F477014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 419 | 604 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300049580|Ga0501046_0260384|Ga0501046_0260384_282_1184 |
| Length | 300 |
| Sequence | MSAHGLARLCATVRTQDDGTHRRRTMASPEHDHEPVRTSAPDPVLDQDGVRLTVDDAIATVTLTNPAKRNAQSPALWRALTAAGRLLPGSVRVVQLRAEGKSFSAGLDRQAFTPEGFDGEPSFIDLARGADAELDAAVAEYQEAFTWWRRSDIVSVAAVQGHAIGAGFQLALACDLRVVADDAQFAMRETGLGLVPDLAGTHPLVGLVGYARALQICVTGRFVAAEEAVHTGLANLAVPREQLDATVADLTSAILAAPRSAVIETKALLQGAQGRSYEEQRAAERQAQARRLRDLAGLGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 5 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 6 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 7 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 8 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 9 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 10 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 11 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 12 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 13 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 14 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 15 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 16 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 17 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 18 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 19 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 20 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 21 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 22 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 23 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 24 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 25 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 26 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 27 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 28 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 29 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 30 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 31 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 32 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 33 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 34 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 35 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 36 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 37 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 38 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 39 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 40 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 41 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 42 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 43 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 44 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 45 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 46 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 47 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 48 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 49 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 50 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 51 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 52 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 53 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 54 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 55 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 56 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 57 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 58 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 59 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 60 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 61 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 62 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 63 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 64 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 65 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 66 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 67 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 68 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 69 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 70 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 71 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 72 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 73 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 74 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 75 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 76 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 77 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 78 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 79 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 80 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 81 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 82 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 83 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 84 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 85 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 86 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 87 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 88 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 89 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 90 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 91 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 92 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 93 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 94 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 95 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 99 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 117 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 118 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 129 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 155 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 231 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 232 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 238 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 239 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 240 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 241 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 242 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 243 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 244 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 387 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 388 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 389 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 390 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 392 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 398 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 399 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 400 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 401 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 402 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 403 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 404 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 405 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 406 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 407 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 408 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 409 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 410 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 411 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 412 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 413 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 414 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 415 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 416 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 417 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 418 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 419 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.52 |
| Metatranscriptomes | 1.96 |
| Isolates | 15.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0.84 |
| Rhizoplane | 2.24 |
| Rhizosphere | 81.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002243 | 3300001989 | Bacteria | 7429 |
| 2 | JGI24735J21928_10019146 | 3300002067 | Bacteria | 2105 |
| 3 | JGI24735J21928_10020594 | 3300002067 | Bacteria | 2019 |
| 4 | rootH1_10040607 | 3300003316 | Bacteria | 5372 |
| 5 | rootL2_10026369 | 3300003322 | Bacteria | 4525 |
| 6 | rootH1_10042801 | 3300003323 | Bacteria | 4898 |
| 7 | rootH1_10051479 | 3300003323 | Bacteria | 5611 |
| 8 | JGI25160J50197_1005533 | 3300003354 | Bacteria | 5243 |
| 9 | Ga0070658_10000119 | 3300005327 | Bacteria | 71128 |
| 10 | Ga0070658_10067691 | 3300005327 | Bacteria | 2918 |
| 11 | Ga0070658_10154233 | 3300005327 | Bacteria | 1925 |
| 12 | Ga0070658_10364508 | 3300005327 | Bacteria | 1238 |
| 13 | Ga0070683_100163068 | 3300005329 | Bacteria | 2115 |
| 14 | Ga0068869_100122383 | 3300005334 | Bacteria | 1991 |
| 15 | Ga0070680_100011790 | 3300005336 | Bacteria | 6779 |
| 16 | Ga0070680_100017571 | 3300005336 | Bacteria | 5642 |
| 17 | Ga0070692_10044010 | 3300005345 | Bacteria | 2298 |
| 18 | Ga0070671_100286970 | 3300005355 | Bacteria | 1400 |
| 19 | Ga0070673_100191516 | 3300005364 | Bacteria | 1757 |
| 20 | Ga0070659_100000362 | 3300005366 | Bacteria | 34592 |
| 21 | Ga0070709_10037259 | 3300005434 | Bacteria | 2969 |
| 22 | Ga0070709_10083032 | 3300005434 | Bacteria | 2095 |
| 23 | Ga0070714_100457753 | 3300005435 | Bacteria | 1212 |
| 24 | Ga0070713_100008754 | 3300005436 | Bacteria | 7201 |
| 25 | Ga0070663_100284716 | 3300005455 | Bacteria | 1318 |
| 26 | Ga0070681_10320784 | 3300005458 | Bacteria | 1459 |
| 27 | Ga0070685_10251434 | 3300005466 | Bacteria | 1171 |
| 28 | Ga0070679_100092767 | 3300005530 | Bacteria | 3007 |
| 29 | Ga0070679_100366819 | 3300005530 | Bacteria | 1387 |
| 30 | Ga0070684_100150005 | 3300005535 | Bacteria | 2111 |
| 31 | Ga0070684_100157725 | 3300005535 | Bacteria | 2058 |
| 32 | Ga0068853_100037542 | 3300005539 | Bacteria | 4122 |
| 33 | Ga0068853_100045056 | 3300005539 | Bacteria | 3778 |
| 34 | Ga0070665_100066681 | 3300005548 | Bacteria | 3610 |
| 35 | Ga0068855_100012299 | 3300005563 | Bacteria | 10341 |
| 36 | Ga0068855_100454258 | 3300005563 | Bacteria | 1397 |
| 37 | Ga0068854_100064116 | 3300005578 | Bacteria | 2669 |
| 38 | Ga0068852_100157836 | 3300005616 | Bacteria | 2115 |
| 39 | Ga0068859_100059737 | 3300005617 | Bacteria | 3841 |
| 40 | Ga0068870_10001458 | 3300005840 | Bacteria | 9574 |
| 41 | Ga0068870_10191954 | 3300005840 | Bacteria | 1233 |
| 42 | Ga0081540_1001328 | 3300005983 | Bacteria | 21591 |
| 43 | Ga0081540_1005111 | 3300005983 | Bacteria | 9842 |
| 44 | Ga0070717_10298340 | 3300006028 | Bacteria | 1432 |
| 45 | Ga0075365_10163336 | 3300006038 | Bacteria | 1552 |
| 46 | Ga0075368_10001944 | 3300006042 | Bacteria | 6655 |
| 47 | Ga0075363_100027879 | 3300006048 | Bacteria | 2900 |
| 48 | Ga0070716_100091100 | 3300006173 | Bacteria | 1846 |
| 49 | Ga0075367_10013085 | 3300006178 | Bacteria | 4446 |
| 50 | Ga0075428_100013985 | 3300006844 | Bacteria | 8934 |
| 51 | Ga0075430_100001131 | 3300006846 | Bacteria | 21253 |
| 52 | Ga0075431_100037399 | 3300006847 | Bacteria | 5001 |
| 53 | Ga0075429_100003197 | 3300006880 | Bacteria | 13930 |
| 54 | Ga0097620_100059737 | 3300006931 | Bacteria | 3841 |
| 55 | Ga0099826_10052161 | 3300006948 | Bacteria | 2735 |
| 56 | Ga0105251_10032904 | 3300009011 | Bacteria | 2579 |
| 57 | Ga0105244_10128650 | 3300009036 | Bacteria | 1223 |
| 58 | Ga0105250_10030904 | 3300009092 | Bacteria | 2152 |
| 59 | Ga0105240_10058110 | 3300009093 | Bacteria | 4829 |
| 60 | Ga0105245_10281268 | 3300009098 | Bacteria | 1626 |
| 61 | Ga0114129_10026919 | 3300009147 | Bacteria | 8140 |
| 62 | Ga0114129_10214171 | 3300009147 | Bacteria | 2602 |
| 63 | Ga0105241_10005515 | 3300009174 | Bacteria | 9349 |
| 64 | Ga0105248_10363585 | 3300009177 | Bacteria | 1629 |
| 65 | Ga0105237_10123767 | 3300009545 | Bacteria | 2580 |
