0307513_10018658 Ga0307513_100186585 250
472 3300031456 Ga0307513_10054304 Ga0307513_100543047 250
473 3300031616 Ga0307508_10165784 Ga0307508_101657843 250
474 3300031649 Ga0307514_10034295 Ga0307514_100342951 250
475 3300031649 Ga0307514_10102841 Ga0307514_101028411 250
476 3300031649 Ga0307514_10158100 Ga0307514_101581001 250
477 3300031649 Ga0307514_10229729 Ga0307514_102297291 250
478 3300031730 Ga0307516_10004291 Ga0307516_1000429114 250
479 3300031730 Ga0307516_10208241 Ga0307516_102082412 250
480 3300033179 Ga0307507_10049533 Ga0307507_100495337 250
481 3300033180 Ga0307510_10051295 Ga0307510_100512951 250
482 3300033180 Ga0307510_10067663 Ga0307510_100676636 250
483 3300033180 Ga0307510_10073100 Ga0307510_100731003 250
484 3300033180 Ga0307510_10233274 Ga0307510_102332742 250
485 3300037312 Ga0395899_0200255 Ga0395899_0200255_139_942 250
486 3300037418 Ga0395900_0055090 Ga0395900_0055090_1429_2232 250
487 3300037466 Ga0395898_0003059 Ga0395898_0003059_17730_18533 250
488 3300037853 Ga0436364_0586317 Ga0436364_0586317_7095_7943 250
489 3300038443 Ga0395901_0093166 Ga0395901_0093166_1581_2384 250
490 3300041404 Ga0439436_0000389 Ga0439436_0000389_4901_5704 250
491 3300041406 Ga0439439_0009805 Ga0439439_0009805_871_1674 250
492 3300041512 Ga0451853_0695299 Ga0451853_0695299_404_1207 250
493 3300041999 Ga0439433_0000389 Ga0439433_0000389_4776_5579 250
494 3300042006 Ga0439432_062307 Ga0439432_062307_223_1026 250
495 3300042007 Ga0439449_0000989 Ga0439449_0000989_244_1047 250
496 3300042014 Ga0439457_002703 Ga0439457_002703_1893_2696 250
497 3300042157 Ga0439458_0003052 Ga0439458_0003052_92_904 250
498 3300044656 Ga0466969_0029153 Ga0466969_0029153_326_1141 250
499 3300044658 Ga0466972_0024209 Ga0466972_0024209_1800_2615 250
500 3300044658 Ga0466972_0085269 Ga0466972_0085269_300_1103 250
501 3300044658 Ga0466972_0097482 Ga0466972_0097482_179_982 250
502 3300044683 Ga0466965_0013412 Ga0466965_0013412_1853_2668 250
503 3300044684 Ga0466966_0000938 Ga0466966_0000938_11209_12024 250
504 3300044693 Ga0466961_0003176 Ga0466961_0003176_8984_9799 250
505 3300044693 Ga0466961_0355004 Ga0466961_0355004_66_869 250
506 3300044694 Ga0466963_0000235 Ga0466963_0000235_21479_22282 250
507 3300044694 Ga0466963_0000589 Ga0466963_0000589_6159_6974 250
508 3300044719 Ga0466971_0000182 Ga0466971_0000182_7935_8750 250
509 3300044765 Ga0466970_0000333 Ga0466970_0000333_21723_22538 250
510 3300044765 Ga0466970_0081512 Ga0466970_0081512_403_1194 250
511 3300044842 Ga0466957_0012768 Ga0466957_0012768_981_1796 250
512 3300044901 Ga0466960_0003073 Ga0466960_0003073_15_818 250
513 3300045049 Ga0466959_0132432 Ga0466959_0132432_431_1246 250
514 3300045836 Ga0466958_0092900 Ga0466958_0092900_303_1118 250
515 3300045836 Ga0466958_0142156 Ga0466958_0142156_410_1213 250
516 3300045976 Ga0466967_0018743 Ga0466967_0018743_4682_5485 250
517 3300045976 Ga0466967_0577177 Ga0466967_0577177_10_813 250
518 3300046452 Ga0495617_019949 Ga0495617_019949_1377_2180 250
519 3300046453 Ga0495627_011288 Ga0495627_011288_337_1140 250
520 3300046455 Ga0495603_0000346 Ga0495603_0000346_22190_22981 250
521 3300046455 Ga0495603_0001138 Ga0495603_0001138_4153_4956 250
522 3300046455 Ga0495603_0025888 Ga0495603_0025888_800_1591 250
523 3300046459 Ga0495629_0004470 Ga0495629_0004470_8654_9445 250
524 3300046459 Ga0495629_0033791 Ga0495629_0033791_2532_3323 250
525 3300046459 Ga0495629_0139175 Ga0495629_0139175_418_1221 250
526 3300046459 Ga0495629_0292823 Ga0495629_0292823_250_1053 250
527 3300046460 Ga0495638_0132150 Ga0495638_0132150_331_1143 250
528 3300046462 Ga0495651_0138717 Ga0495651_0138717_437_1240 250
529 3300046473 Ga0495582_0239317 Ga0495582_0239317_171_974 250
530 3300046474 Ga0495605_0007393 Ga0495605_0007393_593_1396 250
531 3300046476 Ga0495662_0006099 Ga0495662_0006099_2296_3099 250
