F476936

General Info

Members Datasets Scaffolds Average Seq Length
714 236 1428 267

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100459999|Ga0075434_1004599992
Length 285
Sequence MIARLGRILRNQQGQVVTGRAAAARPPIKASTLRKDTWWALPLTVVLVLGSFIVYSTWAGLQNANYWAPPYLSPFYSPCLSAKCLHVTFGYGLPDISLPIIGILSPAFLILWGPGLFRLTCYYYRKAYYRSFWLAPPACAVPDAKRGYTGETRFPLIFQNLHRYAWYVAVIFIVLLTWDAVLAFRFPMPDGSHRLGIGVGTLVMWVNVILLAGYTFSCHSCRHVCGGHVDVFSRAKTRYRVWHFFTRLNENHPAFAWLSLFSVGLTDLYIRLVAMGVIRDLRIVF

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.42
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100459999 3300006871 Bacteria 1294
2 JGI25406J46586_10017390 3300003203 Bacteria 2974
3 JGI26129J50193_1000967 3300003349 Bacteria 1893
4 Ga0065712_10178808 3300005290 Bacteria 1203
5 Ga0065707_10134579 3300005295 Bacteria 1863
6 Ga0070676_10001402 3300005328 Bacteria 12171
7 Ga0070683_100234008 3300005329 Bacteria 1747
8 Ga0070670_100001558 3300005331 Bacteria 18473
9 Ga0068869_100000795 3300005334 Bacteria 18019
10 Ga0068869_100046889 3300005334 Bacteria 3118
11 Ga0068869_100114011 3300005334 Bacteria 2060
12 Ga0068869_100546733 3300005334 Bacteria 972
13 Ga0070680_100002409 3300005336 Bacteria 13849
14 Ga0070680_100049260 3300005336 Bacteria 3434
15 Ga0070680_100135883 3300005336 Bacteria 2060
16 Ga0070682_100000179 3300005337 Bacteria 47429
17 Ga0068868_100043820 3300005338 Bacteria 3496
18 Ga0068868_100256546 3300005338 Bacteria 1473
19 Ga0070660_100000476 3300005339 Bacteria 26750
20 Ga0070689_100073029 3300005340 Bacteria 2682
21 Ga0070691_10002169 3300005341 Bacteria 8686
22 Ga0070691_10111549 3300005341 Bacteria 1369
23 Ga0070661_100000876 3300005344 Bacteria 21630
24 Ga0070692_10000828 3300005345 Bacteria 10344
25 Ga0070692_10001115 3300005345 Bacteria 9386
26 Ga0070692_10046023 3300005345 Bacteria 2253
27 Ga0070692_10250019 3300005345 Bacteria 1061
28 Ga0070669_100017830 3300005353 Bacteria 5067
29 Ga0070669_100414852 3300005353 Bacteria 1104
30 Ga0070673_100447972 3300005364 Bacteria 1161
31 Ga0070688_100064606 3300005365 Bacteria 2323
32 Ga0070659_100153974 3300005366 Bacteria 1876
33 Ga0070701_10069613 3300005438 Bacteria 1877
34 Ga0070705_100000333 3300005440 Bacteria 27695
35 Ga0070705_100035395 3300005440 Bacteria 2799
36 Ga0070705_100078316 3300005440 Bacteria 2021
37 Ga0070705_100101787 3300005440 Bacteria 1815
38 Ga0070705_100122966 3300005440 Bacteria 1679
39 Ga0070705_100140294 3300005440 Bacteria 1590
40 Ga0070700_100026807 3300005441 Bacteria 3408
41 Ga0070700_100212381 3300005441 Bacteria 1366
42 Ga0070700_100477935 3300005441 Bacteria 954
43 Ga0070694_100022054 3300005444 Bacteria 4078
44 Ga0070694_100075232 3300005444 Bacteria 2335
45 Ga0070694_100182553 3300005444 Bacteria 1553
46 Ga0070694_100248203 3300005444 Bacteria 1345
47 Ga0070708_100006589 3300005445 Bacteria 9242
48 Ga0070708_100016216 3300005445 Bacteria 6177
49 Ga0070708_100055617 3300005445 Bacteria 3519
50 Ga0070708_100075366 3300005445 Bacteria 3045
51 Ga0070708_100159392 3300005445 Bacteria 2102
52 Ga0070708_100186897 3300005445 Bacteria 1938
53 Ga0070663_100226349 3300005455 Bacteria 1471
54 Ga0070663_100480325 3300005455 Bacteria 1029
55 Ga0070662_100027815 3300005457 Bacteria 3931
56 Ga0070681_10004124 3300005458 Bacteria 13743
57 Ga0068867_100000455 3300005459 Bacteria 27140
58 Ga0068867_100194989 3300005459 Bacteria 1618
59 Ga0068867_100547178 3300005459 Bacteria 1002
60 Ga0070706_100047684 3300005467 Bacteria 3954
61 Ga0070706_100062204 3300005467 Bacteria 3449
62 Ga0070706_100077558 3300005467 Bacteria 3075
63 Ga0070706_100116134 3300005467 Bacteria 2492
64 Ga0070706_100117317 3300005467 Bacteria 2479
65 Ga0070706_100224884 3300005467 Bacteria 1752
66 Ga0070706_100603264 3300005467 Bacteria 1020
67 Ga0070707_100000108 3300005468 Bacteria 76022
68 Ga0070707_100017934 3300005468 Bacteria 6656
69 Ga0070707_100103935 3300005468 Bacteria 2753
70 Ga0070707_100113897 3300005468 Bacteria 2624
71 Ga0070707_100261817 3300005468 Bacteria 1682
72 Ga0070707_100593067 3300005468 Bacteria 1070
73 Ga0070707_100603131 3300005468 Bacteria 1060
74 Ga0070698_100000691 3300005471 Bacteria 36018
75 Ga0070698_100011480 3300005471 Bacteria 9401
76 Ga0070698_100014980 3300005471 Bacteria 8196
77 Ga0070698_100094612 3300005471 Bacteria 2966
78 Ga0070698_100161752 3300005471 Bacteria 2182
79 Ga0070698_100258778 3300005471 Bacteria 1673
80 Ga0070699_100003274 3300005518 Bacteria 14324
81 Ga0070699_100013457 3300005518 Bacteria 7045
82 Ga0070699_100013570 3300005518 Bacteria 7013
83 Ga0070699_100015560 3300005518 Bacteria 6538
84 Ga0070699_100020088 3300005518 Bacteria 5757
85 Ga0070699_100061434 3300005518 Bacteria 3256
86 Ga0070699_100081230 3300005518 Bacteria 2826
87 Ga0070699_100224249 3300005518 Bacteria 1675
88 Ga0070699_100230631 3300005518 Bacteria 1651
89 Ga0070699_100279410 3300005518 Bacteria 1495
90 Ga0070699_100302754 3300005518 Bacteria 1434
91 Ga0070679_100007477 3300005530 Bacteria 10214
92 Ga0070679_100203873 3300005530 Bacteria 1943
93 Ga0070684_100164633 3300005535 Bacteria 2013
94 Ga0070697_100023932 3300005536 Bacteria 4860
95 Ga0070697_100065632 3300005536 Bacteria 2966
96 Ga0070697_100093448 3300005536 Bacteria 2490
97 Ga0070697_100124263 3300005536 Bacteria 2161
98 Ga0070697_100285780 3300005536 Bacteria 1416
99 Ga0070697_100349732 3300005536 Bacteria 1276
100 Ga0070697_100449415 3300005536 Bacteria 1122
101 Ga0068853_100191463 3300005539 Bacteria 1858
102 Ga0070672_100287910 3300005543 Bacteria 1390
103 Ga0070695_100003891 3300005545 Bacteria 8713
104 Ga0070695_100061321 3300005545 Bacteria 2440
105 Ga0070695_100082910 3300005545 Bacteria 2123
106 Ga0070695_100276227 3300005545 Unclassified 1233
107 Ga0070696_100036054 3300005546 Bacteria 3408
108 Ga0070696_100108775 3300005546 Bacteria 1994
109 Ga0070696_100272373 3300005546 Bacteria 1288
110 Ga0070693_100009781 3300005547 Bacteria 4780
111 Ga0070693_100338664 3300005547 Bacteria 1026
112 Ga0070704_100015876 3300005549 Bacteria 4742
113 Ga0070704_100046308 3300005549 Bacteria 3032
114 Ga0070704_100047238 3300005549 Bacteria 3008
115 Ga0070704_100103095 3300005549 Bacteria 2154
116 Ga0068855_100000225 3300005563 Bacteria 72196
117 Ga0070664_100017355 3300005564 Bacteria 5910
118 Ga0068857_100237393 3300005577 Bacteria 1668
119 Ga0068854_100013613 3300005578 Bacteria 5346
120 Ga0068854_100484107 3300005578 Bacteria 1039
121 Ga0068854_100511278 3300005578 Bacteria 1013
122 Ga0068854_100626729 3300005578 Bacteria 921
123 Ga0068856_100001169 3300005614 Bacteria 27611
124 Ga0068852_100142485 3300005616 Bacteria 2220
125 Ga0068859_100001393 3300005617 Bacteria 24544
126 Ga0068859_100089345 3300005617 Bacteria 3131