| 66 | Ga0105237_10196552 | 3300009545 | Bacteria | 2017 |
| 67 | Ga0105238_10009385 | 3300009551 | Bacteria | 9792 |
| 68 | Ga0105238_10644227 | 3300009551 | Bacteria | 1069 |
| 69 | Ga0105249_10070800 | 3300009553 | Bacteria | 3220 |
| 70 | Ga0105239_10066106 | 3300010375 | Bacteria | 3972 |
| 71 | Ga0105246_10024357 | 3300011119 | Bacteria | 3931 |
| 72 | Ga0105246_10156675 | 3300011119 | Bacteria | 1730 |
| 73 | Ga0157371_10198127 | 3300013102 | Bacteria | 1439 |
| 74 | Ga0157369_10000797 | 3300013105 | Bacteria | 40264 |
| 75 | Ga0157369_10001259 | 3300013105 | Bacteria | 31492 |
| 76 | Ga0157369_10134630 | 3300013105 | Bacteria | 2617 |
| 77 | Ga0157369_10200329 | 3300013105 | Bacteria | 2096 |
| 78 | Ga0157369_10215827 | 3300013105 | Bacteria | 2009 |
| 79 | Ga0157369_10490256 | 3300013105 | Bacteria | 1272 |
| 80 | Ga0157378_10238951 | 3300013297 | Bacteria | 1735 |
| 81 | Ga0157372_10168322 | 3300013307 | Bacteria | 2535 |
| 82 | Ga0157372_10256350 | 3300013307 | Bacteria | 2031 |
| 83 | Ga0157372_10308935 | 3300013307 | Bacteria | 1840 |
| 84 | Ga0157375_10761319 | 3300013308 | Bacteria | 1119 |
| 85 | Ga0157380_10072340 | 3300014326 | Bacteria | 2792 |
| 86 | Ga0182008_10006694 | 3300014497 | Bacteria | 6415 |
| 87 | Ga0157376_10083823 | 3300014969 | Bacteria | 2743 |
| 88 | Ga0182007_10002052 | 3300015262 | Bacteria | 10343 |
| 89 | Ga0183367_1007 | 3300015688 | Bacteria | 498079 |
| 90 | Ga0197907_10194450 | 3300020069 | Bacteria | 1138 |
| 91 | Ga0197907_11404546 | 3300020069 | Bacteria | 2956 |
| 92 | Ga0206356_11157171 | 3300020070 | Bacteria | 985 |
| 93 | Ga0206356_11557667 | 3300020070 | Bacteria | 1124 |
| 94 | Ga0206356_11754385 | 3300020070 | Bacteria | 989 |
| 95 | Ga0206352_10458276 | 3300020078 | Bacteria | 1103 |
| 96 | Ga0206350_10992698 | 3300020080 | Bacteria | 1789 |
| 97 | Ga0206354_10608928 | 3300020081 | Bacteria | 2289 |
| 98 | Ga0206353_10245330 | 3300020082 | Bacteria | 2282 |
| 99 | Ga0224712_10012653 | 3300022467 | Bacteria | 2661 |
| 100 | Ga0224712_10017830 | 3300022467 | Bacteria | 2361 |
| 101 | Ga0224712_10141230 | 3300022467 | Bacteria | 1060 |
| 102 | Ga0224712_10141777 | 3300022467 | Bacteria | 1058 |
| 103 | Ga0209758_1009625 | 3300025297 | Bacteria | 5960 |
| 104 | Ga0207426_1001708 | 3300025302 | Bacteria | 16860 |
| 105 | Ga0207426_1002372 | 3300025302 | Bacteria | 12199 |
| 106 | Ga0207713_1022981 | 3300025735 | Bacteria | 2946 |
| 107 | Ga0207647_10001793 | 3300025904 | Bacteria | 16439 |
| 108 | Ga0207647_10008441 | 3300025904 | Bacteria | 7388 |
| 109 | Ga0207647_10019779 | 3300025904 | Bacteria | 4522 |
| 110 | Ga0207647_10130559 | 3300025904 | Bacteria | 1477 |
| 111 | Ga0207699_10051951 | 3300025906 | Bacteria | 2424 |
| 112 | Ga0207643_10000642 | 3300025908 | Bacteria | 21849 |
| 113 | Ga0207705_10002817 | 3300025909 | Bacteria | 13293 |
| 114 | Ga0207705_10024594 | 3300025909 | Bacteria | 4297 |
| 115 | Ga0207705_10157882 | 3300025909 | Bacteria | 1702 |
| 116 | Ga0207695_10001103 | 3300025913 | Bacteria | 46908 |
| 117 | Ga0207695_10456643 | 3300025913 | Bacteria | 1161 |
| 118 | Ga0207671_10000389 | 3300025914 | Bacteria | 61710 |
| 119 | Ga0207660_10014899 | 3300025917 | Bacteria | 5125 |
| 120 | Ga0207660_10185982 | 3300025917 | Bacteria | 1616 |
| 121 | Ga0207657_10015561 | 3300025919 | Bacteria | 7365 |
| 122 | Ga0207657_10107522 | 3300025919 | Bacteria | 2307 |
| 123 | Ga0207649_10149166 | 3300025920 | Bacteria | 1609 |
| 124 | Ga0207652_10073273 | 3300025921 | Bacteria | 2979 |
| 125 | Ga0207652_10129549 | 3300025921 | Bacteria | 2249 |
| 126 | Ga0207694_10000549 | 3300025924 | Bacteria | 34007 |
| 127 | Ga0207700_10004997 | 3300025928 | Bacteria | 7884 |
| 128 | Ga0207664_10041633 | 3300025929 | Bacteria | 3580 |
| 129 | Ga0207690_10003378 | 3300025932 | Bacteria | 9539 |
| 130 | Ga0207690_10012941 | 3300025932 | Bacteria | 5000 |
| 131 | Ga0207690_10156077 | 3300025932 | Bacteria | 1696 |
| 132 | Ga0207691_10112322 | 3300025940 | Bacteria | 2422 |
| 133 | Ga0207689_10117215 | 3300025942 | Bacteria | 2189 |
| 134 | Ga0207661_10025764 | 3300025944 | Bacteria | 4475 |
| 135 | Ga0207661_10097167 | 3300025944 | Bacteria | 2466 |
| 136 | Ga0207661_10686343 | 3300025944 | Bacteria | 942 |
| 137 | Ga0207667_10078377 | 3300025949 | Bacteria | 3424 |
| 138 | Ga0207667_10332896 | 3300025949 | Bacteria | 1550 |
| 139 | Ga0207703_10546639 | 3300026035 | Bacteria | 1092 |
| 140 | Ga0207639_10061430 | 3300026041 | Bacteria | 2902 |
| 141 | Ga0207678_10050866 | 3300026067 | Bacteria | 3579 |
| 142 | Ga0207678_10053356 | 3300026067 | Bacteria | 3484 |
| 143 | Ga0207702_10033501 | 3300026078 | Bacteria | 4291 |
| 144 | Ga0207702_10347367 | 3300026078 | Bacteria | 1418 |
| 145 | Ga0207641_10284676 | 3300026088 | Bacteria | 1556 |
| 146 | Ga0207698_10016593 | 3300026142 | Bacteria | 4970 |
| 147 | Ga0207698_10292764 | 3300026142 | Bacteria | 1512 |
| 148 | Ga0209371_1007004 | 3300027312 | Bacteria | 4030 |
| 149 | Ga0209813_10003133 | 3300027866 | Bacteria | 3844 |
| 150 | Ga0268266_10164251 | 3300028379 | Bacteria | 2010 |
| 151 | Ga0307517_10084604 | 3300028786 | Bacteria | 2668 |
| 152 | Ga0307515_10001938 | 3300028794 | Bacteria | 45899 |
| 153 | Ga0307515_10033218 | 3300028794 | Bacteria | 8505 |
| 154 | Ga0307515_10188196 | 3300028794 | Bacteria | 1985 |
| 155 | Ga0268256_1006497 | 3300030500 | Bacteria | 4335 |
| 156 | Ga0307511_10003550 | 3300030521 | Bacteria | 16000 |
| 157 | Ga0307511_10180594 | 3300030521 | Bacteria | 1138 |
| 158 | Ga0307512_10060873 | 3300030522 | Bacteria | 2914 |
| 159 | Ga0307513_10018658 | 3300031456 | Bacteria | 8284 |
| 160 | Ga0307513_10044671 | 3300031456 | Bacteria | 4851 |
| 161 | Ga0307513_10054304 | 3300031456 | Bacteria | 4297 |
| 162 | Ga0307513_10157480 | 3300031456 | Bacteria | 2169 |
| 163 | Ga0307513_10454171 | 3300031456 | Bacteria | 1005 |
| 164 | Ga0307509_10018531 | 3300031507 | Bacteria | 7979 |
| 165 | Ga0307408_100119461 | 3300031548 | Bacteria | 2040 |
| 166 | Ga0307508_10049368 | 3300031616 | Bacteria | 3748 |
| 167 | Ga0307508_10165784 | 3300031616 | Bacteria | 1812 |
| 168 | Ga0307514_10034295 | 3300031649 | Bacteria | 4045 |
| 169 | Ga0307514_10102841 | 3300031649 | Bacteria | 2047 |
| 170 | Ga0307514_10158100 | 3300031649 | Bacteria | 1506 |
| 171 | Ga0307514_10229729 | 3300031649 | Bacteria | 1126 |
| 172 | Ga0316576_10003510 | 3300031727 | Bacteria | 9210 |
| 173 | Ga0307516_10004291 | 3300031730 | Bacteria | 17697 |
| 174 | Ga0307516_10208241 | 3300031730 | Bacteria | 1671 |
| 175 | Ga0307405_10014517 | 3300031731 | Bacteria | 4238 |
| 176 | Ga0307405_10356312 | 3300031731 | Bacteria | 1130 |
| 177 | Ga0307413_10298328 | 3300031824 | Bacteria | 1221 |
| 178 | Ga0307410_10031789 | 3300031852 | Bacteria | 3391 |
| 179 | Ga0307410_10032066 | 3300031852 | Bacteria | 3377 |
| 180 | Ga0307410_10089745 | 3300031852 | Bacteria | 2178 |
| 181 | Ga0307406_10194509 | 3300031901 | Bacteria | 1488 |
| 182 | Ga0307406_10548398 | 3300031901 | Bacteria | 945 |
| 183 | Ga0307407_10035351 | 3300031903 | Bacteria | 2744 |
| 184 | Ga0307407_10101498 | 3300031903 | Bacteria | 1787 |
| 185 | Ga0307407_10233344 | 3300031903 | Bacteria | 1251 |
| 186 | Ga0307412_10284096 | 3300031911 | Bacteria | 1300 |
| 187 | Ga0307409_100013836 | 3300031995 | Bacteria | 5216 |
| 188 | Ga0307409_100028034 | 3300031995 | Bacteria | 4004 |
| 189 | Ga0307409_100078736 | 3300031995 | Bacteria | 2653 |
| 190 | Ga0307409_100082463 | 3300031995 | Bacteria | 2603 |
| 191 | Ga0307409_100170756 | 3300031995 | Bacteria | 1914 |
| 192 | Ga0307409_100180311 | 3300031995 | Bacteria | 1869 |
| 193 | Ga0307409_100181099 | 3300031995 | Bacteria | 1865 |
| 194 | Ga0307409_100210291 | 3300031995 | Bacteria | 1748 |
| 195 | Ga0307416_100026483 | 3300032002 | Bacteria | 4274 |
| 196 | Ga0307416_100052841 | 3300032002 | Bacteria | 3255 |
| 197 | Ga0307416_100114809 | 3300032002 | Bacteria | 2383 |
| 198 | Ga0307416_100133476 | 3300032002 | Bacteria | 2240 |
| 199 | Ga0307414_10046683 | 3300032004 | Bacteria | 2975 |
| 200 | Ga0307414_10088751 | 3300032004 | Bacteria | 2289 |
| 201 | Ga0307414_10120395 | 3300032004 | Bacteria | 2017 |
| 202 | Ga0307411_10178979 | 3300032005 | Bacteria | 1607 |
| 203 | Ga0307411_10252921 | 3300032005 | Bacteria | 1386 |
| 204 | Ga0307415_100006290 | 3300032126 | Bacteria | 6384 |
| 205 | Ga0307415_100052350 | 3300032126 | Bacteria | 2776 |
| 206 | Ga0307415_100085707 | 3300032126 | Bacteria | 2264 |
| 207 | Ga0307415_100166149 | 3300032126 | Bacteria | 1716 |
| 208 | Ga0307415_100193515 | 3300032126 | Bacteria | 1607 |
| 209 | Ga0307415_100345676 | 3300032126 | Bacteria | 1250 |
| 210 | Ga0316585_10017413 | 3300032137 | Bacteria | 2172 |
| 211 | Ga0316585_10019269 | 3300032137 | Bacteria | 2079 |
| 212 | Ga0307507_10049533 | 3300033179 | Bacteria | 4069 |
| 213 | Ga0307507_10119453 | 3300033179 | Bacteria | 2115 |
| 214 | Ga0307510_10051295 | 3300033180 | Bacteria | 4364 |
| 215 | Ga0307510_10067663 | 3300033180 | Bacteria | 3593 |
| 216 | Ga0307510_10073100 | 3300033180 | Bacteria | 3400 |
| 217 | Ga0307510_10233274 | 3300033180 | Bacteria | 1341 |
| 218 | Ga0373951_0000211 | 3300035091 | Bacteria | 20847 |
| 219 | Ga0373954_0039353 | 3300035118 | Bacteria | 2201 |
| 220 | Ga0316574_0024247 | 3300035398 | Bacteria | 3629 |
| 221 | Ga0316574_0026269 | 3300035398 | Bacteria | 3500 |
| 222 | Ga0316584_0027632 | 3300036712 | Bacteria | 4177 |
| 223 | Ga0395899_0110433 | 3300037312 | Bacteria | 1978 |
| 224 | Ga0395899_0200255 | 3300037312 | Bacteria | 1393 |
| 225 | Ga0395900_0055090 | 3300037418 | Bacteria | 4094 |
| 226 | Ga0395898_0003059 | 3300037466 | Bacteria | 18948 |
| 227 | Ga0395898_0015951 | 3300037466 | Bacteria | 7698 |
| 228 | Ga0395905_0139086 | 3300037471 | Bacteria | 2285 |
| 229 | Ga0316581_0000691 | 3300037588 | Bacteria | 6864 |
| 230 | Ga0436364_0586317 | 3300037853 | Bacteria | 24910 |
| 231 | Ga0395901_0093166 | 3300038443 | Bacteria | 3154 |
| 232 | Ga0395901_0103238 | 3300038443 | Bacteria | 2991 |
| 233 | Ga0395901_0440555 | 3300038443 | Bacteria | 1334 |
| 234 | Ga0436363_1668436 | 3300039450 | Bacteria | 1668 |
| 235 | Ga0439436_0000389 | 3300041404 | Bacteria | 10964 |
| 236 | Ga0439436_0025102 | 3300041404 | Bacteria | 1753 |
| 237 | Ga0439439_0009805 | 3300041406 | Bacteria | 2284 |
| 238 | Ga0451837_1623308 | 3300041494 | Bacteria | 2521 |
| 239 | Ga0451853_0695299 | 3300041512 | Bacteria | 1441 |
| 240 | Ga0451853_1849776 | 3300041512 | Bacteria | 2270 |
| 241 | Ga0451853_1912804 | 3300041512 | Bacteria | 3257 |
| 242 | Ga0439433_0000389 | 3300041999 | Bacteria | 7892 |
| 243 | Ga0439448_0079160 | 3300042005 | Bacteria | 1102 |
| 244 | Ga0439432_062307 | 3300042006 | Bacteria | 1148 |
| 245 | Ga0439449_0000989 | 3300042007 | Bacteria | 11165 |
| 246 | Ga0439457_000487 | 3300042014 | Bacteria | 11471 |
| 247 | Ga0439457_002703 | 3300042014 | Bacteria | 4993 |
| 248 | Ga0439457_017355 | 3300042014 | Bacteria | 1598 |
| 249 | Ga0450894_000118 | 3300042131 | Bacteria | 13523 |
| 250 | Ga0450896_001022 | 3300042133 | Bacteria | 3270 |
| 251 | Ga0450898_001468 | 3300042134 | Bacteria | 3112 |
| 252 | Ga0450906_004237 | 3300042145 | Bacteria | 3018 |
| 253 | Ga0439458_0003052 | 3300042157 | Bacteria | 3990 |
| 254 | Ga0466969_0001961 | 3300044656 | Bacteria | 11000 |
| 255 | Ga0466969_0003315 | 3300044656 | Bacteria | 8564 |
| 256 | Ga0466969_0029153 | 3300044656 | Bacteria | 2820 |
| 257 | Ga0466969_0085596 | 3300044656 | Bacteria | 1498 |
| 258 | Ga0466972_0006482 | 3300044658 | Bacteria | 5877 |
| 259 | Ga0466972_0024209 | 3300044658 | Bacteria | 3013 |
| 260 | Ga0466972_0085269 | 3300044658 | Bacteria | 1501 |
| 261 | Ga0466972_0097482 | 3300044658 | Bacteria | 1392 |
| 262 | Ga0466965_0013412 | 3300044683 | Bacteria | 3867 |
| 263 | Ga0466965_0057981 | 3300044683 | Bacteria | 1931 |
| 264 | Ga0466965_0112909 | 3300044683 | Bacteria | 1398 |
| 265 | Ga0466966_0000938 | 3300044684 | Bacteria | 18615 |
| 266 | Ga0466966_0018211 | 3300044684 | Bacteria | 4634 |
| 267 | Ga0466966_0019368 | 3300044684 | Bacteria | 4477 |
| 268 | Ga0466966_0119600 | 3300044684 | Bacteria | 1619 |