532 3300046476 Ga0495662_0029742 Ga0495662_0029742_401_1204 250
533 3300046476 Ga0495662_0133567 Ga0495662_0133567_164_967 250
534 3300046477 Ga0495664_0003683 Ga0495664_0003683_353_1165 250
535 3300046492 Ga0495585_0041446 Ga0495585_0041446_566_1357 250
536 3300046492 Ga0495585_0109717 Ga0495585_0109717_292_1095 250
537 3300046492 Ga0495585_0124801 Ga0495585_0124801_373_1185 250
538 3300046499 Ga0495594_0023051 Ga0495594_0023051_2031_2834 250
539 3300046501 Ga0495607_0041936 Ga0495607_0041936_420_1223 250
540 3300046501 Ga0495607_0118011 Ga0495607_0118011_184_996 250
541 3300046506 Ga0495583_0012198 Ga0495583_0012198_3922_4725 250
542 3300046506 Ga0495583_0072072 Ga0495583_0072072_401_1204 250
543 3300046507 Ga0495606_0009840 Ga0495606_0009840_5123_5926 250
544 3300046514 Ga0495618_0013838 Ga0495618_0013838_366_1178 250
545 3300046514 Ga0495618_0019166 Ga0495618_0019166_2896_3699 250
546 3300046515 Ga0495620_0006186 Ga0495620_0006186_4299_5102 250
547 3300046515 Ga0495620_0007325 Ga0495620_0007325_154_957 250
548 3300046518 Ga0495631_0008128 Ga0495631_0008128_1204_2007 250
549 3300046519 Ga0495632_0090721 Ga0495632_0090721_79_882 250
550 3300046522 Ga0495643_0006578 Ga0495643_0006578_3923_4726 250
551 3300046524 Ga0495648_0062861 Ga0495648_0062861_1104_1907 250
552 3300046526 Ga0495666_0023752 Ga0495666_0023752_1172_1975 250
553 3300046529 Ga0495652_0073859 Ga0495652_0073859_1250_2062 250
554 3300046533 Ga0495640_0012019 Ga0495640_0012019_2566_3369 250
555 3300046533 Ga0495640_0042414 Ga0495640_0042414_339_1151 250
556 3300046535 Ga0495586_0060304 Ga0495586_0060304_177_980 250
557 3300046536 Ga0495587_0163115 Ga0495587_0163115_433_1236 250
558 3300046542 Ga0495597_0026787 Ga0495597_0026787_198_1001 250
559 3300046543 Ga0495645_0007791 Ga0495645_0007791_1196_2008 250
560 3300046543 Ga0495645_0201940 Ga0495645_0201940_74_877 250
561 3300046559 Ga0495667_0020998 Ga0495667_0020998_628_1431 250
562 3300046616 Ga0495668_0050625 Ga0495668_0050625_173_976 250
563 3300046642 Ga0495634_0000101 Ga0495634_0000101_12430_13242 250
564 3300046648 Ga0495611_0014769 Ga0495611_0014769_1020_1823 250
565 3300046660 Ga0495625_0003505 Ga0495625_0003505_8797_9609 250
566 3300046660 Ga0495625_0076350 Ga0495625_0076350_47_850 250
567 3300046663 Ga0495635_0010250 Ga0495635_0010250_3805_4617 250
568 3300046663 Ga0495635_0190819 Ga0495635_0190819_534_1337 250
569 3300046665 Ga0495661_0011434 Ga0495661_0011434_2400_3203 250
570 3300046665 Ga0495661_0112189 Ga0495661_0112189_355_1167 250
571 3300046674 Ga0495588_0004893 Ga0495588_0004893_499_1302 250
572 3300046674 Ga0495588_0006042 Ga0495588_0006042_4199_5011 250
573 3300046675 Ga0495657_0026616 Ga0495657_0026616_179_982 250
574 3300046679 Ga0495623_0037985 Ga0495623_0037985_1322_2125 250
575 3300046680 Ga0495646_0002319 Ga0495646_0002319_523_1326 250
576 3300046683 Ga0495658_0031545 Ga0495658_0031545_845_1657 250
577 3300046689 Ga0495613_0000709 Ga0495613_0000709_8382_9173 250
578 3300046689 Ga0495613_0005664 Ga0495613_0005664_323_1135 250
579 3300046689 Ga0495613_0226624 Ga0495613_0226624_397_1200 250
580 3300046690 Ga0495624_0184081 Ga0495624_0184081_312_1115 250
581 3300046692 Ga0495671_0015852 Ga0495671_0015852_2326_3138 250
582 3300046694 Ga0495649_0039674 Ga0495649_0039674_492_1295 250
583 3300046794 Ga0495589_0003707 Ga0495589_0003707_7050_7862 250
584 3300046794 Ga0495589_0018742 Ga0495589_0018742_383_1186 250
585 3300046794 Ga0495589_0197374 Ga0495589_0197374_51_854 250
586 3300046810 Ga0495660_0047520 Ga0495660_0047520_497_1300 250
587 3300047315 Ga0495581_0001118 Ga0495581_0001118_252_1064 250
588 3300047315 Ga0495581_0124239 Ga0495581_0124239_303_1106 250
589 3300047317 Ga0495604_0000157 Ga0495604_0000157_57387_58199 250
590 3300047317 Ga0495604_0270179 Ga0495604_0270179_141_944 250