127 Ga0068864_100285188 3300005618 Bacteria 1542
128 Ga0068866_10060874 3300005718 Bacteria 1959
129 Ga0068866_10267607 3300005718 Bacteria 1053
130 Ga0068861_100018775 3300005719 Bacteria 4930
131 Ga0068870_10000139 3300005840 Bacteria 25224
132 Ga0068863_100032824 3300005841 Bacteria 4947
133 Ga0068863_100079836 3300005841 Bacteria 3098
134 Ga0068858_100189302 3300005842 Bacteria 1944
135 Ga0068860_100001109 3300005843 Bacteria 29627
136 Ga0068860_100315180 3300005843 Bacteria 1534
137 Ga0068862_100003750 3300005844 Bacteria 12958
138 Ga0068862_100080533 3300005844 Bacteria 2824
139 Ga0068862_100087038 3300005844 Bacteria 2717
140 Ga0068862_100143465 3300005844 Bacteria 2121
141 Ga0068862_100546214 3300005844 Bacteria 1106
142 Ga0081455_10001810 3300005937 Bacteria 25776
143 Ga0081538_10015371 3300005981 Bacteria 5929
144 Ga0081540_1005034 3300005983 Bacteria 9916
145 Ga0081539_10000005 3300005985 Bacteria 549026
146 Ga0075432_10024663 3300006058 Bacteria 2062
147 Ga0070715_10016204 3300006163 Bacteria 2796
148 Ga0070716_100085712 3300006173 Bacteria 1893
149 Ga0070712_100006589 3300006175 Bacteria 7212
150 Ga0075367_10339685 3300006178 Unclassified 947
151 Ga0068871_100259299 3300006358 Bacteria 1516
152 Ga0075428_100000924 3300006844 Bacteria 31024
153 Ga0075428_100001380 3300006844 Bacteria 25833
154 Ga0075428_100023900 3300006844 Bacteria 6763
155 Ga0075428_100030517 3300006844 Bacteria 5961
156 Ga0075428_100054921 3300006844 Bacteria 4364
157 Ga0075428_100182861 3300006844 Bacteria 2268
158 Ga0075428_100197674 3300006844 Bacteria 2174
159 Ga0075428_100224837 3300006844 Bacteria 2026
160 Ga0075428_100624849 3300006844 Bacteria 1150
161 Ga0075430_100000019 3300006846 Bacteria 86721
162 Ga0075430_100000487 3300006846 Bacteria 29740
163 Ga0075430_100016723 3300006846 Bacteria 6247
164 Ga0075430_100046733 3300006846 Bacteria 3656
165 Ga0075430_100061652 3300006846 Bacteria 3151
166 Ga0075430_100147154 3300006846 Bacteria 1962
167 Ga0075430_100212495 3300006846 Bacteria 1605
168 Ga0075431_100000797 3300006847 Bacteria 27524
169 Ga0075431_100002180 3300006847 Bacteria 18719
170 Ga0075431_100002229 3300006847 Bacteria 18559
171 Ga0075431_100008469 3300006847 Bacteria 10298
172 Ga0075431_100011273 3300006847 Bacteria 9005
173 Ga0075431_100023868 3300006847 Bacteria 6261
174 Ga0075431_100072397 3300006847 Bacteria 3556
175 Ga0075431_100168828 3300006847 Bacteria 2249
176 Ga0075431_100340726 3300006847 Bacteria 1509
177 Ga0075431_100503852 3300006847 Bacteria 1201
178 Ga0075433_10006420 3300006852 Bacteria 9298
179 Ga0075433_10032400 3300006852 Bacteria 4476
180 Ga0075433_10056759 3300006852 Bacteria 3421
181 Ga0075433_10062927 3300006852 Bacteria 3250
182 Ga0075433_10082435 3300006852 Bacteria 2836
183 Ga0075433_10166688 3300006852 Bacteria 1960
184 Ga0075433_10281102 3300006852 Bacteria 1474
185 Ga0075434_100022146 3300006871 Bacteria 6189
186 Ga0075434_100031633 3300006871 Bacteria 5217
187 Ga0075434_100033398 3300006871 Bacteria 5078
188 Ga0075434_100087316 3300006871 Bacteria 3119
189 Ga0075434_100156094 3300006871 Bacteria 2301
190 Ga0075434_100163988 3300006871 Bacteria 2242
191 Ga0075434_100167389 3300006871 Bacteria 2218
192 Ga0075434_100223242 3300006871 Bacteria 1904
193 Ga0075434_100232081 3300006871 Bacteria 1865
194 Ga0075429_100000859 3300006880 Bacteria 23924
195 Ga0075429_100010038 3300006880 Bacteria 8205
196 Ga0075429_100011531 3300006880 Bacteria 7665
197 Ga0075429_100021240 3300006880 Bacteria 5627
198 Ga0075429_100027920 3300006880 Bacteria 4899
199 Ga0075429_100030148 3300006880 Bacteria 4712
200 Ga0075429_100144176 3300006880 Bacteria 2084
201 Ga0075429_100424371 3300006880 Bacteria 1165
202 Ga0075429_100611439 3300006880 Bacteria 955
203 Ga0068865_100124729 3300006881 Bacteria 1920
204 Ga0075436_100001157 3300006914 Bacteria 17854
205 Ga0075436_100015235 3300006914 Bacteria 5266
206 Ga0075436_100041000 3300006914 Bacteria 3195
207 Ga0075436_100146490 3300006914 Bacteria 1661
208 Ga0075436_100414469 3300006914 Bacteria 977
209 Ga0097620_100001393 3300006931 Bacteria 24544
210 Ga0097620_100089342 3300006931 Bacteria 3131
211 Ga0075435_100000661 3300007076 Bacteria 21221
212 Ga0075435_100015296 3300007076 Bacteria 5766
213 Ga0075435_100057817 3300007076 Bacteria 3138
214 Ga0075435_100485406 3300007076 Bacteria 1067
215 Ga0099794_10007170 3300007265 Bacteria 4562
216 Ga0099794_10016643 3300007265 Bacteria 3264
217 Ga0099794_10033382 3300007265 Bacteria 2420
218 Ga0099794_10119145 3300007265 Bacteria 1327
219 Ga0111539_10000535 3300009094 Bacteria 48283
220 Ga0111539_10018495 3300009094 Bacteria 8631
221 Ga0111539_10082769 3300009094 Bacteria 3775
222 Ga0111539_10114639 3300009094 Bacteria 3161
223 Ga0111539_10192811 3300009094 Bacteria 2377
224 Ga0111539_10249379 3300009094 Bacteria 2067
225 Ga0111539_10481786 3300009094 Bacteria 1445
226 Ga0114129_10000115 3300009147 Bacteria 80576
227 Ga0114129_10000606 3300009147 Bacteria 44322
228 Ga0114129_10001631 3300009147 Bacteria 30466
229 Ga0114129_10008441 3300009147 Bacteria 14680
230 Ga0114129_10009875 3300009147 Bacteria 13607
231 Ga0114129_10012726 3300009147 Bacteria 11977
232 Ga0114129_10036324 3300009147 Bacteria 6958
233 Ga0114129_10079508 3300009147 Bacteria 4559
234 Ga0114129_10102712 3300009147 Bacteria 3953
235 Ga0114129_10102978 3300009147 Bacteria 3947
236 Ga0114129_10114996 3300009147 Bacteria 3709
237 Ga0114129_10119347 3300009147 Bacteria 3632
238 Ga0114129_10225093 3300009147 Bacteria 2529
239 Ga0114129_10273784 3300009147 Bacteria 2258
240 Ga0114129_10529845 3300009147 Bacteria 1535
241 Ga0114129_10563662 3300009147 Bacteria 1480
242 Ga0114129_10734822 3300009147 Bacteria 1265
243 Ga0114129_10738955 3300009147 Bacteria 1261
244 Ga0114129_10753981 3300009147 Bacteria 1246
245 Ga0114129_10919193 3300009147 Bacteria 1107
246 Ga0105243_10007774 3300009148 Bacteria 8242
247 Ga0105243_10275853 3300009148 Bacteria 1512
248 Ga0105241_10001038 3300009174 Bacteria 21150
249 Ga0105241_10133370 3300009174 Bacteria 2013
250 Ga0105241_10212150 3300009174 Bacteria 1623
251 Ga0105242_10016052 3300009176 Bacteria 5817
252 Ga0105248_10472423 3300009177 Bacteria 1413
253 Ga0105249_10082436 3300009553 Bacteria 2992
254 Ga0105249_10227328 3300009553 Bacteria 1839
255 Ga0105249_10779791 3300009553 Bacteria 1019
256 Ga0105239_10016176 3300010375 Bacteria 8254
257 Ga0105239_10383916 3300010375 Bacteria 1588
258 Ga0105246_10170521 3300011119 Bacteria 1666
259 Ga0157373_10000388 3300013100 Bacteria 35150
260 Ga0157371_10107766 3300013102 Bacteria 1977
261 Ga0157369_10232425 3300013105 Bacteria 1927
262 Ga0157378_10339128 3300013297 Bacteria 1465
263 Ga0163162_10015647 3300013306 Bacteria 7413