| 269 | Ga0466961_0000931 | 3300044693 | Bacteria | 18166 |
| 270 | Ga0466961_0003176 | 3300044693 | Bacteria | 10229 |
| 271 | Ga0466961_0013288 | 3300044693 | Bacteria | 5269 |
| 272 | Ga0466961_0023414 | 3300044693 | Bacteria | 3974 |
| 273 | Ga0466961_0113162 | 3300044693 | Bacteria | 1706 |
| 274 | Ga0466961_0355004 | 3300044693 | Bacteria | 892 |
| 275 | Ga0466963_0000235 | 3300044694 | Bacteria | 23900 |
| 276 | Ga0466963_0000589 | 3300044694 | Bacteria | 17310 |
| 277 | Ga0466963_0197104 | 3300044694 | Unclassified | 1408 |
| 278 | Ga0466964_0037189 | 3300044706 | Bacteria | 1954 |
| 279 | Ga0466971_0000129 | 3300044719 | Bacteria | 27584 |
| 280 | Ga0466971_0000182 | 3300044719 | Bacteria | 23765 |
| 281 | Ga0466970_0000333 | 3300044765 | Bacteria | 23058 |
| 282 | Ga0466970_0001880 | 3300044765 | Bacteria | 10156 |
| 283 | Ga0466970_0081512 | 3300044765 | Bacteria | 1749 |
| 284 | Ga0466970_0194658 | 3300044765 | Bacteria | 1127 |
| 285 | Ga0466957_0012768 | 3300044842 | Bacteria | 4867 |
| 286 | Ga0466957_0244560 | 3300044842 | Bacteria | 1191 |
| 287 | Ga0466960_0003073 | 3300044901 | Bacteria | 6380 |
| 288 | Ga0466960_0019918 | 3300044901 | Bacteria | 2964 |
| 289 | Ga0466959_0002069 | 3300045049 | Bacteria | 12688 |
| 290 | Ga0466959_0021527 | 3300045049 | Bacteria | 4756 |
| 291 | Ga0466959_0045828 | 3300045049 | Bacteria | 3219 |
| 292 | Ga0466959_0132432 | 3300045049 | Bacteria | 1766 |
| 293 | Ga0466959_0235795 | 3300045049 | Bacteria | 1265 |
| 294 | Ga0466959_0256308 | 3300045049 | Bacteria | 1205 |
| 295 | Ga0466958_0040184 | 3300045836 | Bacteria | 2811 |
| 296 | Ga0466958_0092900 | 3300045836 | Bacteria | 1868 |
| 297 | Ga0466958_0142156 | 3300045836 | Bacteria | 1511 |
| 298 | Ga0466958_0209196 | 3300045836 | Bacteria | 1242 |
| 299 | Ga0466967_0018743 | 3300045976 | Bacteria | 5542 |
| 300 | Ga0466967_0022099 | 3300045976 | Bacteria | 5183 |
| 301 | Ga0466967_0099938 | 3300045976 | Bacteria | 2650 |
| 302 | Ga0466967_0144214 | 3300045976 | Bacteria | 2220 |
| 303 | Ga0466967_0577177 | 3300045976 | Bacteria | 1108 |
| 304 | Ga0495617_019949 | 3300046452 | Bacteria | 2265 |
| 305 | Ga0495627_011288 | 3300046453 | Bacteria | 3210 |
| 306 | Ga0495603_0000346 | 3300046455 | Bacteria | 24860 |
| 307 | Ga0495603_0001138 | 3300046455 | Bacteria | 15534 |
| 308 | Ga0495603_0025888 | 3300046455 | Bacteria | 3546 |
| 309 | Ga0495603_0086739 | 3300046455 | Bacteria | 1832 |
| 310 | Ga0495590_0108040 | 3300046457 | Bacteria | 991 |
| 311 | Ga0495629_0004470 | 3300046459 | Bacteria | 10480 |
| 312 | Ga0495629_0033791 | 3300046459 | Bacteria | 3616 |
| 313 | Ga0495629_0139175 | 3300046459 | Bacteria | 1689 |
| 314 | Ga0495629_0292823 | 3300046459 | Bacteria | 1115 |
| 315 | Ga0495638_0132150 | 3300046460 | Bacteria | 1465 |
| 316 | Ga0495651_0000439 | 3300046462 | Bacteria | 32028 |
| 317 | Ga0495651_0002038 | 3300046462 | Bacteria | 15612 |
| 318 | Ga0495651_0011488 | 3300046462 | Bacteria | 6799 |
| 319 | Ga0495651_0138717 | 3300046462 | Bacteria | 1766 |
| 320 | Ga0495651_0164587 | 3300046462 | Bacteria | 1585 |
| 321 | Ga0495653_0003878 | 3300046463 | Bacteria | 12087 |
| 322 | Ga0495653_0142906 | 3300046463 | Bacteria | 1681 |
| 323 | Ga0495580_0043463 | 3300046472 | Bacteria | 3198 |
| 324 | Ga0495582_0239317 | 3300046473 | Bacteria | 1040 |
| 325 | Ga0495605_0007393 | 3300046474 | Bacteria | 6236 |
| 326 | Ga0495662_0006099 | 3300046476 | Bacteria | 6024 |
| 327 | Ga0495662_0029742 | 3300046476 | Bacteria | 2636 |
| 328 | Ga0495662_0133567 | 3300046476 | Bacteria | 1220 |
| 329 | Ga0495664_0003683 | 3300046477 | Bacteria | 8351 |
| 330 | Ga0495664_0027249 | 3300046477 | Bacteria | 3330 |
| 331 | Ga0495664_0138831 | 3300046477 | Bacteria | 1473 |
| 332 | Ga0495585_0041446 | 3300046492 | Bacteria | 2582 |
| 333 | Ga0495585_0109717 | 3300046492 | Bacteria | 1468 |
| 334 | Ga0495585_0124801 | 3300046492 | Bacteria | 1359 |
| 335 | Ga0495594_0023051 | 3300046499 | Bacteria | 3334 |
| 336 | Ga0495596_0126585 | 3300046500 | Bacteria | 992 |
| 337 | Ga0495607_0041936 | 3300046501 | Bacteria | 2715 |
| 338 | Ga0495607_0118011 | 3300046501 | Bacteria | 1397 |
| 339 | Ga0495583_0012198 | 3300046506 | Bacteria | 4879 |
| 340 | Ga0495583_0072072 | 3300046506 | Bacteria | 1516 |
| 341 | Ga0495583_0154112 | 3300046506 | Bacteria | 951 |
| 342 | Ga0495606_0009840 | 3300046507 | Bacteria | 8022 |
| 343 | Ga0495608_0007650 | 3300046511 | Bacteria | 7616 |
| 344 | Ga0495618_0013838 | 3300046514 | Bacteria | 4910 |
| 345 | Ga0495618_0019166 | 3300046514 | Bacteria | 4207 |
| 346 | Ga0495620_0006186 | 3300046515 | Bacteria | 6594 |
| 347 | Ga0495620_0007325 | 3300046515 | Bacteria | 6004 |
| 348 | Ga0495628_0110958 | 3300046516 | Bacteria | 2109 |
| 349 | Ga0495628_0372912 | 3300046516 | Bacteria | 1046 |
| 350 | Ga0495630_0274611 | 3300046517 | Bacteria | 1287 |
| 351 | Ga0495631_0008128 | 3300046518 | Bacteria | 5297 |
| 352 | Ga0495632_0090721 | 3300046519 | Bacteria | 1449 |
| 353 | Ga0495643_0006578 | 3300046522 | Bacteria | 7642 |
| 354 | Ga0495648_0062861 | 3300046524 | Bacteria | 2196 |
| 355 | Ga0495666_0000038 | 3300046526 | Bacteria | 49268 |
| 356 | Ga0495666_0023752 | 3300046526 | Bacteria | 3031 |
| 357 | Ga0495652_0000641 | 3300046529 | Bacteria | 40645 |
| 358 | Ga0495652_0001811 | 3300046529 | Bacteria | 22721 |
| 359 | Ga0495652_0018707 | 3300046529 | Bacteria | 6174 |
| 360 | Ga0495652_0073859 | 3300046529 | Bacteria | 2838 |
| 361 | Ga0495652_0154085 | 3300046529 | Bacteria | 1791 |
| 362 | Ga0495665_0000846 | 3300046531 | Bacteria | 16034 |
| 363 | Ga0495640_0000604 | 3300046533 | Bacteria | 26433 |
| 364 | Ga0495640_0012019 | 3300046533 | Bacteria | 6635 |
| 365 | Ga0495640_0042414 | 3300046533 | Bacteria | 3175 |
| 366 | Ga0495640_0195634 | 3300046533 | Bacteria | 1284 |
| 367 | Ga0495586_0008446 | 3300046535 | Bacteria | 5480 |
| 368 | Ga0495586_0060304 | 3300046535 | Bacteria | 2063 |
| 369 | Ga0495587_0026773 | 3300046536 | Bacteria | 3512 |
| 370 | Ga0495587_0163115 | 3300046536 | Bacteria | 1268 |
| 371 | Ga0495597_0026787 | 3300046542 | Bacteria | 2647 |
| 372 | Ga0495645_0007791 | 3300046543 | Bacteria | 7449 |
| 373 | Ga0495645_0015660 | 3300046543 | Bacteria | 5394 |
| 374 | Ga0495645_0201940 | 3300046543 | Bacteria | 1348 |
| 375 | Ga0495667_0005401 | 3300046559 | Bacteria | 8644 |
| 376 | Ga0495667_0020998 | 3300046559 | Bacteria | 4405 |
| 377 | Ga0495667_0272240 | 3300046559 | Bacteria | 1076 |
| 378 | Ga0495668_0050625 | 3300046616 | Bacteria | 2301 |
| 379 | Ga0495634_0000101 | 3300046642 | Bacteria | 70643 |
| 380 | Ga0495634_0038825 | 3300046642 | Bacteria | 3244 |
| 381 | Ga0495611_0014769 | 3300046648 | Bacteria | 3338 |
| 382 | Ga0495625_0003505 | 3300046660 | Bacteria | 15553 |
| 383 | Ga0495625_0076350 | 3300046660 | Bacteria | 2342 |
| 384 | Ga0495635_0010250 | 3300046663 | Bacteria | 6552 |
| 385 | Ga0495635_0035280 | 3300046663 | Bacteria | 3467 |
| 386 | Ga0495635_0047456 | 3300046663 | Bacteria | 2962 |
| 387 | Ga0495635_0190819 | 3300046663 | Bacteria | 1391 |
| 388 | Ga0495661_0011434 | 3300046665 | Bacteria | 6025 |
| 389 | Ga0495661_0112189 | 3300046665 | Bacteria | 1518 |
| 390 | Ga0495588_0004893 | 3300046674 | Bacteria | 5940 |
| 391 | Ga0495588_0006042 | 3300046674 | Bacteria | 5432 |
| 392 | Ga0495588_0058055 | 3300046674 | Bacteria | 2000 |
| 393 | Ga0495657_0007395 | 3300046675 | Bacteria | 8488 |
| 394 | Ga0495657_0026616 | 3300046675 | Bacteria | 4094 |
| 395 | Ga0495623_0012861 | 3300046679 | Bacteria | 5421 |
| 396 | Ga0495623_0037985 | 3300046679 | Bacteria | 3079 |
| 397 | Ga0495646_0002319 | 3300046680 | Bacteria | 11651 |
| 398 | Ga0495646_0020503 | 3300046680 | Bacteria | 4182 |
| 399 | Ga0495658_0031545 | 3300046683 | Bacteria | 2887 |
| 400 | Ga0495613_0000709 | 3300046689 | Bacteria | 26118 |
| 401 | Ga0495613_0005664 | 3300046689 | Bacteria | 9359 |
| 402 | Ga0495613_0022738 | 3300046689 | Bacteria | 4671 |
| 403 | Ga0495613_0226624 | 3300046689 | Bacteria | 1310 |
| 404 | Ga0495624_0184081 | 3300046690 | Bacteria | 1272 |
| 405 | Ga0495671_0015852 | 3300046692 | Bacteria | 4033 |
| 406 | Ga0495649_0039674 | 3300046694 | Bacteria | 2581 |
| 407 | Ga0495589_0003707 | 3300046794 | Bacteria | 8239 |
| 408 | Ga0495589_0018742 | 3300046794 | Bacteria | 3547 |
| 409 | Ga0495589_0134409 | 3300046794 | Bacteria | 1186 |
| 410 | Ga0495589_0197374 | 3300046794 | Bacteria | 950 |
| 411 | Ga0495600_0012847 | 3300046809 | Bacteria | 5245 |
| 412 | Ga0495600_0019339 | 3300046809 | Bacteria | 4349 |
| 413 | Ga0495600_0028378 | 3300046809 | Bacteria | 3620 |
| 414 | Ga0495660_0047520 | 3300046810 | Bacteria | 2349 |
| 415 | Ga0495581_0001118 | 3300047315 | Bacteria | 14677 |
| 416 | Ga0495581_0029662 | 3300047315 | Bacteria | 3170 |
| 417 | Ga0495581_0093113 | 3300047315 | Bacteria | 1749 |
| 418 | Ga0495581_0124239 | 3300047315 | Bacteria | 1502 |
| 419 | Ga0495604_0000157 | 3300047317 | Bacteria | 59668 |
| 420 | Ga0495604_0001183 | 3300047317 | Bacteria | 21530 |
| 421 | Ga0495604_0270179 | 3300047317 | Bacteria | 1152 |
| 422 | Ga0495636_0002685 | 3300047318 | Bacteria | 6870 |
| 423 | Ga0495636_0006916 | 3300047318 | Bacteria | 4461 |
| 424 | Ga0495636_0149393 | 3300047318 | Bacteria | 1047 |
| 425 | Ga0495674_0130790 | 3300047319 | Unclassified | 2115 |
| 426 | Ga0495676_0012848 | 3300047321 | Bacteria | 7529 |
| 427 | Ga0495676_0015066 | 3300047321 | Bacteria | 6902 |
| 428 | Ga0495676_0025899 | 3300047321 | Bacteria | 5055 |
| 429 | Ga0495676_0028506 | 3300047321 | Bacteria | 4765 |
| 430 | Ga0495676_0072169 | 3300047321 | Bacteria | 2651 |
| 431 | Ga0495676_0072316 | 3300047321 | Bacteria | 2648 |
| 432 | Ga0495680_0046786 | 3300047322 | Bacteria | 3408 |
| 433 | Ga0495687_000830 | 3300047443 | Bacteria | 33048 |
| 434 | Ga0495687_095925 | 3300047443 | Bacteria | 1123 |
| 435 | Ga0495675_0033019 | 3300047444 | Bacteria | 3303 |
| 436 | Ga0495675_0080595 | 3300047444 | Bacteria | 2050 |
| 437 | Ga0495675_0204873 | 3300047444 | Bacteria | 1199 |
| 438 | Ga0495677_0120826 | 3300047445 | Bacteria | 999 |
| 439 | Ga0495685_066434 | 3300047447 | Bacteria | 1211 |
| 440 | Ga0495685_082174 | 3300047447 | Bacteria | 1073 |
| 441 | Ga0495685_088917 | 3300047447 | Bacteria | 1025 |
| 442 | Ga0495681_0004221 | 3300047470 | Bacteria | 9856 |
| 443 | Ga0495681_0031125 | 3300047470 | Bacteria | 2707 |
| 444 | Ga0495681_0109039 | 3300047470 | Bacteria | 1201 |
| 445 | Ga0495684_0029675 | 3300047471 | Bacteria | 4196 |
| 446 | Ga0495686_0046841 | 3300047472 | Bacteria | 2732 |
| 447 | Ga0495593_0025313 | 3300047673 | Bacteria | 3285 |
| 448 | Ga0495593_0080220 | 3300047673 | Bacteria | 1688 |
| 449 | Ga0495602_0071117 | 3300048088 | Bacteria | 2973 |
| 450 | Ga0495614_0001144 | 3300048089 | Bacteria | 11371 |
| 451 | Ga0495614_0046450 | 3300048089 | Bacteria | 1861 |
| 452 | Ga0495626_0129889 | 3300048091 | Bacteria | 1076 |
| 453 | Ga0496101_0533306 | 3300048904 | Bacteria | 928 |
| 454 | Ga0496102_0000164 | 3300048905 | Bacteria | 89355 |
| 455 | Ga0496103_0001561 | 3300048906 | Bacteria | 15145 |
| 456 | Ga0496104_0109526 | 3300048907 | Bacteria | 2647 |
| 457 | Ga0496104_0140269 | 3300048907 | Bacteria | 2322 |
| 458 | Ga0496106_0098428 | 3300048909 | Bacteria | 2266 |
| 459 | Ga0496108_0124877 | 3300048911 | Bacteria | 2209 |
| 460 | Ga0496108_0293992 | 3300048911 | Bacteria | 1414 |
| 461 | Ga0496109_0155240 | 3300048912 | Bacteria | 2144 |
| 462 | Ga0496109_0157242 | 3300048912 | Bacteria | 2129 |
| 463 | Ga0496113_0068423 | 3300048916 | Bacteria | 2694 |
| 464 | Ga0496114_0003598 | 3300048917 | Bacteria | 11908 |
| 465 | Ga0496114_0242156 | 3300048917 | Bacteria | 1586 |
| 466 | Ga0496114_0408633 | 3300048917 | Bacteria | 1202 |
| 467 | Ga0496115_0221633 | 3300048918 | Bacteria | 1561 |
| 468 | Ga0496118_0008577 | 3300048921 | Bacteria | 10521 |
| 469 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 470 | Ga0501308_008026 | 3300049128 | Bacteria | 1120 |
| 471 | Ga0501031_0033051 | 3300049568 | Bacteria | 3373 |
| 472 | Ga0501031_0196399 | 3300049568 | Bacteria | 1317 |
| 473 | Ga0501032_0005828 | 3300049569 | Bacteria | 9112 |
| 474 | Ga0501032_0029582 | 3300049569 | Bacteria | 3758 |