591 3300047318 Ga0495636_0002685 Ga0495636_0002685_5763_6566 250
592 3300047321 Ga0495676_0012848 Ga0495676_0012848_6329_7132 250
593 3300047321 Ga0495676_0015066 Ga0495676_0015066_408_1199 250
594 3300047321 Ga0495676_0025899 Ga0495676_0025899_2457_3269 250
595 3300047321 Ga0495676_0028506 Ga0495676_0028506_341_1132 250
596 3300047321 Ga0495676_0072169 Ga0495676_0072169_383_1186 250
597 3300047321 Ga0495676_0072316 Ga0495676_0072316_729_1541 250
598 3300047322 Ga0495680_0046786 Ga0495680_0046786_1749_2552 250
599 3300047443 Ga0495687_000830 Ga0495687_000830_2913_3725 250
600 3300047443 Ga0495687_095925 Ga0495687_095925_179_982 250
601 3300047444 Ga0495675_0033019 Ga0495675_0033019_2469_3272 250
602 3300047444 Ga0495675_0080595 Ga0495675_0080595_193_996 250
603 3300047445 Ga0495677_0120826 Ga0495677_0120826_103_906 250
604 3300047447 Ga0495685_066434 Ga0495685_066434_26_829 250
605 3300047447 Ga0495685_088917 Ga0495685_088917_14_817 250
606 3300047470 Ga0495681_0004221 Ga0495681_0004221_7422_8234 250
607 3300047470 Ga0495681_0031125 Ga0495681_0031125_1642_2445 250
608 3300047470 Ga0495681_0109039 Ga0495681_0109039_222_1025 250
609 3300047472 Ga0495686_0046841 Ga0495686_0046841_1397_2200 250
610 3300047673 Ga0495593_0025313 Ga0495593_0025313_524_1336 250
611 3300048088 Ga0495602_0071117 Ga0495602_0071117_900_1712 250
612 3300048089 Ga0495614_0001144 Ga0495614_0001144_2176_2967 250
613 3300048089 Ga0495614_0046450 Ga0495614_0046450_214_1026 250
614 3300048091 Ga0495626_0129889 Ga0495626_0129889_85_888 250
615 3300048905 Ga0496102_0000164 Ga0496102_0000164_52518_53348 250
616 3300048906 Ga0496103_0001561 Ga0496103_0001561_6714_7544 250
617 3300048912 Ga0496109_0157242 Ga0496109_0157242_473_1276 250
618 3300048921 Ga0496118_0008577 Ga0496118_0008577_4685_5515 250
619 3300049568 Ga0501031_0033051 Ga0501031_0033051_2518_3315 250
620 3300049568 Ga0501031_0196399 Ga0501031_0196399_359_1162 250
621 3300049569 Ga0501032_0029582 Ga0501032_0029582_124_921 250
622 3300049569 Ga0501032_0035790 Ga0501032_0035790_1244_2038 250
623 3300049570 Ga0501033_0001964 Ga0501033_0001964_16941_17744 250
624 3300049570 Ga0501033_0008400 Ga0501033_0008400_49_900 250
625 3300049570 Ga0501033_0267635 Ga0501033_0267635_155_952 250
626 3300049570 Ga0501033_0317098 Ga0501033_0317098_41_883 250
627 3300049571 Ga0501034_0011223 Ga0501034_0011223_6113_6910 250
628 3300049571 Ga0501034_0027632 Ga0501034_0027632_361_1203 250
629 3300049571 Ga0501034_0028951 Ga0501034_0028951_4394_5188 250
630 3300049571 Ga0501034_0185864 Ga0501034_0185864_1142_1993 250
631 3300049571 Ga0501034_0486015 Ga0501034_0486015_315_1109 250
632 3300049572 Ga0501036_0026454 Ga0501036_0026454_861_1655 250
633 3300049572 Ga0501036_0124736 Ga0501036_0124736_473_1324 250
634 3300049572 Ga0501036_0214853 Ga0501036_0214853_383_1225 250
635 3300049573 Ga0501037_0005983 Ga0501037_0005983_925_1719 250
636 3300049573 Ga0501037_0274650 Ga0501037_0274650_48_845 250
637 3300049573 Ga0501037_0423079 Ga0501037_0423079_62_865 250
638 3300049574 Ga0501038_0016566 Ga0501038_0016566_411_1262 250
639 3300049574 Ga0501038_0048752 Ga0501038_0048752_1197_1994 250
640 3300049575 Ga0501039_0107064 Ga0501039_0107064_339_1136 250
641 3300049575 Ga0501039_0144004 Ga0501039_0144004_774_1568 250
642 3300049575 Ga0501039_0154811 Ga0501039_0154811_539_1342 250
643 3300049575 Ga0501039_0247627 Ga0501039_0247627_215_1066 250
644 3300049579 Ga0501043_0001119 Ga0501043_0001119_16589_17440 250
645 3300049579 Ga0501043_0012175 Ga0501043_0012175_4690_5487 250
646 3300049579 Ga0501043_0395965 Ga0501043_0395965_186_989 250
647 3300049580 Ga0501046_0199432 Ga0501046_0199432_287_1090 250
648 3300049580 Ga0501046_0260384 Ga0501046_0260384_282_1184 250
649 3300049581 Ga0501047_0025359 Ga0501047_0025359_472_1266 250
650 3300049581 Ga0501047_0108182 Ga0501047_0108182_1839_2636 250