264 Ga0163162_10017085 3300013306 Bacteria 7099
265 Ga0163162_10316041 3300013306 Bacteria 1694
266 Ga0163162_10361522 3300013306 Bacteria 1585
267 Ga0163162_11141169 3300013306 Bacteria 884
268 Ga0157372_10000105 3300013307 Bacteria 88007
269 Ga0157372_10072881 3300013307 Bacteria 3870
270 Ga0157380_10135536 3300014326 Bacteria 2107
271 Ga0157379_10190827 3300014968 Bacteria 1851
272 Ga0157379_10414095 3300014968 Bacteria 1240
273 Ga0182007_10037705 3300015262 Bacteria 1622
274 Ga0207653_10019880 3300025885 Bacteria 2120
275 Ga0207653_10038407 3300025885 Bacteria 1564
276 Ga0207642_10233978 3300025899 Bacteria 1034
277 Ga0207688_10012816 3300025901 Bacteria 4558
278 Ga0207645_10005499 3300025907 Bacteria 9176
279 Ga0207643_10001465 3300025908 Bacteria 13545
280 Ga0207684_10000115 3300025910 Bacteria 149762
281 Ga0207684_10019692 3300025910 Bacteria 5772
282 Ga0207684_10073541 3300025910 Bacteria 2903
283 Ga0207684_10132276 3300025910 Bacteria 2141
284 Ga0207684_10148413 3300025910 Bacteria 2017
285 Ga0207684_10359491 3300025910 Bacteria 1253
286 Ga0207654_10004154 3300025911 Bacteria 7301
287 Ga0207654_10082136 3300025911 Bacteria 1942
288 Ga0207707_10000352 3300025912 Bacteria 48248
289 Ga0207671_10168526 3300025914 Bacteria 1699
290 Ga0207693_10025215 3300025915 Bacteria 4715
291 Ga0207663_10207634 3300025916 Bacteria 1417
292 Ga0207660_10000334 3300025917 Bacteria 30356
293 Ga0207660_10570966 3300025917 Bacteria 920
294 Ga0207657_10002597 3300025919 Bacteria 19548
295 Ga0207649_10006035 3300025920 Bacteria 6576
296 Ga0207652_10000466 3300025921 Bacteria 41482
297 Ga0207646_10000250 3300025922 Bacteria 73162
298 Ga0207646_10003851 3300025922 Bacteria 16662
299 Ga0207646_10008025 3300025922 Bacteria 10643
300 Ga0207646_10028619 3300025922 Bacteria 5069
301 Ga0207646_10084314 3300025922 Bacteria 2843
302 Ga0207646_10108278 3300025922 Bacteria 2493
303 Ga0207646_10196959 3300025922 Bacteria 1819
304 Ga0207646_10283279 3300025922 Bacteria 1498
305 Ga0207646_10590039 3300025922 Bacteria 998
306 Ga0207681_10013659 3300025923 Bacteria 5028
307 Ga0207681_10166559 3300025923 Bacteria 1666
308 Ga0207681_10420961 3300025923 Bacteria 1082
309 Ga0207694_10201692 3300025924 Bacteria 1619
310 Ga0207650_10025156 3300025925 Bacteria 4239
311 Ga0207659_10148540 3300025926 Bacteria 1828
312 Ga0207690_10041224 3300025932 Bacteria 3024
313 Ga0207706_10024583 3300025933 Bacteria 5400
314 Ga0207706_10080188 3300025933 Bacteria 2870
315 Ga0207706_10131427 3300025933 Bacteria 2202
316 Ga0207706_10468686 3300025933 Bacteria 1089
317 Ga0207709_10003271 3300025935 Bacteria 9720
318 Ga0207709_10071982 3300025935 Bacteria 2197
319 Ga0207670_10088095 3300025936 Bacteria 2188
320 Ga0207670_10320547 3300025936 Bacteria 1219
321 Ga0207704_10160750 3300025938 Bacteria 1598
322 Ga0207665_10114297 3300025939 Bacteria 1900
323 Ga0207665_10165423 3300025939 Bacteria 1594
324 Ga0207691_10203962 3300025940 Bacteria 1720
325 Ga0207711_10418118 3300025941 Bacteria 1247
326 Ga0207689_10003685 3300025942 Bacteria 13959
327 Ga0207689_10074531 3300025942 Bacteria 2789
328 Ga0207661_10148620 3300025944 Bacteria 2024
329 Ga0207679_10000878 3300025945 Bacteria 19200
330 Ga0207667_10000497 3300025949 Bacteria 51927
331 Ga0207712_10347335 3300025961 Bacteria 1232
332 Ga0207712_10547631 3300025961 Bacteria 995
333 Ga0207640_10088641 3300025981 Bacteria 2136
334 Ga0207640_10100394 3300025981 Bacteria 2027
335 Ga0207640_10476418 3300025981 Bacteria 1034
336 Ga0207658_10165220 3300025986 Bacteria 1818
337 Ga0207677_10228346 3300026023 Bacteria 1498
338 Ga0207677_10422300 3300026023 Bacteria 1136
339 Ga0207703_10019303 3300026035 Bacteria 5325
340 Ga0207703_10318461 3300026035 Bacteria 1424
341 Ga0207639_10002384 3300026041 Bacteria 12612
342 Ga0207678_10013961 3300026067 Bacteria 7060
343 Ga0207678_10253752 3300026067 Bacteria 1507
344 Ga0207708_10135745 3300026075 Bacteria 1927
345 Ga0207708_10248471 3300026075 Bacteria 1433
346 Ga0207708_10396790 3300026075 Bacteria 1140
347 Ga0207708_10456647 3300026075 Bacteria 1065
348 Ga0207708_10570979 3300026075 Bacteria 956
349 Ga0207702_10008955 3300026078 Bacteria 8434
350 Ga0207641_10071148 3300026088 Bacteria 2991
351 Ga0207641_10082607 3300026088 Bacteria 2792
352 Ga0207648_10015946 3300026089 Bacteria 6885
353 Ga0207648_10153126 3300026089 Bacteria 2035
354 Ga0207648_10202775 3300026089 Bacteria 1759
355 Ga0207648_10295593 3300026089 Bacteria 1451
356 Ga0207648_10752173 3300026089 Bacteria 905
357 Ga0207674_10000550 3300026116 Bacteria 49205
358 Ga0207675_100002639 3300026118 Bacteria 17699
359 Ga0207675_100005709 3300026118 Bacteria 11909
360 Ga0207675_100132891 3300026118 Bacteria 2360
361 Ga0207698_10116523 3300026142 Bacteria 2252
362 Ga0209981_1000490 3300027378 Bacteria 5020
363 Ga0209996_1000338 3300027395 Bacteria 5808
364 Ga0210000_1017209 3300027462 Bacteria 1095
365 Ga0209995_1002164 3300027471 Bacteria 3084
366 Ga0209968_1000579 3300027526 Bacteria 5659
367 Ga0209999_1000243 3300027543 Bacteria 7873
368 Ga0209982_1001041 3300027552 Bacteria 3693
369 Ga0210002_1017292 3300027617 Bacteria 1147
370 Ga0209983_1000034 3300027665 Bacteria 19527
371 Ga0209588_1017370 3300027671 Bacteria 2230
372 Ga0209971_1000028 3300027682 Bacteria 53458
373 Ga0209971_1005708 3300027682 Bacteria 2948
374 Ga0209966_1000073 3300027695 Bacteria 44067
375 Ga0209966_1009155 3300027695 Bacteria 1764
376 Ga0209998_10000001 3300027717 Bacteria 203589
377 Ga0209974_10000369 3300027876 Bacteria 14852
378 Ga0209974_10066276 3300027876 Bacteria 1227
379 Ga0207428_10000176 3300027907 Bacteria 89634
380 Ga0207428_10000394 3300027907 Bacteria 54660
381 Ga0207428_10123151 3300027907 Bacteria 1987
382 Ga0207428_10141454 3300027907 Bacteria 1836
383 Ga0268265_10002923 3300028380 Bacteria 12524
384 Ga0268265_10024098 3300028380 Bacteria 4300
385 Ga0268265_10088185 3300028380 Bacteria 2471
386 Ga0268265_10268221 3300028380 Bacteria 1521
387 Ga0268264_10031393 3300028381 Bacteria 4356
388 Ga0268264_10155527 3300028381 Bacteria 2054
389 Ga0268264_10216801 3300028381 Bacteria 1760
390 Ga0307408_100034524 3300031548 Bacteria 3543
391 Ga0307408_100048113 3300031548 Bacteria 3057
392 Ga0307408_100145291 3300031548 Bacteria 1866
393 Ga0307408_100353624 3300031548 Bacteria 1247
394 Ga0307405_10240301 3300031731 Bacteria 1341
395 Ga0307410_10059238 3300031852 Bacteria 2614
396 Ga0307410_10193742 3300031852 Bacteria 1547
397 Ga0307416_100599922 3300032002 Bacteria 1181
398 Ga0307411_10063789 3300032005 Bacteria 2464
399 Ga0307411_10334865 3300032005 Bacteria 1228
400 Ga0373959_0013857 3300034820 Bacteria 1460
401 Ga0373940_0017681 3300035088 Bacteria 1779
402 Ga0373949_0043019 3300035090 Bacteria 1116