| 475 | Ga0501032_0035790 | 3300049569 | Bacteria | 3392 |
| 476 | Ga0501033_0001964 | 3300049570 | Bacteria | 17900 |
| 477 | Ga0501033_0008400 | 3300049570 | Bacteria | 7998 |
| 478 | Ga0501033_0103465 | 3300049570 | Bacteria | 2076 |
| 479 | Ga0501033_0267635 | 3300049570 | Bacteria | 1208 |
| 480 | Ga0501033_0317098 | 3300049570 | Bacteria | 1095 |
| 481 | Ga0501034_0004159 | 3300049571 | Bacteria | 16188 |
| 482 | Ga0501034_0011223 | 3300049571 | Bacteria | 9304 |
| 483 | Ga0501034_0027632 | 3300049571 | Bacteria | 5770 |
| 484 | Ga0501034_0028951 | 3300049571 | Bacteria | 5633 |
| 485 | Ga0501034_0185864 | 3300049571 | Bacteria | 2041 |
| 486 | Ga0501034_0486015 | 3300049571 | Bacteria | 1150 |
| 487 | Ga0501036_0002938 | 3300049572 | Bacteria | 13533 |
| 488 | Ga0501036_0026454 | 3300049572 | Bacteria | 4897 |
| 489 | Ga0501036_0124736 | 3300049572 | Bacteria | 2174 |
| 490 | Ga0501036_0173465 | 3300049572 | Bacteria | 1816 |
| 491 | Ga0501036_0214853 | 3300049572 | Bacteria | 1615 |
| 492 | Ga0501037_0004856 | 3300049573 | Bacteria | 9780 |
| 493 | Ga0501037_0005983 | 3300049573 | Bacteria | 8887 |
| 494 | Ga0501037_0264859 | 3300049573 | Bacteria | 1200 |
| 495 | Ga0501037_0274650 | 3300049573 | Bacteria | 1175 |
| 496 | Ga0501037_0423079 | 3300049573 | Bacteria | 911 |
| 497 | Ga0501038_0016566 | 3300049574 | Bacteria | 6682 |
| 498 | Ga0501038_0037839 | 3300049574 | Bacteria | 4228 |
| 499 | Ga0501038_0048752 | 3300049574 | Bacteria | 3664 |
| 500 | Ga0501039_0011139 | 3300049575 | Bacteria | 6853 |
| 501 | Ga0501039_0018223 | 3300049575 | Bacteria | 5389 |
| 502 | Ga0501039_0107064 | 3300049575 | Bacteria | 2184 |
| 503 | Ga0501039_0144004 | 3300049575 | Bacteria | 1872 |
| 504 | Ga0501039_0154811 | 3300049575 | Bacteria | 1801 |
| 505 | Ga0501039_0247627 | 3300049575 | Bacteria | 1401 |
| 506 | Ga0501040_0009695 | 3300049576 | Bacteria | 6288 |
| 507 | Ga0501040_0012035 | 3300049576 | Bacteria | 5661 |
| 508 | Ga0501040_0148045 | 3300049576 | Bacteria | 1656 |
| 509 | Ga0501041_0000342 | 3300049577 | Bacteria | 22862 |
| 510 | Ga0501042_0082943 | 3300049578 | Bacteria | 2298 |
| 511 | Ga0501042_0483732 | 3300049578 | Bacteria | 898 |
| 512 | Ga0501043_0001119 | 3300049579 | Bacteria | 23527 |
| 513 | Ga0501043_0002270 | 3300049579 | Bacteria | 16350 |
| 514 | Ga0501043_0012175 | 3300049579 | Bacteria | 6723 |
| 515 | Ga0501043_0395965 | 3300049579 | Bacteria | 1044 |
| 516 | Ga0501046_0015939 | 3300049580 | Bacteria | 6302 |
| 517 | Ga0501046_0017948 | 3300049580 | Bacteria | 5897 |
| 518 | Ga0501046_0199432 | 3300049580 | Bacteria | 1489 |
| 519 | Ga0501046_0260384 | 3300049580 | Bacteria | 1274 |
| 520 | Ga0501047_0000055 | 3300049581 | Bacteria | 144149 |
| 521 | Ga0501047_0002325 | 3300049581 | Bacteria | 18159 |
| 522 | Ga0501047_0025359 | 3300049581 | Bacteria | 5698 |
| 523 | Ga0501047_0108182 | 3300049581 | Bacteria | 2662 |
| 524 | Ga0501047_0125811 | 3300049581 | Bacteria | 2443 |
| 525 | Ga0501047_0208539 | 3300049581 | Bacteria | 1813 |
| 526 | Ga0501048_0009621 | 3300049582 | Bacteria | 7252 |
| 527 | Ga0501048_0009686 | 3300049582 | Bacteria | 7228 |
| 528 | Ga0501067_0007213 | 3300049583 | Bacteria | 6175 |
| 529 | Ga0501068_0001227 | 3300049584 | Bacteria | 13610 |
| 530 | Ga0501069_0266565 | 3300049585 | Bacteria | 1000 |
| 531 | Ga0501070_0015698 | 3300049586 | Bacteria | 6367 |
| 532 | Ga0501070_0039469 | 3300049586 | Bacteria | 3938 |
| 533 | Ga0501070_0135970 | 3300049586 | Bacteria | 2029 |
| 534 | Ga0501070_0272429 | 3300049586 | Bacteria | 1382 |
| 535 | Ga0501071_0010072 | 3300049587 | Bacteria | 6319 |
| 536 | Ga0501072_0006034 | 3300049588 | Bacteria | 9243 |
| 537 | Ga0501072_0009706 | 3300049588 | Bacteria | 7320 |
| 538 | Ga0501073_0020233 | 3300049589 | Bacteria | 4800 |
| 539 | Ga0501074_0040978 | 3300049590 | Bacteria | 3353 |
| 540 | Ga0501074_0073420 | 3300049590 | Bacteria | 2457 |
| 541 | Ga0501075_0012744 | 3300049591 | Bacteria | 5983 |
| 542 | Ga0501076_0015064 | 3300049592 | Bacteria | 5838 |
| 543 | Ga0501076_0614064 | 3300049592 | Bacteria | 897 |
| 544 | Ga0501077_0112064 | 3300049593 | Bacteria | 1729 |
| 545 | Ga0501077_0142108 | 3300049593 | Bacteria | 1522 |
| 546 | Ga0501079_0001125 | 3300049741 | Bacteria | 18628 |
| 547 | Ga0501079_0024022 | 3300049741 | Bacteria | 4676 |
| 548 | Ga0501080_0009424 | 3300049742 | Bacteria | 8906 |
| 549 | Ga0501080_0251487 | 3300049742 | Bacteria | 1611 |
| 550 | Ga0501035_0003717 | 3300049822 | Bacteria | 14549 |
| 551 | Ga0501035_0076126 | 3300049822 | Bacteria | 2967 |
| 552 | Ga0501035_0151575 | 3300049822 | Bacteria | 2011 |
| 553 | Ga0501044_0001280 | 3300049823 | Bacteria | 29717 |
| 554 | Ga0501044_0003673 | 3300049823 | Bacteria | 17257 |
| 555 | Ga0501044_0014813 | 3300049823 | Bacteria | 8406 |
| 556 | Ga0501044_0073080 | 3300049823 | Bacteria | 3486 |
| 557 | Ga0501044_0140646 | 3300049823 | Bacteria | 2402 |
| 558 | Ga0501044_0174026 | 3300049823 | Bacteria | 2122 |
| 559 | Ga0501044_0409672 | 3300049823 | Bacteria | 1267 |
| 560 | Ga0501044_0640362 | 3300049823 | Bacteria | 953 |
| 561 | Ga0501045_0006195 | 3300049824 | Bacteria | 8282 |
| 562 | Ga0501045_0256243 | 3300049824 | Bacteria | 1302 |
| 563 | Ga0501045_0373973 | 3300049824 | Bacteria | 1060 |
| 564 | nmdc:mga03n38_8846_c1 | 3300050490 | Bacteria | 3633 |
| 565 | nmdc:mga0yw44_161365_c1 | 3300050492 | Bacteria | 1467 |
| 566 | nmdc:mga04h51_1911_c1 | 3300050495 | Bacteria | 4867 |
| 567 | nmdc:mga07m45_198089_c1 | 3300050496 | Bacteria | 1168 |
| 568 | nmdc:mga05p37_10699_c1 | 3300050507 | Bacteria | 10890 |
| 569 | nmdc:mga05p37_650239_c1 | 3300050507 | Bacteria | 1181 |
| 570 | nmdc:mga09592_5735_c1 | 3300050508 | Bacteria | 10126 |
| 571 | nmdc:mga0qj67_40175_c1 | 3300050509 | Bacteria | 3677 |
| 572 | nmdc:mga06r32_24334_c1 | 3300050510 | Bacteria | 5619 |
| 573 | Ga0495601_0006666 | 3300053077 | Bacteria | 6759 |
| 574 | Ga0495601_0045368 | 3300053077 | Bacteria | 2763 |
| 575 | Ga0495601_0064359 | 3300053077 | Bacteria | 2332 |
| 576 | Ga0495601_0091398 | 3300053077 | Bacteria | 1959 |
| 577 | Ga0495612_0001094 | 3300053078 | Bacteria | 11097 |
| 578 | Ga0495612_0012093 | 3300053078 | Bacteria | 3477 |
| 579 | Ga0495612_0150042 | 3300053078 | Bacteria | 1014 |
| 580 | Ga0495655_0007409 | 3300053083 | Bacteria | 2039 |
| 581 | Ga0495655_0080842 | 3300053083 | Bacteria | 929 |
| 582 | Ga0495619_0027418 | 3300053085 | Bacteria | 3668 |
| 583 | Ga0495619_0113087 | 3300053085 | Bacteria | 1856 |
| 584 | Ga0495619_0124003 | 3300053085 | Bacteria | 1772 |
| 585 | Ga0495619_0193453 | 3300053085 | Bacteria | 1408 |
| 586 | Ga0495619_0213089 | 3300053085 | Bacteria | 1338 |
| 587 | Ga0500583_0175554 | 3300053092 | Bacteria | 1067 |
| 588 | Ga0500640_004906 | 3300053095 | Bacteria | 4918 |
| 589 | Ga0500553_103176 | 3300053101 | Bacteria | 1221 |
| 590 | Ga0500560_009278 | 3300053107 | Bacteria | 2411 |
| 591 | Ga0500572_006859 | 3300053111 | Bacteria | 2619 |
| 592 | Ga0500580_111849 | 3300053113 | Bacteria | 1055 |
| 593 | Ga0500573_0036186 | 3300053140 | Bacteria | 2850 |
| 594 | Ga0500573_0169886 | 3300053140 | Bacteria | 1180 |
| 595 | Ga0501084_0026251 | 3300054114 | Bacteria | 4858 |
| 596 | Ga0501084_0125367 | 3300054114 | Bacteria | 2161 |
| 597 | Ga0590075_033321 | 3300059424 | Bacteria | 1308 |
| 598 | Ga0501082_0005865 | 3300060353 | Bacteria | 10662 |
| 599 | Ga0501082_0024474 | 3300060353 | Bacteria | 5204 |
| 600 | Ga0466962_0000045 | 3300061719 | Bacteria | 52271 |
| 601 | Ga0466962_0000304 | 3300061719 | Bacteria | 21075 |
| 602 | Ga0466962_0061629 | 3300061719 | Bacteria | 1790 |
| 603 | Ga0466962_0065834 | 3300061719 | Bacteria | 1730 |
| 604 | Ga0530510_0160929 | 3300061734 | Bacteria | 1660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031901 | Ga0307406_10548398 | Ga0307406_105483981 | 205 |
| 2 | 3300035398 | Ga0316574_0024247 | Ga0316574_0024247_668_1471 | 207 |
| 3 | 3300020078 | Ga0206352_10458276 | Ga0206352_104582761 | 208 |
| 4 | 3300032002 | Ga0307416_100114809 | Ga0307416_1001148092 | 208 |
| 5 | 3300031995 | Ga0307409_100028034 | Ga0307409_1000280342 | 209 |
| 6 | 3300032002 | Ga0307416_100026483 | Ga0307416_1000264832 | 209 |
| 7 | 3300032004 | Ga0307414_10046683 | Ga0307414_100466832 | 209 |
| 8 | 3300046500 | Ga0495596_0126585 | Ga0495596_0126585_196_975 | 209 |
| 9 | 3300025944 | Ga0207661_10686343 | Ga0207661_106863431 | 210 |
| 10 | 3300009177 | Ga0105248_10363585 | Ga0105248_103635852 | 211 |
| 11 | 3300048912 | Ga0496109_0155240 | Ga0496109_0155240_1427_2104 | 211 |
| 12 | iso_pu_bacteria | 2929219909 | 2929224514 | 211 |
| 13 | 3300005563 | Ga0068855_100454258 | Ga0068855_1004542582 | 213 |
| 14 | 3300020082 | Ga0206353_10245330 | Ga0206353_102453303 | 213 |
| 15 | 3300013105 | Ga0157369_10001259 | Ga0157369_1000125911 | 214 |
| 16 | 3300020069 | Ga0197907_11404546 | Ga0197907_114045462 | 214 |
| 17 | 3300020081 | Ga0206354_10608928 | Ga0206354_106089282 | 214 |
| 18 | 3300022467 | Ga0224712_10012653 | Ga0224712_100126532 | 214 |
| 19 | 3300025949 | Ga0207667_10332896 | Ga0207667_103328962 | 214 |
| 20 | 3300048918 | Ga0496115_0221633 | Ga0496115_0221633_423_1079 | 214 |
| 21 | 3300037312 | Ga0395899_0110433 | Ga0395899_0110433_625_1446 | 215 |
| 22 | 3300037466 | Ga0395898_0015951 | Ga0395898_0015951_3437_4258 | 215 |
| 23 | 3300038443 | Ga0395901_0103238 | Ga0395901_0103238_541_1362 | 215 |
| 24 | 3300031995 | Ga0307409_100181099 | Ga0307409_1001810992 | 216 |
| 25 | 3300006844 | Ga0075428_100013985 | Ga0075428_1000139852 | 217 |
| 26 | 3300006846 | Ga0075430_100001131 | Ga0075430_10000113123 | 217 |
| 27 | 3300006847 | Ga0075431_100037399 | Ga0075431_1000373994 | 217 |
| 28 | 3300006880 | Ga0075429_100003197 | Ga0075429_1000031977 | 217 |
| 29 | 3300009147 | Ga0114129_10026919 | Ga0114129_100269194 | 217 |
| 30 | 3300050507 | nmdc:mga05p37_10699_c1 | nmdc:mga05p37_10699_c1_9065_9721 | 217 |
| 31 | 3300050508 | nmdc:mga09592_5735_c1 | nmdc:mga09592_5735_c1_8341_8997 | 217 |
| 32 | 3300050509 | nmdc:mga0qj67_40175_c1 | nmdc:mga0qj67_40175_c1_1023_1679 | 217 |
| 33 | 3300050510 | nmdc:mga06r32_24334_c1 | nmdc:mga06r32_24334_c1_1553_2209 | 217 |
| 34 | 3300005327 | Ga0070658_10067691 | Ga0070658_100676912 | 218 |
| 35 | 3300005455 | Ga0070663_100284716 | Ga0070663_1002847161 | 218 |
| 36 | 3300005539 | Ga0068853_100045056 | Ga0068853_1000450561 | 218 |
| 37 | 3300005548 | Ga0070665_100066681 | Ga0070665_1000666813 | 218 |
| 38 | 3300005563 | Ga0068855_100012299 | Ga0068855_1000122997 | 218 |
| 39 | 3300005616 | Ga0068852_100157836 | Ga0068852_1001578362 | 218 |
| 40 | 3300009093 | Ga0105240_10058110 | Ga0105240_100581102 | 218 |
| 41 | 3300009551 | Ga0105238_10009385 | Ga0105238_100093853 | 218 |
| 42 | 3300010375 | Ga0105239_10066106 | Ga0105239_100661062 | 218 |
| 43 | 3300014969 | Ga0157376_10083823 | Ga0157376_100838232 | 218 |
| 44 | 3300025904 | Ga0207647_10001793 | Ga0207647_1000179313 | 218 |
| 45 | 3300025913 | Ga0207695_10001103 | Ga0207695_1000110339 | 218 |
| 46 | 3300025914 | Ga0207671_10000389 | Ga0207671_1000038919 | 218 |
| 47 | 3300025924 | Ga0207694_10000549 | Ga0207694_100005494 | 218 |
| 48 | 3300025949 | Ga0207667_10078377 | Ga0207667_100783773 | 218 |
| 49 | 3300026067 | Ga0207678_10053356 | Ga0207678_100533562 | 218 |
| 50 | 3300026142 | Ga0207698_10016593 | Ga0207698_100165932 | 218 |
| 51 | 3300028379 | Ga0268266_10164251 | Ga0268266_101642512 | 218 |
| 52 | 3300045049 | Ga0466959_0235795 | Ga0466959_0235795_339_1115 | 218 |
| 53 | 3300031903 | Ga0307407_10101498 | Ga0307407_101014982 | 219 |
| 54 | 3300005327 | Ga0070658_10000119 | Ga0070658_1000011932 | 220 |
| 55 | 3300005336 | Ga0070680_100017571 | Ga0070680_1000175714 | 220 |
| 56 | 3300005530 | Ga0070679_100366819 | Ga0070679_1003668192 | 220 |
| 57 | 3300025909 | Ga0207705_10002817 | Ga0207705_100028174 | 220 |
| 58 | 3300025917 | Ga0207660_10014899 | Ga0207660_100148994 | 220 |
| 59 | 3300048917 | Ga0496114_0242156 | Ga0496114_0242156_27_704 | 220 |
| 60 | 3300045049 | Ga0466959_0256308 | Ga0466959_0256308_276_1028 | 222 |
| 61 | iso_pu_bacteria | 2831935698 | 2831937359 | 223 |
| 62 | 3300025940 | Ga0207691_10112322 | Ga0207691_101123223 | 225 |