651 3300049581 Ga0501047_0125811 Ga0501047_0125811_296_1099 250
652 3300049581 Ga0501047_0208539 Ga0501047_0208539_662_1513 250
653 3300049586 Ga0501070_0039469 Ga0501070_0039469_2508_3302 250
654 3300049586 Ga0501070_0135970 Ga0501070_0135970_257_1108 250
655 3300049586 Ga0501070_0272429 Ga0501070_0272429_99_911 250
656 3300049590 Ga0501074_0073420 Ga0501074_0073420_53_904 250
657 3300049742 Ga0501080_0009424 Ga0501080_0009424_5943_6746 250
658 3300049822 Ga0501035_0076126 Ga0501035_0076126_581_1378 250
659 3300049822 Ga0501035_0151575 Ga0501035_0151575_880_1674 250
660 3300049823 Ga0501044_0003673 Ga0501044_0003673_12129_12932 250
661 3300049823 Ga0501044_0014813 Ga0501044_0014813_3492_4394 250
662 3300049823 Ga0501044_0073080 Ga0501044_0073080_413_1264 250
663 3300049823 Ga0501044_0140646 Ga0501044_0140646_1529_2323 250
664 3300049823 Ga0501044_0174026 Ga0501044_0174026_894_1688 250
665 3300049824 Ga0501045_0256243 Ga0501045_0256243_331_1128 250
666 3300050492 nmdc:mga0yw44_161365_c1 nmdc:mga0yw44_161365_c1_144_950 250
667 3300050495 nmdc:mga04h51_1911_c1 nmdc:mga04h51_1911_c1_2280_3083 250
668 3300050496 nmdc:mga07m45_198089_c1 nmdc:mga07m45_198089_c1_288_1100 250
669 3300053078 Ga0495612_0150042 Ga0495612_0150042_130_942 250
670 3300053083 Ga0495655_0007409 Ga0495655_0007409_1139_1942 250
671 3300053085 Ga0495619_0213089 Ga0495619_0213089_111_914 250
672 3300053092 Ga0500583_0175554 Ga0500583_0175554_141_953 250
673 3300053095 Ga0500640_004906 Ga0500640_004906_3562_4374 250
674 3300053101 Ga0500553_103176 Ga0500553_103176_355_1167 250
675 3300053107 Ga0500560_009278 Ga0500560_009278_56_868 250
676 3300053111 Ga0500572_006859 Ga0500572_006859_1058_1870 250
677 3300053140 Ga0500573_0036186 Ga0500573_0036186_854_1645 250
678 3300061719 Ga0466962_0000045 Ga0466962_0000045_35696_36511 250
679 iso_pu_bacteria 2582581313 2585307494 250
680 iso_pu_bacteria 2643221647 2644270756 250
681 iso_pu_bacteria 2784746768 2785367578 250
682 iso_pu_bacteria 2786546132 2786668638 250
683 iso_pu_bacteria 2862290372 2862293125 250
684 iso_pu_bacteria 2867428634 2867438042 250
685 iso_pu_bacteria 2877676314 2877682970 250
686 iso_pu_bacteria 2954380949 2954388187 250
687 iso_pu_bacteria 2954673503 2954674916 250
688 iso_pu_bacteria 2954682443 2954689219 250
689 iso_pu_bacteria 2954691527 2954698992 250
690 iso_pu_bacteria 2954701450 2954703229 250
691 iso_pu_bacteria 2954711539 2954717946 250
692 iso_pu_bacteria 2954721474 2954727912 250
693 iso_pu_bacteria 2954731030 2954733892 250
694 iso_pu_bacteria 2954740390 2954746810 250
695 iso_pu_bacteria 2954749733 2954752775 250
696 iso_pu_bacteria 2954759201 2954765925 250
697 iso_pu_bacteria 8056447290 8056451659 250
698 3300020070 Ga0206356_11557667 Ga0206356_115576672 251
699 3300025932 Ga0207690_10156077 Ga0207690_101560772 251
700 iso_pu_bacteria 2891554331 2891562317 251
701 3300013307 Ga0157372_10256350 Ga0157372_102563502 252
702 3300031995 Ga0307409_100078736 Ga0307409_1000787362 252
703 3300054114 Ga0501084_0125367 Ga0501084_0125367_447_1250 252
704 3300001989 JGI24739J22299_10002243 JGI24739J22299_100022432 254
705 3300002067 JGI24735J21928_10019146 JGI24735J21928_100191462 254
706 3300005840 Ga0068870_10191954 Ga0068870_101919542 254
707 3300013105 Ga0157369_10490256 Ga0157369_104902561 254
708 3300013307 Ga0157372_10168322 Ga0157372_101683222 254
709 3300013308 Ga0157375_10761319 Ga0157375_107613192 254
710 3300025904 Ga0207647_10008441 Ga0207647_100084412 254
711 3300025904 Ga0207647_10130559 Ga0207647_101305592 254
712 3300031456 Ga0307513_10157480 Ga0307513_101574802 254
713 3300031456 Ga0307513_10454171 Ga0307513_104541712 254
714 3300049823 Ga0501044_0640362 Ga0501044_0640362_18_782 254
715 3300059424 Ga0590075_033321 Ga0590075_033321_23_862 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