403 Ga0373951_0013500 3300035091 Bacteria 1836
404 Ga0373932_0003143 3300035112 Bacteria 4023
405 Ga0373932_0026642 3300035112 Bacteria 1574
406 Ga0373939_0007077 3300035114 Bacteria 2716
407 Ga0373939_0039678 3300035114 Bacteria 1410
408 Ga0373960_0032466 3300035121 Bacteria 1466
409 Ga0373931_0008836 3300035691 Bacteria 4795
410 Ga0395899_0005401 3300037312 Bacteria 9925
411 Ga0395900_0062032 3300037418 Bacteria 3843
412 Ga0395900_0333236 3300037418 Bacteria 1495
413 Ga0395898_0079077 3300037466 Bacteria 3172
414 Ga0395905_0139761 3300037471 Bacteria 2279
415 Ga0395901_0029677 3300038443 Bacteria 5631
416 Ga0439448_0009418 3300042005 Bacteria 2879
417 Ga0439455_0013689 3300042012 Bacteria 1842
418 Ga0439458_0002296 3300042157 Bacteria 4694
419 Ga0439435_0042049 3300042436 Bacteria 1282
420 Ga0439460_0058949 3300042461 Bacteria 1168
421 Ga0451577_0005206 3300042876 Bacteria 13385
422 Ga0451577_0010038 3300042876 Bacteria 9071
423 Ga0451577_0025265 3300042876 Bacteria 5391
424 Ga0451577_0035839 3300042876 Bacteria 4469
425 Ga0451577_0250202 3300042876 Bacteria 1604
426 Ga0453683_0003008 3300044673 Bacteria 12624
427 Ga0453683_0005950 3300044673 Bacteria 8409
428 Ga0453683_0013136 3300044673 Bacteria 5414
429 Ga0453683_0060352 3300044673 Bacteria 2371
430 Ga0453684_0032377 3300044712 Bacteria 7318
431 Ga0453684_0185691 3300044712 Bacteria 2437
432 Ga0453684_0435913 3300044712 Bacteria 1461
433 Ga0451576_0024239 3300045051 Bacteria 6555
434 Ga0451576_0026201 3300045051 Bacteria 6272
435 Ga0451576_0028871 3300045051 Bacteria 5941
436 Ga0451576_0036861 3300045051 Bacteria 5181
437 Ga0451576_0049195 3300045051 Bacteria 4424
438 Ga0451576_0263638 3300045051 Bacteria 1801
439 Ga0451576_0278038 3300045051 Bacteria 1750
440 Ga0451576_0599263 3300045051 Bacteria 1158
441 Ga0495580_0029596 3300046472 Bacteria 3973
442 Ga0495580_0224360 3300046472 Bacteria 1291
443 Ga0495584_0041628 3300046491 Bacteria 2319
444 Ga0495584_0213351 3300046491 Bacteria 981
445 Ga0495659_0061095 3300046664 Bacteria 1392
446 Ga0495669_0032522 3300046684 Bacteria 2293
447 Ga0495669_0185321 3300046684 Bacteria 992
448 Ga0496102_0001871 3300048905 Bacteria 18136
449 Ga0496108_0397804 3300048911 Bacteria 1203
450 Ga0496110_0210918 3300048913 Bacteria 1766
451 Ga0501031_0003020 3300049568 Bacteria 10764
452 Ga0501031_0090122 3300049568 Bacteria 2000
453 Ga0501033_0008980 3300049570 Bacteria 7718
454 Ga0501033_0082046 3300049570 Bacteria 2365
455 Ga0501033_0204541 3300049570 Bacteria 1409
456 Ga0501033_0231964 3300049570 Bacteria 1311
457 Ga0501036_0012481 3300049572 Bacteria 7043
458 Ga0501036_0025187 3300049572 Bacteria 5019
459 Ga0501036_0207057 3300049572 Bacteria 1649
460 Ga0501036_0306586 3300049572 Bacteria 1328
461 Ga0501037_0064932 3300049573 Bacteria 2659
462 Ga0501038_0000777 3300049574 Bacteria 28251
463 Ga0501038_0035789 3300049574 Bacteria 4358
464 Ga0501038_0110847 3300049574 Bacteria 2274
465 Ga0501038_0197507 3300049574 Bacteria 1616
466 Ga0501039_0001226 3300049575 Bacteria 18831
467 Ga0501039_0006761 3300049575 Bacteria 8728
468 Ga0501039_0147603 3300049575 Bacteria 1848
469 Ga0501039_0164062 3300049575 Bacteria 1747
470 Ga0501039_0168675 3300049575 Bacteria 1721
471 Ga0501040_0001715 3300049576 Bacteria 14046
472 Ga0501040_0006783 3300049576 Bacteria 7424
473 Ga0501040_0016619 3300049576 Bacteria 4876
474 Ga0501040_0019396 3300049576 Bacteria 4523
475 Ga0501040_0061962 3300049576 Bacteria 2573
476 Ga0501040_0067285 3300049576 Bacteria 2469
477 Ga0501040_0111631 3300049576 Bacteria 1912
478 Ga0501040_0113952 3300049576 Bacteria 1892
479 Ga0501040_0326956 3300049576 Bacteria 1097
480 Ga0501041_0000102 3300049577 Bacteria 35437
481 Ga0501041_0009513 3300049577 Bacteria 5729
482 Ga0501041_0031877 3300049577 Bacteria 3186
483 Ga0501041_0041434 3300049577 Bacteria 2797
484 Ga0501041_0047070 3300049577 Bacteria 2625
485 Ga0501041_0047877 3300049577 Bacteria 2603
486 Ga0501041_0075614 3300049577 Bacteria 2071
487 Ga0501041_0115390 3300049577 Bacteria 1667
488 Ga0501041_0170777 3300049577 Bacteria 1361
489 Ga0501042_0000777 3300049578 Bacteria 17428
490 Ga0501042_0007483 3300049578 Bacteria 7156
491 Ga0501042_0007739 3300049578 Bacteria 7058
492 Ga0501042_0030821 3300049578 Bacteria 3792
493 Ga0501042_0126960 3300049578 Bacteria 1837
494 Ga0501042_0160808 3300049578 Bacteria 1620
495 Ga0501042_0171228 3300049578 Bacteria 1566
496 Ga0501042_0178235 3300049578 Bacteria 1533
497 Ga0501042_0291500 3300049578 Bacteria 1179
498 Ga0501042_0427570 3300049578 Bacteria 960
499 Ga0501043_0029257 3300049579 Bacteria 4327
500 Ga0501043_0180607 3300049579 Bacteria 1644
501 Ga0501046_0000609 3300049580 Bacteria 35206
502 Ga0501046_0002061 3300049580 Bacteria 19077
503 Ga0501046_0074003 3300049580 Bacteria 2643
504 Ga0501047_0056714 3300049581 Bacteria 3789
505 Ga0501048_0009507 3300049582 Bacteria 7297
506 Ga0501048_0018520 3300049582 Bacteria 5118
507 Ga0501048_0021144 3300049582 Bacteria 4765
508 Ga0501048_0058521 3300049582 Bacteria 2731
509 Ga0501048_0076147 3300049582 Bacteria 2368
510 Ga0501048_0095448 3300049582 Bacteria 2097
511 Ga0501067_0048491 3300049583 Bacteria 2355
512 Ga0501068_0019384 3300049584 Bacteria 3950
513 Ga0501068_0030991 3300049584 Bacteria 3175
514 Ga0501068_0047035 3300049584 Bacteria 2602
515 Ga0501068_0064635 3300049584 Bacteria 2227
516 Ga0501068_0087739 3300049584 Bacteria 1916
517 Ga0501068_0167374 3300049584 Bacteria 1386
518 Ga0501069_0007927 3300049585 Bacteria 5578
519 Ga0501069_0089197 3300049585 Bacteria 1743
520 Ga0501070_0070558 3300049586 Bacteria 2893
521 Ga0501071_0000736 3300049587 Bacteria 17318
522 Ga0501071_0006665 3300049587 Bacteria 7504
523 Ga0501071_0124817 3300049587 Bacteria 1910
524 Ga0501071_0157789 3300049587 Bacteria 1695
525 Ga0501072_0002055 3300049588 Bacteria 14964
526 Ga0501072_0015809 3300049588 Bacteria 5786
527 Ga0501072_0025773 3300049588 Bacteria 4581
528 Ga0501072_0059434 3300049588 Bacteria 3014
529 Ga0501072_0116890 3300049588 Bacteria 2124
530 Ga0501072_0124331 3300049588 Bacteria 2055
531 Ga0501074_0005624 3300049590 Bacteria 9026
532 Ga0501074_0019321 3300049590 Bacteria 4950
533 Ga0501074_0021260 3300049590 Bacteria 4712
534 Ga0501074_0102039 3300049590 Bacteria 2054
535 Ga0501074_0182597 3300049590 Bacteria 1496
536 Ga0501075_0000122 3300049591 Bacteria 37780
537 Ga0501075_0000396 3300049591 Bacteria 25290
538 Ga0501075_0014948 3300049591 Bacteria 5567
539 Ga0501075_0026576 3300049591 Bacteria 4263
540 Ga0501075_0062305 3300049591 Bacteria 2811
541 Ga0501075_0076372 3300049591 Bacteria 2534
542 Ga0501075_0097421 3300049591 Bacteria 2232
543 Ga0501075_0121655 3300049591 Bacteria 1986
544 Ga0501075_0205952 3300049591 Bacteria 1500