| 63 | 3300044683 | Ga0466965_0057981 | Ga0466965_0057981_438_1214 | 225 |
| 64 | 3300046455 | Ga0495603_0086739 | Ga0495603_0086739_35_808 | 225 |
| 65 | 3300046463 | Ga0495653_0142906 | Ga0495653_0142906_483_1256 | 225 |
| 66 | 3300046533 | Ga0495640_0195634 | Ga0495640_0195634_390_1163 | 225 |
| 67 | 3300046559 | Ga0495667_0272240 | Ga0495667_0272240_293_1066 | 225 |
| 68 | 3300047319 | Ga0495674_0130790 | Ga0495674_0130790_643_1416 | 225 |
| 69 | 3300053085 | Ga0495619_0193453 | Ga0495619_0193453_132_905 | 225 |
| 70 | 3300009553 | Ga0105249_10070800 | Ga0105249_100708002 | 226 |
| 71 | 3300014326 | Ga0157380_10072340 | Ga0157380_100723402 | 226 |
| 72 | 3300049573 | Ga0501037_0264859 | Ga0501037_0264859_325_1116 | 227 |
| 73 | 3300049578 | Ga0501042_0082943 | Ga0501042_0082943_1370_2161 | 227 |
| 74 | 3300049581 | Ga0501047_0000055 | Ga0501047_0000055_96175_96966 | 227 |
| 75 | 3300049823 | Ga0501044_0409672 | Ga0501044_0409672_65_889 | 227 |
| 76 | 3300037471 | Ga0395905_0139086 | Ga0395905_0139086_240_956 | 228 |
| 77 | 3300005327 | Ga0070658_10154233 | Ga0070658_101542332 | 229 |
| 78 | 3300025909 | Ga0207705_10157882 | Ga0207705_101578821 | 229 |
| 79 | 3300025919 | Ga0207657_10015561 | Ga0207657_100155614 | 229 |
| 80 | 3300049580 | Ga0501046_0017948 | Ga0501046_0017948_2955_3680 | 230 |
| 81 | 3300005329 | Ga0070683_100163068 | Ga0070683_1001630681 | 232 |
| 82 | 3300009147 | Ga0114129_10214171 | Ga0114129_102141712 | 232 |
| 83 | 3300025944 | Ga0207661_10025764 | Ga0207661_100257644 | 232 |
| 84 | 3300031727 | Ga0316576_10003510 | Ga0316576_100035103 | 232 |
| 85 | 3300032137 | Ga0316585_10019269 | Ga0316585_100192692 | 232 |
| 86 | 3300036712 | Ga0316584_0027632 | Ga0316584_0027632_65_868 | 232 |
| 87 | 3300050507 | nmdc:mga05p37_650239_c1 | nmdc:mga05p37_650239_c1_44_868 | 232 |
| 88 | 3300003323 | rootH1_10051479 | rootH1_100514793 | 233 |
| 89 | 3300005364 | Ga0070673_100191516 | Ga0070673_1001915163 | 233 |
| 90 | 3300031456 | Ga0307513_10044671 | Ga0307513_100446711 | 233 |
| 91 | 3300044656 | Ga0466969_0003315 | Ga0466969_0003315_6074_6859 | 233 |
| 92 | 3300044684 | Ga0466966_0018211 | Ga0466966_0018211_2444_3229 | 233 |
| 93 | 3300044693 | Ga0466961_0023414 | Ga0466961_0023414_1645_2430 | 233 |
| 94 | 3300045049 | Ga0466959_0002069 | Ga0466959_0002069_9352_10137 | 233 |
| 95 | 3300045976 | Ga0466967_0144214 | Ga0466967_0144214_1305_2090 | 233 |
| 96 | 3300048907 | Ga0496104_0109526 | Ga0496104_0109526_851_1624 | 233 |
| 97 | 3300048909 | Ga0496106_0098428 | Ga0496106_0098428_79_819 | 233 |
| 98 | 3300048911 | Ga0496108_0293992 | Ga0496108_0293992_245_1018 | 233 |
| 99 | 3300005434 | Ga0070709_10083032 | Ga0070709_100830322 | 236 |
| 100 | 3300005436 | Ga0070713_100008754 | Ga0070713_1000087546 | 236 |
| 101 | 3300006173 | Ga0070716_100091100 | Ga0070716_1000911003 | 236 |
| 102 | 3300038443 | Ga0395901_0440555 | Ga0395901_0440555_21_824 | 236 |
| 103 | 3300005535 | Ga0070684_100150005 | Ga0070684_1001500052 | 237 |
| 104 | 3300005355 | Ga0070671_100286970 | Ga0070671_1002869702 | 238 |
| 105 | 3300005840 | Ga0068870_10001458 | Ga0068870_100014584 | 238 |
| 106 | 3300009174 | Ga0105241_10005515 | Ga0105241_100055154 | 238 |
| 107 | 3300009545 | Ga0105237_10123767 | Ga0105237_101237674 | 238 |
| 108 | 3300020080 | Ga0206350_10992698 | Ga0206350_109926982 | 238 |
| 109 | 3300025908 | Ga0207643_10000642 | Ga0207643_1000064214 | 238 |
| 110 | 3300042005 | Ga0439448_0079160 | Ga0439448_0079160_51_797 | 238 |
| 111 | 3300044901 | Ga0466960_0019918 | Ga0466960_0019918_1483_2232 | 238 |
| 112 | 3300048916 | Ga0496113_0068423 | Ga0496113_0068423_1790_2521 | 238 |
| 113 | 3300005458 | Ga0070681_10320784 | Ga0070681_103207841 | 240 |
| 114 | 3300025913 | Ga0207695_10456643 | Ga0207695_104566432 | 240 |
| 115 | 3300032137 | Ga0316585_10017413 | Ga0316585_100174133 | 240 |
| 116 | 3300037588 | Ga0316581_0000691 | Ga0316581_0000691_3282_4070 | 240 |
| 117 | 3300044684 | Ga0466966_0119600 | Ga0466966_0119600_209_976 | 240 |
| 118 | 3300044693 | Ga0466961_0013288 | Ga0466961_0013288_3988_4755 | 240 |
| 119 | 3300045836 | Ga0466958_0040184 | Ga0466958_0040184_365_1132 | 240 |
| 120 | 3300048911 | Ga0496108_0124877 | Ga0496108_0124877_273_1061 | 240 |
| 121 | 3300048917 | Ga0496114_0408633 | Ga0496114_0408633_344_1132 | 240 |
| 122 | 3300049572 | Ga0501036_0173465 | Ga0501036_0173465_698_1453 | 240 |
| 123 | 3300049574 | Ga0501038_0037839 | Ga0501038_0037839_2755_3510 | 240 |
| 124 | 3300049575 | Ga0501039_0018223 | Ga0501039_0018223_4445_5200 | 240 |
| 125 | 3300049576 | Ga0501040_0009695 | Ga0501040_0009695_3387_4142 | 240 |
| 126 | 3300049582 | Ga0501048_0009621 | Ga0501048_0009621_4881_5636 | 240 |
| 127 | 3300049588 | Ga0501072_0006034 | Ga0501072_0006034_4345_5100 | 240 |
| 128 | 3300049590 | Ga0501074_0040978 | Ga0501074_0040978_958_1713 | 240 |
| 129 | 3300049591 | Ga0501075_0012744 | Ga0501075_0012744_3933_4688 | 240 |
| 130 | 3300049592 | Ga0501076_0015064 | Ga0501076_0015064_1805_2560 | 240 |
| 131 | 3300049593 | Ga0501077_0112064 | Ga0501077_0112064_179_934 | 240 |
| 132 | 3300049741 | Ga0501079_0024022 | Ga0501079_0024022_3001_3756 | 240 |
| 133 | 3300049824 | Ga0501045_0006195 | Ga0501045_0006195_5635_6390 | 240 |
| 134 | 3300053113 | Ga0500580_111849 | Ga0500580_111849_84_875 | 240 |
| 135 | 3300060353 | Ga0501082_0024474 | Ga0501082_0024474_1062_1817 | 240 |
| 136 | 3300061734 | Ga0530510_0160929 | Ga0530510_0160929_526_1281 | 240 |
| 137 | 3300005466 | Ga0070685_10251434 | Ga0070685_102514342 | 241 |
| 138 | 3300009098 | Ga0105245_10281268 | Ga0105245_102812682 | 241 |
| 139 | 3300013297 | Ga0157378_10238951 | Ga0157378_102389513 | 241 |
| 140 | 3300020069 | Ga0197907_10194450 | Ga0197907_101944502 | 241 |
| 141 | 3300020070 | Ga0206356_11157171 | Ga0206356_111571712 | 241 |
| 142 | 3300022467 | Ga0224712_10017830 | Ga0224712_100178303 | 241 |
| 143 | 3300035091 | Ga0373951_0000211 | Ga0373951_0000211_12551_13336 | 241 |
| 144 | iso_pu_bacteria | 8057568493 | 8057572173 | 241 |
| 145 | iso_pu_bacteria | 2861520306 | 2861522048 | 242 |
| 146 | 3300005334 | Ga0068869_100122383 | Ga0068869_1001223833 | 243 |
| 147 | 3300005345 | Ga0070692_10044010 | Ga0070692_100440104 | 243 |
| 148 | 3300005366 | Ga0070659_100000362 | Ga0070659_10000036224 | 243 |
| 149 | 3300013102 | Ga0157371_10198127 | Ga0157371_101981272 | 243 |
| 150 | 3300013105 | Ga0157369_10000797 | Ga0157369_1000079713 | 243 |
| 151 | 3300013105 | Ga0157369_10134630 | Ga0157369_101346302 | 243 |
| 152 | 3300013105 | Ga0157369_10215827 | Ga0157369_102158272 | 243 |
| 153 | 3300025932 | Ga0207690_10003378 | Ga0207690_1000337811 | 243 |
| 154 | 3300025932 | Ga0207690_10012941 | Ga0207690_100129414 | 243 |
| 155 | 3300025942 | Ga0207689_10117215 | Ga0207689_101172152 | 243 |
| 156 | 3300005336 | Ga0070680_100011790 | Ga0070680_1000117909 | 244 |
| 157 | 3300005530 | Ga0070679_100092767 | Ga0070679_1000927672 | 244 |
| 158 | 3300005983 | Ga0081540_1001328 | Ga0081540_100132812 | 244 |
| 159 | 3300009545 | Ga0105237_10196552 | Ga0105237_101965522 | 244 |
| 160 | 3300022467 | Ga0224712_10141777 | Ga0224712_101417771 | 244 |
| 161 | 3300025917 | Ga0207660_10185982 | Ga0207660_101859822 | 244 |
| 162 | 3300025921 | Ga0207652_10073273 | Ga0207652_100732732 | 244 |
| 163 | 3300033179 | Ga0307507_10119453 | Ga0307507_101194532 | 244 |
| 164 | 3300044656 | Ga0466969_0085596 | Ga0466969_0085596_454_1230 | 244 |
| 165 | 3300044765 | Ga0466970_0001880 | Ga0466970_0001880_8490_9266 | 244 |
| 166 | 3300045836 | Ga0466958_0209196 | Ga0466958_0209196_38_814 | 244 |
| 167 | 3300046462 | Ga0495651_0011488 | Ga0495651_0011488_1515_2291 | 244 |
| 168 | 3300046516 | Ga0495628_0372912 | Ga0495628_0372912_19_795 | 244 |
| 169 | 3300046529 | Ga0495652_0000641 | Ga0495652_0000641_13166_13942 | 244 |
| 170 | 3300046809 | Ga0495600_0028378 | Ga0495600_0028378_468_1244 | 244 |
| 171 | 3300047315 | Ga0495581_0093113 | Ga0495581_0093113_891_1667 | 244 |
| 172 | 3300048904 | Ga0496101_0533306 | Ga0496101_0533306_10_783 | 244 |
| 173 | 3300048907 | Ga0496104_0140269 | Ga0496104_0140269_671_1444 | 244 |
| 174 | 3300048917 | Ga0496114_0003598 | Ga0496114_0003598_2554_3327 | 244 |
| 175 | iso_pu_bacteria | 2622736605 | 2623499910 | 244 |
| 176 | 3300005578 | Ga0068854_100064116 | Ga0068854_1000641163 | 245 |
| 177 | 3300046462 | Ga0495651_0164587 | Ga0495651_0164587_496_1272 | 245 |
| 178 | 3300046529 | Ga0495652_0154085 | Ga0495652_0154085_969_1745 | 245 |
| 179 | 3300053077 | Ga0495601_0064359 | Ga0495601_0064359_90_866 | 245 |
| 180 | 3300053078 | Ga0495612_0012093 | Ga0495612_0012093_471_1247 | 245 |
| 181 | 3300053085 | Ga0495619_0124003 | Ga0495619_0124003_951_1727 | 245 |
| 182 | 3300053140 | Ga0500573_0169886 | Ga0500573_0169886_290_1069 | 245 |
| 183 | iso_pu_bacteria | 2995463766 | 2995465002 | 245 |
| 184 | 3300005327 | Ga0070658_10364508 | Ga0070658_103645082 | 246 |
| 185 | 3300005535 | Ga0070684_100157725 | Ga0070684_1001577253 | 246 |
| 186 | 3300013105 | Ga0157369_10200329 | Ga0157369_102003293 | 246 |
| 187 | 3300013307 | Ga0157372_10308935 | Ga0157372_103089353 | 246 |
| 188 | 3300020070 | Ga0206356_11754385 | Ga0206356_117543851 | 246 |
| 189 | 3300025909 | Ga0207705_10024594 | Ga0207705_100245942 | 246 |
| 190 | 3300025919 | Ga0207657_10107522 | Ga0207657_101075223 | 246 |
| 191 | 3300025920 | Ga0207649_10149166 | Ga0207649_101491662 | 246 |
| 192 | 3300025921 | Ga0207652_10129549 | Ga0207652_101295492 | 246 |
| 193 | 3300025944 | Ga0207661_10097167 | Ga0207661_100971673 | 246 |
| 194 | 3300026035 | Ga0207703_10546639 | Ga0207703_105466391 | 246 |
| 195 | 3300026067 | Ga0207678_10050866 | Ga0207678_100508663 | 246 |
| 196 | 3300026078 | Ga0207702_10347367 | Ga0207702_103473673 | 246 |
| 197 | 3300026142 | Ga0207698_10292764 | Ga0207698_102927643 | 246 |
| 198 | 3300028794 | Ga0307515_10033218 | Ga0307515_100332187 | 246 |
| 199 | 3300031616 | Ga0307508_10049368 | Ga0307508_100493682 | 246 |
| 200 | 3300031731 | Ga0307405_10014517 | Ga0307405_100145173 | 246 |
| 201 | 3300031731 | Ga0307405_10356312 | Ga0307405_103563122 | 246 |
| 202 | 3300031824 | Ga0307413_10298328 | Ga0307413_102983282 | 246 |
| 203 | 3300031852 | Ga0307410_10031789 | Ga0307410_100317892 | 246 |
| 204 | 3300031852 | Ga0307410_10032066 | Ga0307410_100320664 | 246 |
| 205 | 3300031852 | Ga0307410_10089745 | Ga0307410_100897452 | 246 |
| 206 | 3300031901 | Ga0307406_10194509 | Ga0307406_101945092 | 246 |
| 207 | 3300031903 | Ga0307407_10035351 | Ga0307407_100353513 | 246 |
| 208 | 3300031903 | Ga0307407_10233344 | Ga0307407_102333442 | 246 |
| 209 | 3300031911 | Ga0307412_10284096 | Ga0307412_102840961 | 246 |
| 210 | 3300031995 | Ga0307409_100013836 | Ga0307409_1000138362 | 246 |
| 211 | 3300031995 | Ga0307409_100082463 | Ga0307409_1000824632 | 246 |
| 212 | 3300031995 | Ga0307409_100170756 | Ga0307409_1001707562 | 246 |
| 213 | 3300031995 | Ga0307409_100180311 | Ga0307409_1001803113 | 246 |
| 214 | 3300031995 | Ga0307409_100210291 | Ga0307409_1002102912 | 246 |
| 215 | 3300032002 | Ga0307416_100052841 | Ga0307416_1000528413 | 246 |
| 216 | 3300032004 | Ga0307414_10088751 | Ga0307414_100887513 | 246 |
| 217 | 3300032004 | Ga0307414_10120395 | Ga0307414_101203951 | 246 |
| 218 | 3300032005 | Ga0307411_10178979 | Ga0307411_101789792 | 246 |
| 219 | 3300032005 | Ga0307411_10252921 | Ga0307411_102529212 | 246 |
| 220 | 3300032126 | Ga0307415_100006290 | Ga0307415_1000062904 | 246 |
| 221 | 3300032126 | Ga0307415_100052350 | Ga0307415_1000523503 | 246 |
| 222 | 3300032126 | Ga0307415_100085707 | Ga0307415_1000857072 | 246 |
| 223 | 3300032126 | Ga0307415_100166149 | Ga0307415_1001661492 | 246 |
| 224 | 3300032126 | Ga0307415_100193515 | Ga0307415_1001935151 | 246 |
| 225 | 3300032126 | Ga0307415_100345676 | Ga0307415_1003456762 | 246 |
| 226 | 3300041512 | Ga0451853_1912804 | Ga0451853_1912804_881_1681 | 246 |
| 227 | 3300044683 | Ga0466965_0112909 | Ga0466965_0112909_494_1270 | 246 |
| 228 | 3300045976 | Ga0466967_0022099 | Ga0466967_0022099_2131_2904 | 246 |
| 229 | iso_pu_bacteria | 2501939600 | 2501939957 | 246 |
| 230 | iso_pu_bacteria | 2515154088 | 2515495283 | 246 |