53

294

0.86

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

58

296

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jsb-assembly1.cif.gz_A crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx 0.977 2 252
4omr-assembly1.cif.gz_A crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx in complex with acetoacetyl-coa 0.9652 2 248
4jvt-assembly1.cif.gz_A crystal structure of tfu_1878, a putative enoyl-coa hydratase fromthermobifida fusca yx in complex with coa 0.9615 2 251
4jsb-assembly1.cif.gz_A crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx 0.9467 2 252
4omr-assembly1.cif.gz_A crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx in complex with acetoacetyl-coa 0.9242 2 248
ID Description Score Start End Superfamily
4jvtA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9911 212 251 1.10.12.10
4omrA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9726 212 248 1.10.12.10
4jvtA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9449 212 251 1.10.12.10
4omrA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.944 3 211 3.90.226.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.936 110 209 3.90.226.20
ID Description Score Start End GO Terms
AF-A0A542DUQ4-F1-model_v4 Enoyl-CoA hydratase 0.9992 1 254 GO:0006631
GO:0016853
AF-A0A7W7M7L7-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9938 83 251 GO:0003824
GO:0006635
AF-A0A561BZX7-F1-model_v4 Enoyl-CoA hydratase 0.9934 1 254 GO:0006635
GO:0016853
AF-A0A4S5B4L5-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9898 2 252 GO:0016853
AF-A0A561BZX7-F1-model_v4 Enoyl-CoA hydratase 0.9895 1 254 GO:0006635
GO:0016853

Feature Viewer

pLDDT pTM Quality
95.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map