545 Ga0501076_0000012 3300049592 Bacteria 113396
546 Ga0501076_0001680 3300049592 Bacteria 14960
547 Ga0501076_0002878 3300049592 Bacteria 11918
548 Ga0501076_0021226 3300049592 Bacteria 4980
549 Ga0501076_0024534 3300049592 Bacteria 4661
550 Ga0501076_0027487 3300049592 Bacteria 4411
551 Ga0501076_0065644 3300049592 Bacteria 2895
552 Ga0501076_0110518 3300049592 Bacteria 2222
553 Ga0501076_0130234 3300049592 Bacteria 2040
554 Ga0501076_0332088 3300049592 Bacteria 1247
555 Ga0501077_0000286 3300049593 Bacteria 30007
556 Ga0501077_0009924 3300049593 Bacteria 5926
557 Ga0501077_0009995 3300049593 Bacteria 5905
558 Ga0501077_0018034 3300049593 Bacteria 4461
559 Ga0501077_0045440 3300049593 Bacteria 2790
560 Ga0501077_0046484 3300049593 Bacteria 2757
561 Ga0501077_0063696 3300049593 Bacteria 2339
562 Ga0501077_0092273 3300049593 Bacteria 1919
563 Ga0501077_0118791 3300049593 Bacteria 1675
564 Ga0501077_0121342 3300049593 Bacteria 1657
565 Ga0501079_0000134 3300049741 Bacteria 40016
566 Ga0501079_0001185 3300049741 Bacteria 18261
567 Ga0501079_0008164 3300049741 Bacteria 7935
568 Ga0501079_0011862 3300049741 Bacteria 6649
569 Ga0501079_0017090 3300049741 Bacteria 5540
570 Ga0501079_0018925 3300049741 Bacteria 5262
571 Ga0501079_0041859 3300049741 Bacteria 3537
572 Ga0501079_0059765 3300049741 Bacteria 2940
573 Ga0501079_0115618 3300049741 Bacteria 2085
574 Ga0501079_0333676 3300049741 Bacteria 1188
575 Ga0501080_0000292 3300049742 Bacteria 38028
576 Ga0501080_0059941 3300049742 Bacteria 3542
577 Ga0501080_0113479 3300049742 Bacteria 2512
578 Ga0501080_0122207 3300049742 Bacteria 2412
579 Ga0501080_0138368 3300049742 Bacteria 2252
580 Ga0501080_0312189 3300049742 Bacteria 1425
581 Ga0501081_0001033 3300049743 Bacteria 16654
582 Ga0501081_0001499 3300049743 Bacteria 14316
583 Ga0501081_0003182 3300049743 Bacteria 10436
584 Ga0501081_0006424 3300049743 Bacteria 7628
585 Ga0501081_0008697 3300049743 Bacteria 6598
586 Ga0501081_0010620 3300049743 Bacteria 6013
587 Ga0501081_0016788 3300049743 Bacteria 4840
588 Ga0501081_0021956 3300049743 Bacteria 4265
589 Ga0501081_0036313 3300049743 Bacteria 3360
590 Ga0501081_0049117 3300049743 Bacteria 2904
591 Ga0501081_0112229 3300049743 Bacteria 1935
592 Ga0501081_0197000 3300049743 Bacteria 1460
593 Ga0501081_0422390 3300049743 Bacteria 988
594 Ga0501083_0031778 3300049744 Bacteria 3623
595 Ga0501083_0103576 3300049744 Bacteria 1875
596 Ga0501083_0113204 3300049744 Bacteria 1783
597 Ga0501035_0006607 3300049822 Bacteria 10855
598 Ga0501035_0048808 3300049822 Bacteria 3795
599 Ga0501035_0415821 3300049822 Bacteria 1117
600 Ga0501035_0451103 3300049822 Bacteria 1064
601 Ga0501045_0002290 3300049824 Bacteria 12977
602 Ga0501045_0024468 3300049824 Bacteria 4336
603 Ga0501045_0062629 3300049824 Bacteria 2730
604 Ga0501045_0073786 3300049824 Bacteria 2513
605 nmdc:mga05p37_141781_c1 3300050507 Bacteria 2944
606 nmdc:mga05p37_14582_c1 3300050507 Bacteria 9438
607 nmdc:mga05p37_196355_c1 3300050507 Bacteria 2447
608 nmdc:mga05p37_21565_c1 3300050507 Bacteria 7806
609 nmdc:mga05p37_23238_c1 3300050507 Bacteria 7520
610 nmdc:mga05p37_238148_c1 3300050507 Bacteria 2190
611 nmdc:mga05p37_28205_c1 3300050507 Bacteria 6844
612 nmdc:mga05p37_300449_c1 3300050507 Bacteria 1908
613 nmdc:mga05p37_331825_c1 3300050507 Bacteria 1796
614 nmdc:mga05p37_35596_c1 3300050507 Bacteria 6106
615 nmdc:mga05p37_4063_c1 3300050507 Bacteria 17103
616 nmdc:mga05p37_407123_c1 3300050507 Unclassified 1587
617 nmdc:mga05p37_49894_c1 3300050507 Bacteria 5148
618 nmdc:mga05p37_743528_c1 3300050507 Bacteria 1082
619 nmdc:mga05p37_85453_c1 3300050507 Bacteria 3888
620 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
621 nmdc:mga09592_1406_c1 3300050508 Bacteria 19268
622 nmdc:mga09592_144514_c1 3300050508 Bacteria 2051
623 nmdc:mga09592_21339_c1 3300050508 Bacteria 5338
624 nmdc:mga09592_310142_c1 3300050508 Bacteria 1367
625 nmdc:mga09592_6345_c1 3300050508 Bacteria 9637
626 nmdc:mga09592_837_c1 3300050508 Bacteria 23885
627 nmdc:mga0qj67_167798_c1 3300050509 Bacteria 1782
628 nmdc:mga0qj67_22992_c1 3300050509 Bacteria 4790
629 nmdc:mga0qj67_272243_c1 3300050509 Bacteria 1373
630 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
631 nmdc:mga0qj67_43339_c1 3300050509 Bacteria 3544
632 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
633 nmdc:mga06r32_10348_c1 3300050510 Bacteria 8414
634 nmdc:mga06r32_14068_c1 3300050510 Bacteria 7257
635 nmdc:mga06r32_176697_c1 3300050510 Bacteria 2120
636 nmdc:mga06r32_204473_c1 3300050510 Bacteria 1962
637 nmdc:mga06r32_32294_c1 3300050510 Bacteria 4924
638 nmdc:mga06r32_460165_c1 3300050510 Bacteria 1251
639 nmdc:mga06r32_4631_c1 3300050510 Bacteria 12337
640 nmdc:mga06r32_469340_c1 3300050510 Bacteria 1237
641 nmdc:mga06r32_790916_c1 3300050510 Bacteria 910
642 nmdc:mga06r32_87705_c1 3300050510 Bacteria 3037
643 nmdc:mga08y16_1016574_c1 3300050511 Bacteria 808
644 nmdc:mga08y16_108945_c1 3300050511 Bacteria 2884
645 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
646 nmdc:mga08y16_158513_c1 3300050511 Bacteria 2352
647 nmdc:mga08y16_163309_c1 3300050511 Bacteria 2314
648 nmdc:mga08y16_2945_c1 3300050511 Bacteria 17531
649 nmdc:mga08y16_420122_c1 3300050511 Bacteria 1366
650 nmdc:mga08y16_90439_c1 3300050511 Bacteria 3191
651 nmdc:mga0n895_176870_c1 3300050512 Bacteria 2165
652 nmdc:mga0n895_203_c1 3300050512 Bacteria 21253
653 nmdc:mga0n895_271662_c1 3300050512 Bacteria 1720
654 nmdc:mga0n895_35010_c1 3300050512 Bacteria 4838
655 nmdc:mga0n895_357894_c1 3300050512 Bacteria 1478
656 nmdc:mga0n895_41940_c1 3300050512 Bacteria 4451
657 nmdc:mga0n895_43098_c1 3300050512 Bacteria 4396
658 nmdc:mga0n895_61867_c1 3300050512 Bacteria 3698
659 nmdc:mga0n895_657044_c1 3300050512 Unclassified 1047
660 nmdc:mga0n895_883841_c1 3300050512 Bacteria 880
661 nmdc:mga0n895_88977_c1 3300050512 Bacteria 3088
662 nmdc:mga0rr50_694_c1 3300050513 Bacteria 18015
663 nmdc:mga0rr50_88479_c1 3300050513 Bacteria 2406
664 nmdc:mga08x19_153171_c1 3300050514 Bacteria 1562
665 nmdc:mga08x19_29864_c1 3300050514 Bacteria 3421
666 nmdc:mga08x19_397209_c1 3300050514 Bacteria 967
667 nmdc:mga08x19_4220_c1 3300050514 Bacteria 8518
668 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
669 nmdc:mga08x19_7471_c1 3300050514 Bacteria 6491
670 nmdc:mga0a205_12060_c1 3300050515 Bacteria 7985
671 nmdc:mga0a205_123700_c1 3300050515 Bacteria 2487
672 nmdc:mga0a205_15170_c1 3300050515 Bacteria 7197
673 nmdc:mga0a205_156982_c1 3300050515 Bacteria 2173
674 nmdc:mga0a205_205119_c1 3300050515 Bacteria 1861
675 nmdc:mga0a205_22996_c1 3300050515 Bacteria 5910
676 nmdc:mga0a205_23223_c1 3300050515 Bacteria 2949
677 nmdc:mga0a205_24042_c1 3300050515 Bacteria 5786