| 231 | iso_pu_bacteria | 2515154129 | 2515722226 | 246 |
| 232 | iso_pu_bacteria | 2515154202 | 2516085364 | 246 |
| 233 | iso_pu_bacteria | 2622736626 | 2623590650 | 246 |
| 234 | iso_pu_bacteria | 2858868258 | 2858871862 | 246 |
| 235 | iso_pu_bacteria | 2858902515 | 2858906632 | 246 |
| 236 | iso_pu_bacteria | 2867312974 | 2867318796 | 246 |
| 237 | iso_pu_bacteria | 2867319477 | 2867320791 | 246 |
| 238 | iso_pu_bacteria | 2867507094 | 2867511939 | 246 |
| 239 | iso_pu_bacteria | 2902582711 | 2902585860 | 246 |
| 240 | iso_pu_bacteria | 2996221748 | 2996223099 | 246 |
| 241 | iso_pu_bacteria | 8003830390 | 8003832035 | 246 |
| 242 | iso_pu_bacteria | 8054727385 | 8054731396 | 246 |
| 243 | iso_pu_bacteria | 8055412473 | 8055414588 | 246 |
| 244 | 3300026078 | Ga0207702_10033501 | Ga0207702_100335013 | 247 |
| 245 | 3300026088 | Ga0207641_10284676 | Ga0207641_102846762 | 247 |
| 246 | 3300028786 | Ga0307517_10084604 | Ga0307517_100846042 | 247 |
| 247 | 3300032002 | Ga0307416_100133476 | Ga0307416_1001334762 | 247 |
| 248 | 3300044693 | Ga0466961_0113162 | Ga0466961_0113162_391_1167 | 247 |
| 249 | 3300044706 | Ga0466964_0037189 | Ga0466964_0037189_70_846 | 247 |
| 250 | 3300044765 | Ga0466970_0194658 | Ga0466970_0194658_172_948 | 247 |
| 251 | 3300045049 | Ga0466959_0045828 | Ga0466959_0045828_1202_1978 | 247 |
| 252 | 3300045976 | Ga0466967_0099938 | Ga0466967_0099938_1631_2392 | 247 |
| 253 | 3300049576 | Ga0501040_0148045 | Ga0501040_0148045_45_833 | 247 |
| 254 | 3300061719 | Ga0466962_0061629 | Ga0466962_0061629_891_1667 | 247 |
| 255 | iso_pu_bacteria | 3006425503 | 3006426335 | 247 |
| 256 | iso_pu_bacteria | 8056060235 | 8056066521 | 247 |
| 257 | 3300003354 | JGI25160J50197_1005533 | JGI25160J50197_10055332 | 248 |
| 258 | 3300025302 | Ga0207426_1001708 | Ga0207426_10017081 | 248 |
| 259 | 3300025302 | Ga0207426_1002372 | Ga0207426_10023723 | 248 |
| 260 | 3300035118 | Ga0373954_0039353 | Ga0373954_0039353_428_1231 | 248 |
| 261 | 3300035398 | Ga0316574_0026269 | Ga0316574_0026269_767_1561 | 248 |
| 262 | 3300039450 | Ga0436363_1668436 | Ga0436363_1668436_765_1595 | 248 |
| 263 | 3300044694 | Ga0466963_0197104 | Ga0466963_0197104_60_845 | 248 |
| 264 | 3300044842 | Ga0466957_0244560 | Ga0466957_0244560_99_878 | 248 |
| 265 | 3300046462 | Ga0495651_0002038 | Ga0495651_0002038_11082_11885 | 248 |
| 266 | 3300046463 | Ga0495653_0003878 | Ga0495653_0003878_2109_2912 | 248 |
| 267 | 3300046472 | Ga0495580_0043463 | Ga0495580_0043463_2092_2895 | 248 |
| 268 | 3300046477 | Ga0495664_0027249 | Ga0495664_0027249_2088_2891 | 248 |
| 269 | 3300046511 | Ga0495608_0007650 | Ga0495608_0007650_1400_2203 | 248 |
| 270 | 3300046517 | Ga0495630_0274611 | Ga0495630_0274611_298_1101 | 248 |
| 271 | 3300046526 | Ga0495666_0000038 | Ga0495666_0000038_25050_25853 | 248 |
| 272 | 3300046529 | Ga0495652_0018707 | Ga0495652_0018707_1307_2110 | 248 |
| 273 | 3300046531 | Ga0495665_0000846 | Ga0495665_0000846_1990_2793 | 248 |
| 274 | 3300046533 | Ga0495640_0000604 | Ga0495640_0000604_24965_25768 | 248 |
| 275 | 3300046535 | Ga0495586_0008446 | Ga0495586_0008446_4545_5348 | 248 |
| 276 | 3300046536 | Ga0495587_0026773 | Ga0495587_0026773_2133_2936 | 248 |
| 277 | 3300046543 | Ga0495645_0015660 | Ga0495645_0015660_1900_2703 | 248 |
| 278 | 3300046559 | Ga0495667_0005401 | Ga0495667_0005401_3787_4590 | 248 |
| 279 | 3300046642 | Ga0495634_0038825 | Ga0495634_0038825_354_1157 | 248 |
| 280 | 3300046663 | Ga0495635_0035280 | Ga0495635_0035280_577_1380 | 248 |
| 281 | 3300046675 | Ga0495657_0007395 | Ga0495657_0007395_3516_4319 | 248 |
| 282 | 3300046679 | Ga0495623_0012861 | Ga0495623_0012861_1690_2493 | 248 |
| 283 | 3300046689 | Ga0495613_0022738 | Ga0495613_0022738_3787_4590 | 248 |
| 284 | 3300046809 | Ga0495600_0012847 | Ga0495600_0012847_3659_4462 | 248 |
| 285 | 3300047315 | Ga0495581_0029662 | Ga0495581_0029662_1902_2705 | 248 |
| 286 | 3300047317 | Ga0495604_0001183 | Ga0495604_0001183_2411_3214 | 248 |
| 287 | 3300047444 | Ga0495675_0204873 | Ga0495675_0204873_210_1013 | 248 |
| 288 | 3300047471 | Ga0495684_0029675 | Ga0495684_0029675_1389_2192 | 248 |
| 289 | 3300047673 | Ga0495593_0080220 | Ga0495593_0080220_499_1302 | 248 |
| 290 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_211966_212751 | 248 |
| 291 | 3300049569 | Ga0501032_0005828 | Ga0501032_0005828_7686_8471 | 248 |
| 292 | 3300049570 | Ga0501033_0103465 | Ga0501033_0103465_75_860 | 248 |
| 293 | 3300049571 | Ga0501034_0004159 | Ga0501034_0004159_15333_16118 | 248 |
| 294 | 3300049572 | Ga0501036_0002938 | Ga0501036_0002938_18_803 | 248 |
| 295 | 3300049573 | Ga0501037_0004856 | Ga0501037_0004856_8925_9710 | 248 |
| 296 | 3300049575 | Ga0501039_0011139 | Ga0501039_0011139_644_1429 | 248 |
| 297 | 3300049576 | Ga0501040_0012035 | Ga0501040_0012035_80_865 | 248 |
| 298 | 3300049577 | Ga0501041_0000342 | Ga0501041_0000342_156_941 | 248 |
| 299 | 3300049578 | Ga0501042_0483732 | Ga0501042_0483732_90_875 | 248 |
| 300 | 3300049579 | Ga0501043_0002270 | Ga0501043_0002270_259_1044 | 248 |
| 301 | 3300049580 | Ga0501046_0015939 | Ga0501046_0015939_5425_6210 | 248 |
| 302 | 3300049581 | Ga0501047_0002325 | Ga0501047_0002325_17304_18089 | 248 |
| 303 | 3300049582 | Ga0501048_0009686 | Ga0501048_0009686_4871_5656 | 248 |
| 304 | 3300049583 | Ga0501067_0007213 | Ga0501067_0007213_154_939 | 248 |
| 305 | 3300049584 | Ga0501068_0001227 | Ga0501068_0001227_147_932 | 248 |
| 306 | 3300049585 | Ga0501069_0266565 | Ga0501069_0266565_192_977 | 248 |
| 307 | 3300049586 | Ga0501070_0015698 | Ga0501070_0015698_191_976 | 248 |
| 308 | 3300049587 | Ga0501071_0010072 | Ga0501071_0010072_5365_6150 | 248 |
| 309 | 3300049588 | Ga0501072_0009706 | Ga0501072_0009706_1617_2402 | 248 |
| 310 | 3300049589 | Ga0501073_0020233 | Ga0501073_0020233_1612_2397 | 248 |
| 311 | 3300049593 | Ga0501077_0142108 | Ga0501077_0142108_518_1303 | 248 |
| 312 | 3300049741 | Ga0501079_0001125 | Ga0501079_0001125_57_842 | 248 |
| 313 | 3300049742 | Ga0501080_0251487 | Ga0501080_0251487_805_1590 | 248 |
| 314 | 3300049822 | Ga0501035_0003717 | Ga0501035_0003717_71_856 | 248 |
| 315 | 3300049823 | Ga0501044_0001280 | Ga0501044_0001280_28862_29647 | 248 |
| 316 | 3300049824 | Ga0501045_0373973 | Ga0501045_0373973_152_937 | 248 |
| 317 | 3300053077 | Ga0495601_0006666 | Ga0495601_0006666_5640_6443 | 248 |
| 318 | 3300053085 | Ga0495619_0027418 | Ga0495619_0027418_205_1008 | 248 |
| 319 | 3300054114 | Ga0501084_0026251 | Ga0501084_0026251_1694_2479 | 248 |
| 320 | 3300060353 | Ga0501082_0005865 | Ga0501082_0005865_9661_10446 | 248 |
| 321 | iso_pu_bacteria | 2547132111 | 2547411064 | 248 |
| 322 | iso_pu_bacteria | 2554235005 | 2554259212 | 248 |
| 323 | iso_pu_bacteria | 2582581312 | 2585298573 | 248 |
| 324 | iso_pu_bacteria | 2582581314 | 2585317655 | 248 |
| 325 | iso_pu_bacteria | 2616644814 | 2616693931 | 248 |
| 326 | iso_pu_bacteria | 2616644941 | 2616899159 | 248 |
| 327 | iso_pu_bacteria | 2643221578 | 2643897098 | 248 |
| 328 | iso_pu_bacteria | 2643221673 | 2644408242 | 248 |
| 329 | iso_pu_bacteria | 2643221678 | 2644435442 | 248 |
| 330 | iso_pu_bacteria | 2643221714 | 2644630549 | 248 |
| 331 | iso_pu_bacteria | 2784132148 | 2784587092 | 248 |
| 332 | iso_pu_bacteria | 2784746763 | 2785345312 | 248 |
| 333 | iso_pu_bacteria | 2791355406 | 2793984212 | 248 |
| 334 | iso_pu_bacteria | 2808606359 | 2808848063 | 248 |
| 335 | iso_pu_bacteria | 2808606375 | 2808918830 | 248 |
| 336 | iso_pu_bacteria | 2808606448 | 2809230656 | 248 |
| 337 | iso_pu_bacteria | 2808606982 | 2811847340 | 248 |
| 338 | iso_pu_bacteria | 2811994879 | 2812359935 | 248 |
| 339 | iso_pu_bacteria | 2811994917 | 2812482004 | 248 |
| 340 | iso_pu_bacteria | 2852635781 | 2852638094 | 248 |
| 341 | iso_pu_bacteria | 2862281513 | 2862289064 | 248 |
| 342 | iso_pu_bacteria | 2862382967 | 2862390162 | 248 |
| 343 | iso_pu_bacteria | 2862507626 | 2862508490 | 248 |
| 344 | iso_pu_bacteria | 2862574272 | 2862583286 | 248 |
| 345 | iso_pu_bacteria | 2863404153 | 2863406559 | 248 |
| 346 | iso_pu_bacteria | 2867369537 | 2867370360 | 248 |
| 347 | iso_pu_bacteria | 2867475112 | 2867476993 | 248 |
| 348 | iso_pu_bacteria | 2873151551 | 2873157305 | 248 |
| 349 | iso_pu_bacteria | 2912715099 | 2912721984 | 248 |
| 350 | iso_pu_bacteria | 2912723979 | 2912725752 | 248 |
| 351 | iso_pu_bacteria | 2912757875 | 2912759231 | 248 |
| 352 | iso_pu_bacteria | 2919468124 | 2919475076 | 248 |
| 353 | iso_pu_bacteria | 2946045630 | 2946051647 | 248 |
| 354 | iso_pu_bacteria | 2946064051 | 2946065970 | 248 |
| 355 | iso_pu_bacteria | 2946072368 | 2946074294 | 248 |
| 356 | iso_pu_bacteria | 2947224130 | 2947231434 | 248 |
| 357 | iso_pu_bacteria | 2954002825 | 2954004689 | 248 |
| 358 | iso_pu_bacteria | 2966598605 | 2966604010 | 248 |
| 359 | iso_pu_bacteria | 2990044586 | 2990044624 | 248 |
| 360 | iso_pu_bacteria | 2990059506 | 2990066183 | 248 |
| 361 | iso_pu_bacteria | 2990088156 | 2990092319 | 248 |
| 362 | iso_pu_bacteria | 2997451912 | 2997458804 | 248 |
| 363 | iso_pu_bacteria | 2997600082 | 2997606842 | 248 |
| 364 | iso_pu_bacteria | 3006393351 | 3006394366 | 248 |
| 365 | iso_pu_bacteria | 3006486233 | 3006486372 | 248 |
| 366 | iso_pu_bacteria | 3006493962 | 3006496634 | 248 |
| 367 | iso_pu_bacteria | 8008558824 | 8008561748 | 248 |
| 368 | iso_pu_bacteria | 8008574985 | 8008580384 | 248 |
| 369 | iso_pu_bacteria | 8023623736 | 8023625064 | 248 |
| 370 | iso_pu_bacteria | 8025413630 | 8025418859 | 248 |
| 371 | iso_pu_bacteria | 8025478263 | 8025480037 | 248 |
| 372 | iso_pu_bacteria | 8025524527 | 8025527581 | 248 |
| 373 | iso_pu_bacteria | 8025530807 | 8025535768 | 248 |
| 374 | iso_pu_bacteria | 8047893842 | 8047899866 | 248 |
| 375 | iso_pu_bacteria | 8048127548 | 8048130995 | 248 |
| 376 | iso_pu_bacteria | 8048356638 | 8048359064 | 248 |
| 377 | iso_pu_bacteria | 8048369669 | 8048376814 | 248 |
| 378 | iso_pu_bacteria | 8048379754 | 8048385867 | 248 |
| 379 | iso_pu_bacteria | 8048406513 | 8048411601 | 248 |
| 380 | iso_pu_bacteria | 8054160619 | 8054163429 | 248 |
| 381 | iso_pu_bacteria | 8056667051 | 8056667564 | 248 |
| 382 | iso_pu_bacteria | 8056829672 | 8056832999 | 248 |
| 383 | 3300003316 | rootH1_10040607 | rootH1_100406073 | 249 |
| 384 | 3300003322 | rootL2_10026369 | rootL2_100263693 | 249 |
| 385 | 3300005434 | Ga0070709_10037259 | Ga0070709_100372593 | 249 |
| 386 | 3300005435 | Ga0070714_100457753 | Ga0070714_1004577531 | 249 |
| 387 | 3300005539 | Ga0068853_100037542 | Ga0068853_1000375426 | 249 |
| 388 | 3300005983 | Ga0081540_1005111 | Ga0081540_10051114 | 249 |
| 389 | 3300006028 | Ga0070717_10298340 | Ga0070717_102983401 | 249 |
| 390 | 3300006048 | Ga0075363_100027879 | Ga0075363_1000278793 | 249 |
| 391 | 3300009551 | Ga0105238_10644227 | Ga0105238_106442272 | 249 |
| 392 | 3300015688 | Ga0183367_1007 | Ga0183367_100770 | 249 |
| 393 | 3300025297 | Ga0209758_1009625 | Ga0209758_10096253 | 249 |
| 394 | 3300025906 | Ga0207699_10051951 | Ga0207699_100519512 | 249 |
| 395 | 3300026041 | Ga0207639_10061430 | Ga0207639_100614303 | 249 |
| 396 | 3300028794 | Ga0307515_10188196 | Ga0307515_101881961 | 249 |
| 397 | 3300030521 | Ga0307511_10180594 | Ga0307511_101805941 | 249 |
| 398 | 3300031507 | Ga0307509_10018531 | Ga0307509_100185311 | 249 |
| 399 | 3300031548 | Ga0307408_100119461 | Ga0307408_1001194611 | 249 |
| 400 | 3300041404 | Ga0439436_0025102 | Ga0439436_0025102_520_1311 | 249 |
| 401 | 3300041494 | Ga0451837_1623308 | Ga0451837_1623308_1277_2068 | 249 |
| 402 | 3300041512 | Ga0451853_1849776 | Ga0451853_1849776_1275_2066 | 249 |
| 403 | 3300042014 | Ga0439457_000487 | Ga0439457_000487_10076_10867 | 249 |
| 404 | 3300042014 | Ga0439457_017355 | Ga0439457_017355_336_1127 | 249 |
| 405 | 3300042131 | Ga0450894_000118 | Ga0450894_000118_9378_10169 | 249 |
| 406 | 3300042133 | Ga0450896_001022 | Ga0450896_001022_144_935 | 249 |
| 407 | 3300042134 | Ga0450898_001468 | Ga0450898_001468_21_812 | 249 |
| 408 | 3300042145 | Ga0450906_004237 | Ga0450906_004237_382_1173 | 249 |
| 409 | 3300044656 | Ga0466969_0001961 | Ga0466969_0001961_2313_3134 | 249 |
| 410 | 3300044658 | Ga0466972_0006482 | Ga0466972_0006482_4674_5465 | 249 |
| 411 | 3300044684 | Ga0466966_0019368 | Ga0466966_0019368_2728_3549 | 249 |
| 412 | 3300044693 | Ga0466961_0000931 | Ga0466961_0000931_3940_4761 | 249 |
| 413 | 3300044719 | Ga0466971_0000129 | Ga0466971_0000129_10039_10860 | 249 |
| 414 | 3300045049 | Ga0466959_0021527 | Ga0466959_0021527_3125_3946 | 249 |
| 415 | 3300046457 | Ga0495590_0108040 | Ga0495590_0108040_97_888 | 249 |
| 416 | 3300046462 | Ga0495651_0000439 | Ga0495651_0000439_19379_20200 | 249 |
| 417 | 3300046477 | Ga0495664_0138831 | Ga0495664_0138831_461_1282 | 249 |
| 418 | 3300046506 | Ga0495583_0154112 | Ga0495583_0154112_139_930 | 249 |
| 419 | 3300046516 | Ga0495628_0110958 | Ga0495628_0110958_403_1224 | 249 |
| 420 | 3300046529 | Ga0495652_0001811 | Ga0495652_0001811_8776_9597 | 249 |
| 421 | 3300046663 | Ga0495635_0047456 | Ga0495635_0047456_122_943 | 249 |
| 422 | 3300046674 | Ga0495588_0058055 | Ga0495588_0058055_1058_1864 | 249 |
| 423 | 3300046680 | Ga0495646_0020503 | Ga0495646_0020503_3251_4072 | 249 |
| 424 | 3300046794 | Ga0495589_0134409 | Ga0495589_0134409_272_1063 | 249 |
| 425 | 3300046809 | Ga0495600_0019339 | Ga0495600_0019339_1005_1826 | 249 |
| 426 | 3300047318 | Ga0495636_0006916 | Ga0495636_0006916_3030_3821 | 249 |
| 427 | 3300047318 | Ga0495636_0149393 | Ga0495636_0149393_159_950 | 249 |
| 428 | 3300047447 | Ga0495685_082174 | Ga0495685_082174_143_934 | 249 |
| 429 | 3300049128 | Ga0501308_008026 | Ga0501308_008026_157_948 | 249 |
| 430 | 3300049592 | Ga0501076_0614064 | Ga0501076_0614064_78_869 | 249 |
| 431 | 3300050490 | nmdc:mga03n38_8846_c1 | nmdc:mga03n38_8846_c1_1020_1814 | 249 |
| 432 | 3300053077 | Ga0495601_0045368 | Ga0495601_0045368_178_999 | 249 |
| 433 | 3300053077 | Ga0495601_0091398 | Ga0495601_0091398_999_1820 | 249 |
| 434 | 3300053078 | Ga0495612_0001094 | Ga0495612_0001094_4401_5222 | 249 |
| 435 | 3300053083 | Ga0495655_0080842 | Ga0495655_0080842_57_848 | 249 |
| 436 | 3300053085 | Ga0495619_0113087 | Ga0495619_0113087_295_1116 | 249 |
| 437 | 3300061719 | Ga0466962_0000304 | Ga0466962_0000304_19349_20170 | 249 |
| 438 | 3300061719 | Ga0466962_0065834 | Ga0466962_0065834_373_1164 | 249 |
| 439 | iso_pu_bacteria | 2643221587 | 2643945436 | 249 |
| 440 | iso_pu_bacteria | 2643221670 | 2644387660 | 249 |
| 441 | iso_pu_bacteria | 2643221677 | 2644432335 | 249 |
| 442 | iso_pu_bacteria | 2818991472 | 2819740001 | 249 |
| 443 | iso_pu_bacteria | 2862178590 | 2862183231 | 249 |
| 444 | iso_pu_bacteria | 2918501144 | 2918502916 | 249 |
| 445 | 3300002067 | JGI24735J21928_10020594 | JGI24735J21928_100205943 | 250 |
| 446 | 3300003323 | rootH1_10042801 | rootH1_100428013 | 250 |
| 447 | 3300005617 | Ga0068859_100059737 | Ga0068859_1000597371 | 250 |
| 448 | 3300006038 | Ga0075365_10163336 | Ga0075365_101633361 | 250 |
| 449 | 3300006042 | Ga0075368_10001944 | Ga0075368_100019443 | 250 |
| 450 | 3300006178 | Ga0075367_10013085 | Ga0075367_100130852 | 250 |
| 451 | 3300006931 | Ga0097620_100059737 | Ga0097620_1000597371 | 250 |
| 452 | 3300006948 | Ga0099826_10052161 | Ga0099826_100521614 | 250 |
| 453 | 3300009011 | Ga0105251_10032904 | Ga0105251_100329042 | 250 |
| 454 | 3300009036 | Ga0105244_10128650 | Ga0105244_101286502 | 250 |
| 455 | 3300009092 | Ga0105250_10030904 | Ga0105250_100309042 | 250 |
| 456 | 3300011119 | Ga0105246_10024357 | Ga0105246_100243573 | 250 |
| 457 | 3300011119 | Ga0105246_10156675 | Ga0105246_101566751 | 250 |
| 458 | 3300014497 | Ga0182008_10006694 | Ga0182008_100066943 | 250 |
| 459 | 3300015262 | Ga0182007_10002052 | Ga0182007_1000205215 | 250 |
| 460 | 3300022467 | Ga0224712_10141230 | Ga0224712_101412301 | 250 |
| 461 | 3300025735 | Ga0207713_1022981 | Ga0207713_10229813 | 250 |
| 462 | 3300025904 | Ga0207647_10019779 | Ga0207647_100197792 | 250 |
| 463 | 3300025928 | Ga0207700_10004997 | Ga0207700_100049976 | 250 |
| 464 | 3300025929 | Ga0207664_10041633 | Ga0207664_100416332 | 250 |
| 465 | 3300027312 | Ga0209371_1007004 | Ga0209371_10070046 | 250 |
| 466 | 3300027866 | Ga0209813_10003133 | Ga0209813_100031334 | 250 |
| 467 | 3300028794 | Ga0307515_10001938 | Ga0307515_100019383 | 250 |
| 468 | 3300030500 | Ga0268256_1006497 | Ga0268256_10064973 | 250 |
| 469 | 3300030521 | Ga0307511_10003550 | Ga0307511_1000355018 | 250 |
| 470 | 3300030522 | Ga0307512_10060873 | Ga0307512_100608735 | 250 |
| 471 | 3300031456 | Ga0307513_10018658 | Ga0307513_100186585 | 250 |
| 472 | 3300031456 | Ga0307513_10054304 | Ga0307513_100543047 | 250 |
| 473 | 3300031616 | Ga0307508_10165784 | Ga0307508_101657843 | 250 |
| 474 | 3300031649 | Ga0307514_10034295 | Ga0307514_100342951 | 250 |
| 475 | 3300031649 | Ga0307514_10102841 | Ga0307514_101028411 | 250 |
| 476 | 3300031649 | Ga0307514_10158100 | Ga0307514_101581001 | 250 |
| 477 | 3300031649 | Ga0307514_10229729 | Ga0307514_102297291 | 250 |
| 478 | 3300031730 | Ga0307516_10004291 | Ga0307516_1000429114 | 250 |
| 479 | 3300031730 | Ga0307516_10208241 | Ga0307516_102082412 | 250 |
| 480 | 3300033179 | Ga0307507_10049533 | Ga0307507_100495337 | 250 |
| 481 | 3300033180 | Ga0307510_10051295 | Ga0307510_100512951 | 250 |
| 482 | 3300033180 | Ga0307510_10067663 | Ga0307510_100676636 | 250 |
| 483 | 3300033180 | Ga0307510_10073100 | Ga0307510_100731003 | 250 |
| 484 | 3300033180 | Ga0307510_10233274 | Ga0307510_102332742 | 250 |
| 485 | 3300037312 | Ga0395899_0200255 | Ga0395899_0200255_139_942 | 250 |
| 486 | 3300037418 | Ga0395900_0055090 | Ga0395900_0055090_1429_2232 | 250 |
| 487 | 3300037466 | Ga0395898_0003059 | Ga0395898_0003059_17730_18533 | 250 |
| 488 | 3300037853 | Ga0436364_0586317 | Ga0436364_0586317_7095_7943 | 250 |
| 489 | 3300038443 | Ga0395901_0093166 | Ga0395901_0093166_1581_2384 | 250 |
| 490 | 3300041404 | Ga0439436_0000389 | Ga0439436_0000389_4901_5704 | 250 |
| 491 | 3300041406 | Ga0439439_0009805 | Ga0439439_0009805_871_1674 | 250 |
| 492 | 3300041512 | Ga0451853_0695299 | Ga0451853_0695299_404_1207 | 250 |
| 493 | 3300041999 | Ga0439433_0000389 | Ga0439433_0000389_4776_5579 | 250 |
| 494 | 3300042006 | Ga0439432_062307 | Ga0439432_062307_223_1026 | 250 |
| 495 | 3300042007 | Ga0439449_0000989 | Ga0439449_0000989_244_1047 | 250 |
| 496 | 3300042014 | Ga0439457_002703 | Ga0439457_002703_1893_2696 | 250 |
| 497 | 3300042157 | Ga0439458_0003052 | Ga0439458_0003052_92_904 | 250 |
| 498 | 3300044656 | Ga0466969_0029153 | Ga0466969_0029153_326_1141 | 250 |
| 499 | 3300044658 | Ga0466972_0024209 | Ga0466972_0024209_1800_2615 | 250 |
| 500 | 3300044658 | Ga0466972_0085269 | Ga0466972_0085269_300_1103 | 250 |
| 501 | 3300044658 | Ga0466972_0097482 | Ga0466972_0097482_179_982 | 250 |
| 502 | 3300044683 | Ga0466965_0013412 | Ga0466965_0013412_1853_2668 | 250 |
| 503 | 3300044684 | Ga0466966_0000938 | Ga0466966_0000938_11209_12024 | 250 |
| 504 | 3300044693 | Ga0466961_0003176 | Ga0466961_0003176_8984_9799 | 250 |
| 505 | 3300044693 | Ga0466961_0355004 | Ga0466961_0355004_66_869 | 250 |
| 506 | 3300044694 | Ga0466963_0000235 | Ga0466963_0000235_21479_22282 | 250 |
| 507 | 3300044694 | Ga0466963_0000589 | Ga0466963_0000589_6159_6974 | 250 |
| 508 | 3300044719 | Ga0466971_0000182 | Ga0466971_0000182_7935_8750 | 250 |
| 509 | 3300044765 | Ga0466970_0000333 | Ga0466970_0000333_21723_22538 | 250 |
| 510 | 3300044765 | Ga0466970_0081512 | Ga0466970_0081512_403_1194 | 250 |
| 511 | 3300044842 | Ga0466957_0012768 | Ga0466957_0012768_981_1796 | 250 |
| 512 | 3300044901 | Ga0466960_0003073 | Ga0466960_0003073_15_818 | 250 |
| 513 | 3300045049 | Ga0466959_0132432 | Ga0466959_0132432_431_1246 | 250 |
| 514 | 3300045836 | Ga0466958_0092900 | Ga0466958_0092900_303_1118 | 250 |
| 515 | 3300045836 | Ga0466958_0142156 | Ga0466958_0142156_410_1213 | 250 |
| 516 | 3300045976 | Ga0466967_0018743 | Ga0466967_0018743_4682_5485 | 250 |
| 517 | 3300045976 | Ga0466967_0577177 | Ga0466967_0577177_10_813 | 250 |
| 518 | 3300046452 | Ga0495617_019949 | Ga0495617_019949_1377_2180 | 250 |
| 519 | 3300046453 | Ga0495627_011288 | Ga0495627_011288_337_1140 | 250 |
| 520 | 3300046455 | Ga0495603_0000346 | Ga0495603_0000346_22190_22981 | 250 |
| 521 | 3300046455 | Ga0495603_0001138 | Ga0495603_0001138_4153_4956 | 250 |
| 522 | 3300046455 | Ga0495603_0025888 | Ga0495603_0025888_800_1591 | 250 |
| 523 | 3300046459 | Ga0495629_0004470 | Ga0495629_0004470_8654_9445 | 250 |
| 524 | 3300046459 | Ga0495629_0033791 | Ga0495629_0033791_2532_3323 | 250 |
| 525 | 3300046459 | Ga0495629_0139175 | Ga0495629_0139175_418_1221 | 250 |
| 526 | 3300046459 | Ga0495629_0292823 | Ga0495629_0292823_250_1053 | 250 |
| 527 | 3300046460 | Ga0495638_0132150 | Ga0495638_0132150_331_1143 | 250 |
| 528 | 3300046462 | Ga0495651_0138717 | Ga0495651_0138717_437_1240 | 250 |
| 529 | 3300046473 | Ga0495582_0239317 | Ga0495582_0239317_171_974 | 250 |
| 530 | 3300046474 | Ga0495605_0007393 | Ga0495605_0007393_593_1396 | 250 |
| 531 | 3300046476 | Ga0495662_0006099 | Ga0495662_0006099_2296_3099 | 250 |
| 532 | 3300046476 | Ga0495662_0029742 | Ga0495662_0029742_401_1204 | 250 |
| 533 | 3300046476 | Ga0495662_0133567 | Ga0495662_0133567_164_967 | 250 |
| 534 | 3300046477 | Ga0495664_0003683 | Ga0495664_0003683_353_1165 | 250 |
| 535 | 3300046492 | Ga0495585_0041446 | Ga0495585_0041446_566_1357 | 250 |
| 536 | 3300046492 | Ga0495585_0109717 | Ga0495585_0109717_292_1095 | 250 |
| 537 | 3300046492 | Ga0495585_0124801 | Ga0495585_0124801_373_1185 | 250 |
| 538 | 3300046499 | Ga0495594_0023051 | Ga0495594_0023051_2031_2834 | 250 |
| 539 | 3300046501 | Ga0495607_0041936 | Ga0495607_0041936_420_1223 | 250 |
| 540 | 3300046501 | Ga0495607_0118011 | Ga0495607_0118011_184_996 | 250 |
| 541 | 3300046506 | Ga0495583_0012198 | Ga0495583_0012198_3922_4725 | 250 |
| 542 | 3300046506 | Ga0495583_0072072 | Ga0495583_0072072_401_1204 | 250 |
| 543 | 3300046507 | Ga0495606_0009840 | Ga0495606_0009840_5123_5926 | 250 |
| 544 | 3300046514 | Ga0495618_0013838 | Ga0495618_0013838_366_1178 | 250 |
| 545 | 3300046514 | Ga0495618_0019166 | Ga0495618_0019166_2896_3699 | 250 |
| 546 | 3300046515 | Ga0495620_0006186 | Ga0495620_0006186_4299_5102 | 250 |
| 547 | 3300046515 | Ga0495620_0007325 | Ga0495620_0007325_154_957 | 250 |
| 548 | 3300046518 | Ga0495631_0008128 | Ga0495631_0008128_1204_2007 | 250 |
| 549 | 3300046519 | Ga0495632_0090721 | Ga0495632_0090721_79_882 | 250 |
| 550 | 3300046522 | Ga0495643_0006578 | Ga0495643_0006578_3923_4726 | 250 |
| 551 | 3300046524 | Ga0495648_0062861 | Ga0495648_0062861_1104_1907 | 250 |
| 552 | 3300046526 | Ga0495666_0023752 | Ga0495666_0023752_1172_1975 | 250 |
| 553 | 3300046529 | Ga0495652_0073859 | Ga0495652_0073859_1250_2062 | 250 |
| 554 | 3300046533 | Ga0495640_0012019 | Ga0495640_0012019_2566_3369 | 250 |
| 555 | 3300046533 | Ga0495640_0042414 | Ga0495640_0042414_339_1151 | 250 |
| 556 | 3300046535 | Ga0495586_0060304 | Ga0495586_0060304_177_980 | 250 |
| 557 | 3300046536 | Ga0495587_0163115 | Ga0495587_0163115_433_1236 | 250 |
| 558 | 3300046542 | Ga0495597_0026787 | Ga0495597_0026787_198_1001 | 250 |
| 559 | 3300046543 | Ga0495645_0007791 | Ga0495645_0007791_1196_2008 | 250 |
| 560 | 3300046543 | Ga0495645_0201940 | Ga0495645_0201940_74_877 | 250 |
| 561 | 3300046559 | Ga0495667_0020998 | Ga0495667_0020998_628_1431 | 250 |
| 562 | 3300046616 | Ga0495668_0050625 | Ga0495668_0050625_173_976 | 250 |
| 563 | 3300046642 | Ga0495634_0000101 | Ga0495634_0000101_12430_13242 | 250 |
| 564 | 3300046648 | Ga0495611_0014769 | Ga0495611_0014769_1020_1823 | 250 |
| 565 | 3300046660 | Ga0495625_0003505 | Ga0495625_0003505_8797_9609 | 250 |
| 566 | 3300046660 | Ga0495625_0076350 | Ga0495625_0076350_47_850 | 250 |
| 567 | 3300046663 | Ga0495635_0010250 | Ga0495635_0010250_3805_4617 | 250 |
| 568 | 3300046663 | Ga0495635_0190819 | Ga0495635_0190819_534_1337 | 250 |
| 569 | 3300046665 | Ga0495661_0011434 | Ga0495661_0011434_2400_3203 | 250 |
| 570 | 3300046665 | Ga0495661_0112189 | Ga0495661_0112189_355_1167 | 250 |
| 571 | 3300046674 | Ga0495588_0004893 | Ga0495588_0004893_499_1302 | 250 |
| 572 | 3300046674 | Ga0495588_0006042 | Ga0495588_0006042_4199_5011 | 250 |
| 573 | 3300046675 | Ga0495657_0026616 | Ga0495657_0026616_179_982 | 250 |
| 574 | 3300046679 | Ga0495623_0037985 | Ga0495623_0037985_1322_2125 | 250 |