678 nmdc:mga0a205_420270_c1 3300050515 Bacteria 1199
679 nmdc:mga0a205_5896_c1 3300050515 Bacteria 11035
680 nmdc:mga0a205_66914_c2 3300050515 Bacteria 2986
681 nmdc:mga0a205_76617_c1 3300050515 Bacteria 3232
682 Ga0501084_0000300 3300054114 Bacteria 37454
683 Ga0501084_0001169 3300054114 Bacteria 20453
684 Ga0501084_0001730 3300054114 Bacteria 17322
685 Ga0501084_0015809 3300054114 Bacteria 6259
686 Ga0501084_0024553 3300054114 Bacteria 5029
687 Ga0501084_0036762 3300054114 Bacteria 4092
688 Ga0501084_0053423 3300054114 Bacteria 3380
689 Ga0501084_0055736 3300054114 Bacteria 3307
690 Ga0501084_0097754 3300054114 Bacteria 2465
691 Ga0501084_0199873 3300054114 Bacteria 1686
692 Ga0501084_0312606 3300054114 Bacteria 1327
693 Ga0501084_0319994 3300054114 Bacteria 1310
694 Ga0590071_010281 3300059421 Bacteria 2193
695 Ga0590075_007138 3300059424 Bacteria 2650
696 Ga0501082_0002631 3300060353 Bacteria 15690
697 Ga0501082_0009410 3300060353 Bacteria 8414
698 Ga0501082_0016940 3300060353 Bacteria 6274
699 Ga0501082_0026089 3300060353 Bacteria 5037
700 Ga0501082_0056973 3300060353 Bacteria 3367
701 Ga0501082_0064057 3300060353 Bacteria 3166
702 Ga0501082_0282495 3300060353 Bacteria 1445
703 Ga0501082_0351825 3300060353 Bacteria 1284
704 Ga0530510_0000015 3300061734 Bacteria 104554
705 Ga0530510_0001748 3300061734 Bacteria 14807
706 Ga0530510_0015625 3300061734 Bacteria 5364
707 Ga0530510_0046999 3300061734 Bacteria 3118
708 Ga0530510_0063379 3300061734 Bacteria 2676
709 Ga0530510_0136055 3300061734 Bacteria 1809
710 Ga0530510_0179918 3300061734 Bacteria 1568
711 Ga0530510_0188761 3300061734 Bacteria 1529
712 Ga0530510_0221293 3300061734 Bacteria 1407
713 Ga0530510_0236658 3300061734 Bacteria 1359
714 Ga0530510_0283842 3300061734 Bacteria 1237
715 Ga0075434_100459999
716 JGI25406J46586_10017390
717 JGI26129J50193_1000967
718 Ga0065712_10178808
719 Ga0065707_10134579
720 Ga0070676_10001402
721 Ga0070683_100234008
722 Ga0070670_100001558
723 Ga0068869_100000795
724 Ga0068869_100046889
725 Ga0068869_100114011
726 Ga0068869_100546733
727 Ga0070680_100002409
728 Ga0070680_100049260
729 Ga0070680_100135883
730 Ga0070682_100000179
731 Ga0068868_100043820
732 Ga0068868_100256546
733 Ga0070660_100000476
734 Ga0070689_100073029
735 Ga0070691_10002169
736 Ga0070691_10111549
737 Ga0070661_100000876
738 Ga0070692_10000828
739 Ga0070692_10001115
740 Ga0070692_10046023
741 Ga0070692_10250019
742 Ga0070669_100017830
743 Ga0070669_100414852
744 Ga0070673_100447972
745 Ga0070688_100064606
746 Ga0070659_100153974
747 Ga0070701_10069613
748 Ga0070705_100000333
749 Ga0070705_100035395
750 Ga0070705_100078316
751 Ga0070705_100101787
752 Ga0070705_100122966
753 Ga0070705_100140294
754 Ga0070700_100026807
755 Ga0070700_100212381
756 Ga0070700_100477935
757 Ga0070694_100022054
758 Ga0070694_100075232
759 Ga0070694_100182553
760 Ga0070694_100248203
761 Ga0070708_100006589
762 Ga0070708_100016216
763 Ga0070708_100055617
764 Ga0070708_100075366
765 Ga0070708_100159392
766 Ga0070708_100186897
767 Ga0070663_100226349
768 Ga0070663_100480325
769 Ga0070662_100027815
770 Ga0070681_10004124
771 Ga0068867_100000455
772 Ga0068867_100194989
773 Ga0068867_100547178
774 Ga0070706_100047684
775 Ga0070706_100062204
776 Ga0070706_100077558
777 Ga0070706_100116134
778 Ga0070706_100117317
779 Ga0070706_100224884
780 Ga0070706_100603264
781 Ga0070707_100000108
782 Ga0070707_100017934
783 Ga0070707_100103935
784 Ga0070707_100113897
785 Ga0070707_100261817
786 Ga0070707_100593067
787 Ga0070707_100603131
788 Ga0070698_100000691
789 Ga0070698_100011480
790 Ga0070698_100014980
791 Ga0070698_100094612
792 Ga0070698_100161752
793 Ga0070698_100258778
794 Ga0070699_100003274
795 Ga0070699_100013457
796 Ga0070699_100013570
797 Ga0070699_100015560
798 Ga0070699_100020088
799 Ga0070699_100061434
800 Ga0070699_100081230
801 Ga0070699_100224249
802 Ga0070699_100230631
803 Ga0070699_100279410
804 Ga0070699_100302754
805 Ga0070679_100007477
806 Ga0070679_100203873
807 Ga0070684_100164633
808 Ga0070697_100023932
809 Ga0070697_100065632
810 Ga0070697_100093448
811 Ga0070697_100124263
812 Ga0070697_100285780
813 Ga0070697_100349732
814 Ga0070697_100449415
815 Ga0068853_100191463
816 Ga0070672_100287910
817 Ga0070695_100003891
818 Ga0070695_100061321
819 Ga0070695_100082910
820 Ga0070695_100276227
821 Ga0070696_100036054
822 Ga0070696_100108775
823 Ga0070696_100272373
824 Ga0070693_100009781
825 Ga0070693_100338664
826 Ga0070704_100015876
827 Ga0070704_100046308
828 Ga0070704_100047238
829 Ga0070704_100103095
830 Ga0068855_100000225
831 Ga0070664_100017355
832 Ga0068857_100237393
833 Ga0068854_100013613
834 Ga0068854_100484107
835 Ga0068854_100511278
836 Ga0068854_100626729
837 Ga0068856_100001169
838 Ga0068852_100142485
839 Ga0068859_100001393
840 Ga0068859_100089345
841 Ga0068864_100285188
842 Ga0068866_10060874
843 Ga0068866_10267607
844 Ga0068861_100018775
845 Ga0068870_10000139
846 Ga0068863_100032824
847 Ga0068863_100079836
848 Ga0068858_100189302
849 Ga0068860_100001109
850 Ga0068860_100315180
851 Ga0068862_100003750
852 Ga0068862_100080533
853 Ga0068862_100087038
854 Ga0068862_100143465
855 Ga0068862_100546214
856 Ga0081455_10001810
857 Ga0081538_10015371
858 Ga0081540_1005034
859 Ga0081539_10000005
860 Ga0075432_10024663
861 Ga0070715_10016204
862 Ga0070716_100085712
863 Ga0070712_100006589
864 Ga0075367_10339685
865 Ga0068871_100259299
866 Ga0075428_100000924
867 Ga0075428_100001380
868 Ga0075428_100023900
869 Ga0075428_100030517
870 Ga0075428_100054921
871 Ga0075428_100182861
872 Ga0075428_100197674
873 Ga0075428_100224837
874 Ga0075428_100624849
875 Ga0075430_100000019
876 Ga0075430_100000487
877 Ga0075430_100016723
878 Ga0075430_100046733
879 Ga0075430_100061652
880 Ga0075430_100147154
881 Ga0075430_100212495
882 Ga0075431_100000797
883 Ga0075431_100002180
884 Ga0075431_100002229
885 Ga0075431_100008469
886 Ga0075431_100011273
887 Ga0075431_100023868
888 Ga0075431_100072397
889 Ga0075431_100168828
890 Ga0075431_100340726
891 Ga0075431_100503852
892 Ga0075433_10006420
893 Ga0075433_10032400
894 Ga0075433_10056759
895 Ga0075433_10062927
896 Ga0075433_10082435
897 Ga0075433_10166688
898 Ga0075433_10281102
899 Ga0075434_100022146
900 Ga0075434_100031633
901 Ga0075434_100033398
902 Ga0075434_100087316
903 Ga0075434_100156094
904 Ga0075434_100163988
905 Ga0075434_100167389
906 Ga0075434_100223242
907 Ga0075434_100232081
908 Ga0075429_100000859
909 Ga0075429_100010038
910 Ga0075429_100011531
911 Ga0075429_100021240
912 Ga0075429_100027920
913 Ga0075429_100030148
914 Ga0075429_100144176
915 Ga0075429_100424371
916 Ga0075429_100611439
917 Ga0068865_100124729
918 Ga0075436_100001157
919 Ga0075436_100015235
920 Ga0075436_100041000
921 Ga0075436_100146490
922 Ga0075436_100414469
923 Ga0097620_100001393
924 Ga0097620_100089342
925 Ga0075435_100000661
926 Ga0075435_100015296
927 Ga0075435_100057817
928 Ga0075435_100485406
929 Ga0099794_10007170
930 Ga0099794_10016643
931 Ga0099794_10033382
932 Ga0099794_10119145
933 Ga0111539_10000535
934 Ga0111539_10018495
935 Ga0111539_10082769
936 Ga0111539_10114639
937 Ga0111539_10192811
938 Ga0111539_10249379
939 Ga0111539_10481786
940 Ga0114129_10000115
941 Ga0114129_10000606
942 Ga0114129_10001631
943 Ga0114129_10008441
944 Ga0114129_10009875
945 Ga0114129_10012726
946 Ga0114129_10036324
947 Ga0114129_10079508
948 Ga0114129_10102712
949 Ga0114129_10102978
950 Ga0114129_10114996
951 Ga0114129_10119347
952 Ga0114129_10225093
953 Ga0114129_10273784
954 Ga0114129_10529845
955 Ga0114129_10563662
956 Ga0114129_10734822
957 Ga0114129_10738955
958 Ga0114129_10753981
959 Ga0114129_10919193
960 Ga0105243_10007774
961 Ga0105243_10275853
962 Ga0105241_10001038
963 Ga0105241_10133370
964 Ga0105241_10212150
965 Ga0105242_10016052
966 Ga0105248_10472423
967 Ga0105249_10082436
968 Ga0105249_10227328
969 Ga0105249_10779791
970 Ga0105239_10016176
971 Ga0105239_10383916
972 Ga0105246_10170521
973 Ga0157373_10000388
974 Ga0157371_10107766
975 Ga0157369_10232425
976 Ga0157378_10339128
977 Ga0163162_10015647
978 Ga0163162_10017085
979 Ga0163162_10316041
980 Ga0163162_10361522
981 Ga0163162_11141169
982 Ga0157372_10000105
983 Ga0157372_10072881
984 Ga0157380_10135536
985 Ga0157379_10190827
986 Ga0157379_10414095
987 Ga0182007_10037705
988 Ga0207653_10019880
989 Ga0207653_10038407
990 Ga0207642_10233978
991 Ga0207688_10012816
992 Ga0207645_10005499
993 Ga0207643_10001465
994 Ga0207684_10000115
995 Ga0207684_10019692
996 Ga0207684_10073541
997 Ga0207684_10132276
998 Ga0207684_10148413
999 Ga0207684_10359491
1000 Ga0207654_10004154
1001 Ga0207654_10082136
1002 Ga0207707_10000352
1003 Ga0207671_10168526
1004 Ga0207693_10025215
1005 Ga0207663_10207634
1006 Ga0207660_10000334
1007 Ga0207660_10570966
1008 Ga0207657_10002597
1009 Ga0207649_10006035
1010 Ga0207652_10000466
1011 Ga0207646_10000250
1012 Ga0207646_10003851
1013 Ga0207646_10008025
1014 Ga0207646_10028619
1015 Ga0207646_10084314
1016 Ga0207646_10108278
1017 Ga0207646_10196959
1018 Ga0207646_10283279
1019 Ga0207646_10590039
1020 Ga0207681_10013659
1021 Ga0207681_10166559
1022 Ga0207681_10420961
1023 Ga0207694_10201692
1024 Ga0207650_10025156
1025 Ga0207659_10148540
1026 Ga0207690_10041224
1027 Ga0207706_10024583
1028 Ga0207706_10080188
1029 Ga0207706_10131427
1030 Ga0207706_10468686
1031 Ga0207709_10003271
1032 Ga0207709_10071982
1033 Ga0207670_10088095
1034 Ga0207670_10320547
1035 Ga0207704_10160750
1036 Ga0207665_10114297
1037 Ga0207665_10165423
1038 Ga0207691_10203962
1039 Ga0207711_10418118
1040 Ga0207689_10003685
1041 Ga0207689_10074531
1042 Ga0207661_10148620
1043 Ga0207679_10000878
1044 Ga0207667_10000497
1045 Ga0207712_10347335
1046 Ga0207712_10547631
1047 Ga0207640_10088641
1048 Ga0207640_10100394
1049 Ga0207640_10476418
1050 Ga0207658_10165220
1051 Ga0207677_10228346
1052 Ga0207677_10422300
1053 Ga0207703_10019303
1054 Ga0207703_10318461
1055 Ga0207639_10002384
1056 Ga0207678_10013961
1057 Ga0207678_10253752
1058 Ga0207708_10135745
1059 Ga0207708_10248471
1060 Ga0207708_10396790
1061 Ga0207708_10456647
1062 Ga0207708_10570979
1063 Ga0207702_10008955
1064 Ga0207641_10071148
1065 Ga0207641_10082607
1066 Ga0207648_10015946
1067 Ga0207648_10153126
1068 Ga0207648_10202775
1069 Ga0207648_10295593
1070 Ga0207648_10752173
1071 Ga0207674_10000550
1072 Ga0207675_100002639
1073 Ga0207675_100005709
1074 Ga0207675_100132891
1075 Ga0207698_10116523
1076 Ga0209981_1000490
1077 Ga0209996_1000338
1078 Ga0210000_1017209
1079 Ga0209995_1002164
1080 Ga0209968_1000579
1081 Ga0209999_1000243
1082 Ga0209982_1001041
1083 Ga0210002_1017292
1084 Ga0209983_1000034
1085 Ga0209588_1017370
1086 Ga0209971_1000028
1087 Ga0209971_1005708
1088 Ga0209966_1000073
1089 Ga0209966_1009155
1090 Ga0209998_10000001
1091 Ga0209974_10000369
1092 Ga0209974_10066276
1093 Ga0207428_10000176
1094 Ga0207428_10000394
1095 Ga0207428_10123151
1096 Ga0207428_10141454
1097 Ga0268265_10002923
1098 Ga0268265_10024098
1099 Ga0268265_10088185
1100 Ga0268265_10268221
1101 Ga0268264_10031393
1102 Ga0268264_10155527
1103 Ga0268264_10216801
1104 Ga0307408_100034524
1105 Ga0307408_100048113
1106 Ga0307408_100145291
1107 Ga0307408_100353624
1108 Ga0307405_10240301
1109 Ga0307410_10059238
1110 Ga0307410_10193742
1111 Ga0307416_100599922
1112 Ga0307411_10063789
1113 Ga0307411_10334865
1114 Ga0373959_0013857
1115 Ga0373940_0017681
1116 Ga0373949_0043019
1117 Ga0373951_0013500
1118 Ga0373932_0003143
1119 Ga0373932_0026642
1120 Ga0373939_0007077
1121 Ga0373939_0039678
1122 Ga0373960_0032466
1123 Ga0373931_0008836
1124 Ga0395899_0005401
1125 Ga0395900_0062032
1126 Ga0395900_0333236
1127 Ga0395898_0079077
1128 Ga0395905_0139761
1129 Ga0395901_0029677
1130 Ga0439448_0009418
1131 Ga0439455_0013689
1132 Ga0439458_0002296
1133 Ga0439435_0042049
1134 Ga0439460_0058949
1135 Ga0451577_0005206
1136 Ga0451577_0010038
1137 Ga0451577_0025265
1138 Ga0451577_0035839
1139 Ga0451577_0250202
1140 Ga0453683_0003008
1141 Ga0453683_0005950
1142 Ga0453683_0013136
1143 Ga0453683_0060352
1144 Ga0453684_0032377
1145 Ga0453684_0185691
1146 Ga0453684_0435913
1147 Ga0451576_0024239
1148 Ga0451576_0026201
1149 Ga0451576_0028871
1150 Ga0451576_0036861
1151 Ga0451576_0049195
1152 Ga0451576_0263638
1153 Ga0451576_0278038
1154 Ga0451576_0599263
1155 Ga0495580_0029596
1156 Ga0495580_0224360
1157 Ga0495584_0041628
1158 Ga0495584_0213351
1159 Ga0495659_0061095
1160 Ga0495669_0032522
1161 Ga0495669_0185321
1162 Ga0496102_0001871
1163 Ga0496108_0397804
1164 Ga0496110_0210918
1165 Ga0501031_0003020
1166 Ga0501031_0090122
1167 Ga0501033_0008980
1168 Ga0501033_0082046
1169 Ga0501033_0204541
1170 Ga0501033_0231964
1171 Ga0501036_0012481
1172 Ga0501036_0025187
1173 Ga0501036_0207057
1174 Ga0501036_0306586
1175 Ga0501037_0064932
1176 Ga0501038_0000777
1177 Ga0501038_0035789
1178 Ga0501038_0110847
1179 Ga0501038_0197507
1180 Ga0501039_0001226
1181 Ga0501039_0006761
1182 Ga0501039_0147603
1183 Ga0501039_0164062
1184 Ga0501039_0168675
1185 Ga0501040_0001715
1186 Ga0501040_0006783
1187 Ga0501040_0016619
1188 Ga0501040_0019396
1189 Ga0501040_0061962
1190 Ga0501040_0067285
1191 Ga0501040_0111631
1192 Ga0501040_0113952
1193 Ga0501040_0326956
1194 Ga0501041_0000102
1195 Ga0501041_0009513
1196 Ga0501041_0031877
1197 Ga0501041_0041434
1198 Ga0501041_0047070
1199 Ga0501041_0047877
1200 Ga0501041_0075614
1201 Ga0501041_0115390
1202 Ga0501041_0170777
1203 Ga0501042_0000777
1204 Ga0501042_0007483
1205 Ga0501042_0007739
1206 Ga0501042_0030821
1207 Ga0501042_0126960
1208 Ga0501042_0160808
1209 Ga0501042_0171228
1210 Ga0501042_0178235
1211 Ga0501042_0291500
1212 Ga0501042_0427570
1213 Ga0501043_0029257
1214 Ga0501043_0180607
1215 Ga0501046_0000609
1216 Ga0501046_0002061
1217 Ga0501046_0074003
1218 Ga0501047_0056714
1219 Ga0501048_0009507
1220 Ga0501048_0018520
1221 Ga0501048_0021144
1222 Ga0501048_0058521
1223 Ga0501048_0076147
1224 Ga0501048_0095448
1225 Ga0501067_0048491
1226 Ga0501068_0019384
1227 Ga0501068_0030991
1228 Ga0501068_0047035
1229 Ga0501068_0064635
1230 Ga0501068_0087739
1231 Ga0501068_0167374
1232 Ga0501069_0007927
1233 Ga0501069_0089197
1234 Ga0501070_0070558
1235 Ga0501071_0000736
1236 Ga0501071_0006665
1237 Ga0501071_0124817
1238 Ga0501071_0157789
1239 Ga0501072_0002055
1240 Ga0501072_0015809
1241 Ga0501072_0025773
1242 Ga0501072_0059434
1243 Ga0501072_0116890
1244 Ga0501072_0124331
1245 Ga0501074_0005624
1246 Ga0501074_0019321
1247 Ga0501074_0021260
1248 Ga0501074_0102039
1249 Ga0501074_0182597
1250 Ga0501075_0000122
1251 Ga0501075_0000396
1252 Ga0501075_0014948
1253 Ga0501075_0026576
1254 Ga0501075_0062305
1255 Ga0501075_0076372
1256 Ga0501075_0097421
1257 Ga0501075_0121655
1258 Ga0501075_0205952
1259 Ga0501076_0000012
1260 Ga0501076_0001680
1261 Ga0501076_0002878
1262 Ga0501076_0021226
1263 Ga0501076_0024534
1264 Ga0501076_0027487
1265 Ga0501076_0065644
1266 Ga0501076_0110518
1267 Ga0501076_0130234
1268 Ga0501076_0332088
1269 Ga0501077_0000286
1270 Ga0501077_0009924
1271 Ga0501077_0009995
1272 Ga0501077_0018034
1273 Ga0501077_0045440
1274 Ga0501077_0046484
1275 Ga0501077_0063696
1276 Ga0501077_0092273
1277 Ga0501077_0118791
1278 Ga0501077_0121342
1279 Ga0501079_0000134
1280 Ga0501079_0001185
1281 Ga0501079_0008164
1282 Ga0501079_0011862
1283 Ga0501079_0017090
1284 Ga0501079_0018925
1285 Ga0501079_0041859
1286 Ga0501079_0059765
1287 Ga0501079_0115618
1288 Ga0501079_0333676
1289 Ga0501080_0000292
1290 Ga0501080_0059941
1291 Ga0501080_0113479
1292 Ga0501080_0122207
1293 Ga0501080_0138368
1294 Ga0501080_0312189
1295 Ga0501081_0001033
1296 Ga0501081_0001499
1297 Ga0501081_0003182
1298 Ga0501081_0006424
1299 Ga0501081_0008697
1300 Ga0501081_0010620
1301 Ga0501081_0016788
1302 Ga0501081_0021956
1303 Ga0501081_0036313
1304 Ga0501081_0049117
1305 Ga0501081_0112229
1306 Ga0501081_0197000
1307 Ga0501081_0422390
1308 Ga0501083_0031778
1309 Ga0501083_0103576
1310 Ga0501083_0113204
1311 Ga0501035_0006607
1312 Ga0501035_0048808
1313 Ga0501035_0415821
1314 Ga0501035_0451103
1315 Ga0501045_0002290
1316 Ga0501045_0024468
1317 Ga0501045_0062629
1318 Ga0501045_0073786
1319 nmdc:mga05p37_141781_c1
1320 nmdc:mga05p37_14582_c1
1321 nmdc:mga05p37_196355_c1
1322 nmdc:mga05p37_21565_c1
1323 nmdc:mga05p37_23238_c1
1324 nmdc:mga05p37_238148_c1
1325 nmdc:mga05p37_28205_c1
1326 nmdc:mga05p37_300449_c1
1327 nmdc:mga05p37_331825_c1
1328 nmdc:mga05p37_35596_c1
1329 nmdc:mga05p37_4063_c1
1330 nmdc:mga05p37_407123_c1
1331 nmdc:mga05p37_49894_c1
1332 nmdc:mga05p37_743528_c1
1333 nmdc:mga05p37_85453_c1
1334 nmdc:mga05p37_89_c1
1335 nmdc:mga09592_1406_c1
1336 nmdc:mga09592_144514_c1
1337 nmdc:mga09592_21339_c1
1338 nmdc:mga09592_310142_c1
1339 nmdc:mga09592_6345_c1
1340 nmdc:mga09592_837_c1
1341 nmdc:mga0qj67_167798_c1
1342 nmdc:mga0qj67_22992_c1
1343 nmdc:mga0qj67_272243_c1
1344 nmdc:mga0qj67_343_c1
1345 nmdc:mga0qj67_43339_c1
1346 nmdc:mga0qj67_798_c1
1347 nmdc:mga06r32_10348_c1
1348 nmdc:mga06r32_14068_c1
1349 nmdc:mga06r32_176697_c1
1350 nmdc:mga06r32_204473_c1
1351 nmdc:mga06r32_32294_c1
1352 nmdc:mga06r32_460165_c1
1353 nmdc:mga06r32_4631_c1
1354 nmdc:mga06r32_469340_c1
1355 nmdc:mga06r32_790916_c1
1356 nmdc:mga06r32_87705_c1
1357 nmdc:mga08y16_1016574_c1
1358 nmdc:mga08y16_108945_c1
1359 nmdc:mga08y16_1417_c1
1360 nmdc:mga08y16_158513_c1
1361 nmdc:mga08y16_163309_c1
1362 nmdc:mga08y16_2945_c1
1363 nmdc:mga08y16_420122_c1
1364 nmdc:mga08y16_90439_c1
1365 nmdc:mga0n895_176870_c1
1366 nmdc:mga0n895_203_c1
1367 nmdc:mga0n895_271662_c1
1368 nmdc:mga0n895_35010_c1
1369 nmdc:mga0n895_357894_c1
1370 nmdc:mga0n895_41940_c1
1371 nmdc:mga0n895_43098_c1
1372 nmdc:mga0n895_61867_c1
1373 nmdc:mga0n895_657044_c1
1374 nmdc:mga0n895_883841_c1
1375 nmdc:mga0n895_88977_c1
1376 nmdc:mga0rr50_694_c1
1377 nmdc:mga0rr50_88479_c1
1378 nmdc:mga08x19_153171_c1
1379 nmdc:mga08x19_29864_c1
1380 nmdc:mga08x19_397209_c1
1381 nmdc:mga08x19_4220_c1
1382 nmdc:mga08x19_470_c1
1383 nmdc:mga08x19_7471_c1
1384 nmdc:mga0a205_12060_c1
1385 nmdc:mga0a205_123700_c1
1386 nmdc:mga0a205_15170_c1
1387 nmdc:mga0a205_156982_c1
1388 nmdc:mga0a205_205119_c1
1389 nmdc:mga0a205_22996_c1
1390 nmdc:mga0a205_23223_c1
1391 nmdc:mga0a205_24042_c1
1392 nmdc:mga0a205_420270_c1
1393 nmdc:mga0a205_5896_c1
1394 nmdc:mga0a205_66914_c2
1395 nmdc:mga0a205_76617_c1
1396 Ga0501084_0000300
1397 Ga0501084_0001169
1398 Ga0501084_0001730
1399 Ga0501084_0015809
1400 Ga0501084_0024553
1401 Ga0501084_0036762
1402 Ga0501084_0053423
1403 Ga0501084_0055736
1404 Ga0501084_0097754
1405 Ga0501084_0199873
1406 Ga0501084_0312606
1407 Ga0501084_0319994
1408 Ga0590071_010281
1409 Ga0590075_007138
1410 Ga0501082_0002631
1411 Ga0501082_0009410
1412 Ga0501082_0016940
1413 Ga0501082_0026089
1414 Ga0501082_0056973
1415 Ga0501082_0064057
1416 Ga0501082_0282495
1417 Ga0501082_0351825
1418 Ga0530510_0000015
1419 Ga0530510_0001748
1420 Ga0530510_0015625
1421 Ga0530510_0046999
1422 Ga0530510_0063379
1423 Ga0530510_0136055
1424 Ga0530510_0179918
1425 Ga0530510_0188761
1426 Ga0530510_0221293
1427 Ga0530510_0236658
1428 Ga0530510_0283842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7958 17 269
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7471 17 269
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.486 80 262
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.4842 92 263
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.4716 80 262
ID Description Score Start End Superfamily
af_Q4DSB3_1_115_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.583 97 255 1.20.58.400
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5353 94 261 1.20.120.1770
af_Q4DSB3_1_115_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.5099 97 255 1.20.58.400
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5051 92 262 1.20.950.20
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5027 94 261 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.968 180 269
AF-A0A6B1FLJ0-F1-model_v4 deleted 0.9576 180 269
AF-A0A2V7RLD6-F1-model_v4 Succinate dehydrogenase 0.9508 152 269 GO:0016020
AF-A0A292Z6H2-F1-model_v4 Putative succinate dehydrogenase 0.9368 161 269 GO:0016020
AF-A0A2V6H4D2-F1-model_v4 Succinate dehydrogenase 0.9366 168 269 GO:0016020

Map