| 575 | 3300046680 | Ga0495646_0002319 | Ga0495646_0002319_523_1326 | 250 |
| 576 | 3300046683 | Ga0495658_0031545 | Ga0495658_0031545_845_1657 | 250 |
| 577 | 3300046689 | Ga0495613_0000709 | Ga0495613_0000709_8382_9173 | 250 |
| 578 | 3300046689 | Ga0495613_0005664 | Ga0495613_0005664_323_1135 | 250 |
| 579 | 3300046689 | Ga0495613_0226624 | Ga0495613_0226624_397_1200 | 250 |
| 580 | 3300046690 | Ga0495624_0184081 | Ga0495624_0184081_312_1115 | 250 |
| 581 | 3300046692 | Ga0495671_0015852 | Ga0495671_0015852_2326_3138 | 250 |
| 582 | 3300046694 | Ga0495649_0039674 | Ga0495649_0039674_492_1295 | 250 |
| 583 | 3300046794 | Ga0495589_0003707 | Ga0495589_0003707_7050_7862 | 250 |
| 584 | 3300046794 | Ga0495589_0018742 | Ga0495589_0018742_383_1186 | 250 |
| 585 | 3300046794 | Ga0495589_0197374 | Ga0495589_0197374_51_854 | 250 |
| 586 | 3300046810 | Ga0495660_0047520 | Ga0495660_0047520_497_1300 | 250 |
| 587 | 3300047315 | Ga0495581_0001118 | Ga0495581_0001118_252_1064 | 250 |
| 588 | 3300047315 | Ga0495581_0124239 | Ga0495581_0124239_303_1106 | 250 |
| 589 | 3300047317 | Ga0495604_0000157 | Ga0495604_0000157_57387_58199 | 250 |
| 590 | 3300047317 | Ga0495604_0270179 | Ga0495604_0270179_141_944 | 250 |
| 591 | 3300047318 | Ga0495636_0002685 | Ga0495636_0002685_5763_6566 | 250 |
| 592 | 3300047321 | Ga0495676_0012848 | Ga0495676_0012848_6329_7132 | 250 |
| 593 | 3300047321 | Ga0495676_0015066 | Ga0495676_0015066_408_1199 | 250 |
| 594 | 3300047321 | Ga0495676_0025899 | Ga0495676_0025899_2457_3269 | 250 |
| 595 | 3300047321 | Ga0495676_0028506 | Ga0495676_0028506_341_1132 | 250 |
| 596 | 3300047321 | Ga0495676_0072169 | Ga0495676_0072169_383_1186 | 250 |
| 597 | 3300047321 | Ga0495676_0072316 | Ga0495676_0072316_729_1541 | 250 |
| 598 | 3300047322 | Ga0495680_0046786 | Ga0495680_0046786_1749_2552 | 250 |
| 599 | 3300047443 | Ga0495687_000830 | Ga0495687_000830_2913_3725 | 250 |
| 600 | 3300047443 | Ga0495687_095925 | Ga0495687_095925_179_982 | 250 |
| 601 | 3300047444 | Ga0495675_0033019 | Ga0495675_0033019_2469_3272 | 250 |
| 602 | 3300047444 | Ga0495675_0080595 | Ga0495675_0080595_193_996 | 250 |
| 603 | 3300047445 | Ga0495677_0120826 | Ga0495677_0120826_103_906 | 250 |
| 604 | 3300047447 | Ga0495685_066434 | Ga0495685_066434_26_829 | 250 |
| 605 | 3300047447 | Ga0495685_088917 | Ga0495685_088917_14_817 | 250 |
| 606 | 3300047470 | Ga0495681_0004221 | Ga0495681_0004221_7422_8234 | 250 |
| 607 | 3300047470 | Ga0495681_0031125 | Ga0495681_0031125_1642_2445 | 250 |
| 608 | 3300047470 | Ga0495681_0109039 | Ga0495681_0109039_222_1025 | 250 |
| 609 | 3300047472 | Ga0495686_0046841 | Ga0495686_0046841_1397_2200 | 250 |
| 610 | 3300047673 | Ga0495593_0025313 | Ga0495593_0025313_524_1336 | 250 |
| 611 | 3300048088 | Ga0495602_0071117 | Ga0495602_0071117_900_1712 | 250 |
| 612 | 3300048089 | Ga0495614_0001144 | Ga0495614_0001144_2176_2967 | 250 |
| 613 | 3300048089 | Ga0495614_0046450 | Ga0495614_0046450_214_1026 | 250 |
| 614 | 3300048091 | Ga0495626_0129889 | Ga0495626_0129889_85_888 | 250 |
| 615 | 3300048905 | Ga0496102_0000164 | Ga0496102_0000164_52518_53348 | 250 |
| 616 | 3300048906 | Ga0496103_0001561 | Ga0496103_0001561_6714_7544 | 250 |
| 617 | 3300048912 | Ga0496109_0157242 | Ga0496109_0157242_473_1276 | 250 |
| 618 | 3300048921 | Ga0496118_0008577 | Ga0496118_0008577_4685_5515 | 250 |
| 619 | 3300049568 | Ga0501031_0033051 | Ga0501031_0033051_2518_3315 | 250 |
| 620 | 3300049568 | Ga0501031_0196399 | Ga0501031_0196399_359_1162 | 250 |
| 621 | 3300049569 | Ga0501032_0029582 | Ga0501032_0029582_124_921 | 250 |
| 622 | 3300049569 | Ga0501032_0035790 | Ga0501032_0035790_1244_2038 | 250 |
| 623 | 3300049570 | Ga0501033_0001964 | Ga0501033_0001964_16941_17744 | 250 |
| 624 | 3300049570 | Ga0501033_0008400 | Ga0501033_0008400_49_900 | 250 |
| 625 | 3300049570 | Ga0501033_0267635 | Ga0501033_0267635_155_952 | 250 |
| 626 | 3300049570 | Ga0501033_0317098 | Ga0501033_0317098_41_883 | 250 |
| 627 | 3300049571 | Ga0501034_0011223 | Ga0501034_0011223_6113_6910 | 250 |
| 628 | 3300049571 | Ga0501034_0027632 | Ga0501034_0027632_361_1203 | 250 |
| 629 | 3300049571 | Ga0501034_0028951 | Ga0501034_0028951_4394_5188 | 250 |
| 630 | 3300049571 | Ga0501034_0185864 | Ga0501034_0185864_1142_1993 | 250 |
| 631 | 3300049571 | Ga0501034_0486015 | Ga0501034_0486015_315_1109 | 250 |
| 632 | 3300049572 | Ga0501036_0026454 | Ga0501036_0026454_861_1655 | 250 |
| 633 | 3300049572 | Ga0501036_0124736 | Ga0501036_0124736_473_1324 | 250 |
| 634 | 3300049572 | Ga0501036_0214853 | Ga0501036_0214853_383_1225 | 250 |
| 635 | 3300049573 | Ga0501037_0005983 | Ga0501037_0005983_925_1719 | 250 |
| 636 | 3300049573 | Ga0501037_0274650 | Ga0501037_0274650_48_845 | 250 |
| 637 | 3300049573 | Ga0501037_0423079 | Ga0501037_0423079_62_865 | 250 |
| 638 | 3300049574 | Ga0501038_0016566 | Ga0501038_0016566_411_1262 | 250 |
| 639 | 3300049574 | Ga0501038_0048752 | Ga0501038_0048752_1197_1994 | 250 |
| 640 | 3300049575 | Ga0501039_0107064 | Ga0501039_0107064_339_1136 | 250 |
| 641 | 3300049575 | Ga0501039_0144004 | Ga0501039_0144004_774_1568 | 250 |
| 642 | 3300049575 | Ga0501039_0154811 | Ga0501039_0154811_539_1342 | 250 |
| 643 | 3300049575 | Ga0501039_0247627 | Ga0501039_0247627_215_1066 | 250 |
| 644 | 3300049579 | Ga0501043_0001119 | Ga0501043_0001119_16589_17440 | 250 |
| 645 | 3300049579 | Ga0501043_0012175 | Ga0501043_0012175_4690_5487 | 250 |
| 646 | 3300049579 | Ga0501043_0395965 | Ga0501043_0395965_186_989 | 250 |
| 647 | 3300049580 | Ga0501046_0199432 | Ga0501046_0199432_287_1090 | 250 |
| 648 | 3300049580 | Ga0501046_0260384 | Ga0501046_0260384_282_1184 | 250 |
| 649 | 3300049581 | Ga0501047_0025359 | Ga0501047_0025359_472_1266 | 250 |
| 650 | 3300049581 | Ga0501047_0108182 | Ga0501047_0108182_1839_2636 | 250 |
| 651 | 3300049581 | Ga0501047_0125811 | Ga0501047_0125811_296_1099 | 250 |
| 652 | 3300049581 | Ga0501047_0208539 | Ga0501047_0208539_662_1513 | 250 |
| 653 | 3300049586 | Ga0501070_0039469 | Ga0501070_0039469_2508_3302 | 250 |
| 654 | 3300049586 | Ga0501070_0135970 | Ga0501070_0135970_257_1108 | 250 |
| 655 | 3300049586 | Ga0501070_0272429 | Ga0501070_0272429_99_911 | 250 |
| 656 | 3300049590 | Ga0501074_0073420 | Ga0501074_0073420_53_904 | 250 |
| 657 | 3300049742 | Ga0501080_0009424 | Ga0501080_0009424_5943_6746 | 250 |
| 658 | 3300049822 | Ga0501035_0076126 | Ga0501035_0076126_581_1378 | 250 |
| 659 | 3300049822 | Ga0501035_0151575 | Ga0501035_0151575_880_1674 | 250 |
| 660 | 3300049823 | Ga0501044_0003673 | Ga0501044_0003673_12129_12932 | 250 |
| 661 | 3300049823 | Ga0501044_0014813 | Ga0501044_0014813_3492_4394 | 250 |
| 662 | 3300049823 | Ga0501044_0073080 | Ga0501044_0073080_413_1264 | 250 |
| 663 | 3300049823 | Ga0501044_0140646 | Ga0501044_0140646_1529_2323 | 250 |
| 664 | 3300049823 | Ga0501044_0174026 | Ga0501044_0174026_894_1688 | 250 |
| 665 | 3300049824 | Ga0501045_0256243 | Ga0501045_0256243_331_1128 | 250 |
| 666 | 3300050492 | nmdc:mga0yw44_161365_c1 | nmdc:mga0yw44_161365_c1_144_950 | 250 |
| 667 | 3300050495 | nmdc:mga04h51_1911_c1 | nmdc:mga04h51_1911_c1_2280_3083 | 250 |
| 668 | 3300050496 | nmdc:mga07m45_198089_c1 | nmdc:mga07m45_198089_c1_288_1100 | 250 |
| 669 | 3300053078 | Ga0495612_0150042 | Ga0495612_0150042_130_942 | 250 |
| 670 | 3300053083 | Ga0495655_0007409 | Ga0495655_0007409_1139_1942 | 250 |
| 671 | 3300053085 | Ga0495619_0213089 | Ga0495619_0213089_111_914 | 250 |
| 672 | 3300053092 | Ga0500583_0175554 | Ga0500583_0175554_141_953 | 250 |
| 673 | 3300053095 | Ga0500640_004906 | Ga0500640_004906_3562_4374 | 250 |
| 674 | 3300053101 | Ga0500553_103176 | Ga0500553_103176_355_1167 | 250 |
| 675 | 3300053107 | Ga0500560_009278 | Ga0500560_009278_56_868 | 250 |
| 676 | 3300053111 | Ga0500572_006859 | Ga0500572_006859_1058_1870 | 250 |
| 677 | 3300053140 | Ga0500573_0036186 | Ga0500573_0036186_854_1645 | 250 |
| 678 | 3300061719 | Ga0466962_0000045 | Ga0466962_0000045_35696_36511 | 250 |
| 679 | iso_pu_bacteria | 2582581313 | 2585307494 | 250 |
| 680 | iso_pu_bacteria | 2643221647 | 2644270756 | 250 |
| 681 | iso_pu_bacteria | 2784746768 | 2785367578 | 250 |
| 682 | iso_pu_bacteria | 2786546132 | 2786668638 | 250 |
| 683 | iso_pu_bacteria | 2862290372 | 2862293125 | 250 |
| 684 | iso_pu_bacteria | 2867428634 | 2867438042 | 250 |
| 685 | iso_pu_bacteria | 2877676314 | 2877682970 | 250 |
| 686 | iso_pu_bacteria | 2954380949 | 2954388187 | 250 |
| 687 | iso_pu_bacteria | 2954673503 | 2954674916 | 250 |
| 688 | iso_pu_bacteria | 2954682443 | 2954689219 | 250 |
| 689 | iso_pu_bacteria | 2954691527 | 2954698992 | 250 |
| 690 | iso_pu_bacteria | 2954701450 | 2954703229 | 250 |
| 691 | iso_pu_bacteria | 2954711539 | 2954717946 | 250 |
| 692 | iso_pu_bacteria | 2954721474 | 2954727912 | 250 |
| 693 | iso_pu_bacteria | 2954731030 | 2954733892 | 250 |
| 694 | iso_pu_bacteria | 2954740390 | 2954746810 | 250 |
| 695 | iso_pu_bacteria | 2954749733 | 2954752775 | 250 |
| 696 | iso_pu_bacteria | 2954759201 | 2954765925 | 250 |
| 697 | iso_pu_bacteria | 8056447290 | 8056451659 | 250 |
| 698 | 3300020070 | Ga0206356_11557667 | Ga0206356_115576672 | 251 |
| 699 | 3300025932 | Ga0207690_10156077 | Ga0207690_101560772 | 251 |
| 700 | iso_pu_bacteria | 2891554331 | 2891562317 | 251 |
| 701 | 3300013307 | Ga0157372_10256350 | Ga0157372_102563502 | 252 |
| 702 | 3300031995 | Ga0307409_100078736 | Ga0307409_1000787362 | 252 |
| 703 | 3300054114 | Ga0501084_0125367 | Ga0501084_0125367_447_1250 | 252 |
| 704 | 3300001989 | JGI24739J22299_10002243 | JGI24739J22299_100022432 | 254 |
| 705 | 3300002067 | JGI24735J21928_10019146 | JGI24735J21928_100191462 | 254 |
| 706 | 3300005840 | Ga0068870_10191954 | Ga0068870_101919542 | 254 |
| 707 | 3300013105 | Ga0157369_10490256 | Ga0157369_104902561 | 254 |
| 708 | 3300013307 | Ga0157372_10168322 | Ga0157372_101683222 | 254 |
| 709 | 3300013308 | Ga0157375_10761319 | Ga0157375_107613192 | 254 |
| 710 | 3300025904 | Ga0207647_10008441 | Ga0207647_100084412 | 254 |
| 711 | 3300025904 | Ga0207647_10130559 | Ga0207647_101305592 | 254 |
| 712 | 3300031456 | Ga0307513_10157480 | Ga0307513_101574802 | 254 |
| 713 | 3300031456 | Ga0307513_10454171 | Ga0307513_104541712 | 254 |
| 714 | 3300049823 | Ga0501044_0640362 | Ga0501044_0640362_18_782 | 254 |
| 715 | 3300059424 | Ga0590075_033321 | Ga0590075_033321_23_862 | 254 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jsb-assembly1.cif.gz_A | crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx | 0.977 | 2 | 252 |
| 4omr-assembly1.cif.gz_A | crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx in complex with acetoacetyl-coa | 0.9652 | 2 | 248 |
| 4jvt-assembly1.cif.gz_A | crystal structure of tfu_1878, a putative enoyl-coa hydratase fromthermobifida fusca yx in complex with coa | 0.9615 | 2 | 251 |
| 4jsb-assembly1.cif.gz_A | crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx | 0.9467 | 2 | 252 |
| 4omr-assembly1.cif.gz_A | crystal structure of tfu_1878, a putative enoyl-coa hydratase from thermobifida fusca yx in complex with acetoacetyl-coa | 0.9242 | 2 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jvtA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9911 | 212 | 251 | 1.10.12.10 |
| 4omrA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9726 | 212 | 248 | 1.10.12.10 |
| 4jvtA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9449 | 212 | 251 | 1.10.12.10 |
| 4omrA01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.944 | 3 | 211 | 3.90.226.10 |
| 3rsiB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; | 0.936 | 110 | 209 | 3.90.226.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A542DUQ4-F1-model_v4 | Enoyl-CoA hydratase | 0.9992 | 1 | 254 |
GO:0006631
GO:0016853 |
| AF-A0A7W7M7L7-F1-model_v4 | Enoyl-CoA hydratase/carnithine racemase | 0.9938 | 83 | 251 |
GO:0003824
GO:0006635 |
| AF-A0A561BZX7-F1-model_v4 | Enoyl-CoA hydratase | 0.9934 | 1 | 254 |
GO:0006635
GO:0016853 |
| AF-A0A4S5B4L5-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9898 | 2 | 252 |
GO:0016853
|
| AF-A0A561BZX7-F1-model_v4 | Enoyl-CoA hydratase | 0.9895 | 1 | 254 |
GO:0006635
GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar