F476890

General Info

Members Datasets Scaffolds Average Seq Length
713 348 603 405

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10021668|Ga0207639_100216682
Length 472
Sequence MAAGGCCNNERLGALRASQCPFGERFLAMNGMNLDTARTDAGGAGSIAGASQAEPTALRPPKPTRFGVIGAVSFVHLLNDMMQSVIVTIYPLLKHEFALSFVQIGVITLTFQLTASLLQPVVGAVTDKHPLPYSLPIGMCFTLAGLLLLSVAPSYPILLLSVALIGCGSSVFHPESSRVARMASGGRYGLAQSLFQIGGNTGQALGPLLAAVIVLKMGRPEAAWFSLAALLAIXVLLQVSRWYSRHIDERVRQRAATDRPQFPAKVVRRTVGILFALMFSKFFYLASISSYYEFFLIHRFGLAAHESANLLAVFLFAVAIGTMIGGPLGDRIGRRRVIWFSILGCAPFTLVLPYVGLGWTIGLSVVIGLILASAFPAIIVYAQDMLTHRIGMVSGLFYGFSFGLGGLGAAVLGLIADHFGIVFVYQVCAFLPLLGLLAVFLPDVRPPEHAARHPPRLTGAWNPGNALWSDPW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
4 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
5 2561511199 Enterobacter sp. R4-368 Isolate Nodule
6 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
7 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
8 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
9 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
10 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
11 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
12 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
13 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
14 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
15 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
16 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
17 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
18 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
19 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
20 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
21 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
22 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
23 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
24 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
25 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
26 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
27 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
28 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
29 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
30 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
31 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
32 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
33 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
34 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
35 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
36 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
37 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
38 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
39 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
40 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
41 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
42 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
43 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
44 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
45 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
46 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
47 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
48 2636415599 Klebsiella variicola DX120E Isolate Unclassified
49 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
50 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
51 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
52 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
53 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
54 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
55 2738543013 Variovorax sp. BT01 Isolate Unclassified
56 2751185917 Enterobacter sp. HK169 Isolate Unclassified
57 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
58 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
59 2775507074 Klebsiella sp. D5A Isolate Unclassified
60 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
61 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
62 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
63 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
64 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
65 2818991457 Xanthomonas translucens 569 Isolate Unclassified
66 2821118458 Enterobacter asburiae 609 Isolate Unclassified
67 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
68 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
69 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
70 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
71 2847085930 Erwinia persicina B64 Isolate Bulb
72 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
73 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
74 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
75 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
76 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
77 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
78 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
79 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
80 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
81 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
82 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
83 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
84 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
85 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
86 2937539931 Pantoea sp. LS15 Isolate Unclassified
87 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
88 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
89 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
90 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
91 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
92 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
93 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
94 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
95 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
96 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
97 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
98 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
99 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
100 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
101 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
102 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
103 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
104 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
105 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
106 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
107 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
108 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
109 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
110 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
113 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
123 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
128 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
129 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
154 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
175 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
176 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
177 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
223 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
242 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
337 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
338 8018221730 Enterobacter sp. CM29 Isolate Unclassified
339 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
340 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
341 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
342 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
343 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
344 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
345 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
346 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
347 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
348 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.29
Metatranscriptomes 0.28
Isolates 15.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0.14
Endosphere 4.63
Nodule 2.66
Rhizoplane 8.42
Rhizosphere 69.42
Stem 0.14
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_538696 2162886007 Bacteria 8149
2 SwRhRL2b_contig_91143 2162886007 Bacteria 4481
3 JGI24741J21665_1000657 3300001915 Bacteria 10437
4 JGI24741J21665_1001198 3300001915 Bacteria 7646
5 JGI24741J21665_1002210 3300001915 Bacteria 5164
6 JGI24740J21852_10004760 3300001979 Bacteria 5798
7 JGI24740J21852_10005286 3300001979 Bacteria 5480
8 JGI25152J39213_1000101 3300002773 Bacteria 60570
9 JGI25150J39212_1000588 3300002774 Bacteria 14316
10 JGI25151J46595_10002896 3300003187 Bacteria 9836
11 JGI25153J46596_10000061 3300003215 Bacteria 131624
12 Ga0055536_1022130 3300003781 Bacteria 1906
13 Ga0055534_1000455 3300003784 Bacteria 23803
14 Ga0058692_1000033 3300003856 Bacteria 174393
15 Ga0058692_1005450 3300003856 Bacteria 3624
16 Ga0058692_1012726 3300003856 Bacteria 1982
17 Ga0058692_1014700 3300003856 Bacteria 1787
18 Ga0065704_10000433 3300005289 Bacteria 46686
19 Ga0065704_10000665 3300005289 Bacteria 14067
20 Ga0065704_10001659 3300005289 Bacteria 6945
21 Ga0065704_10070381 3300005289 Bacteria 27950
22 Ga0065704_10071710 3300005289 Bacteria 10180
23 Ga0070658_10186952 3300005327 Bacteria 1745
24 Ga0070683_100003087 3300005329 Bacteria 13409
25 Ga0070683_100212661 3300005329 Bacteria 1837
26 Ga0070670_100000851 3300005331 Bacteria 23874
27 Ga0070670_100004348 3300005331 Bacteria 11856
28 Ga0070680_100000962 3300005336 Bacteria 20385
29 Ga0070680_100003796 3300005336 Bacteria 11297
30 Ga0070680_100004644 3300005336 Bacteria 10329
31 Ga0070680_100007196 3300005336 Bacteria 8482
32 Ga0070680_100014393 3300005336 Bacteria 6183
33 Ga0070680_100017699 3300005336 Bacteria 5621
34 Ga0070680_100031469 3300005336 Bacteria 4266
35 Ga0070680_100033731 3300005336 Bacteria 4128
36 Ga0070680_100080840 3300005336 Bacteria 2681
37 Ga0070682_100002329 3300005337 Bacteria 10500
38 Ga0070682_100026586 3300005337 Bacteria 3465
39 Ga0070660_100015944 3300005339 Bacteria 5442
40 Ga0070660_100038796 3300005339 Bacteria 3618
41 Ga0070691_10000750 3300005341 Bacteria 12791
42 Ga0070691_10008594 3300005341 Bacteria 4674
43 Ga0070661_100014266 3300005344 Bacteria 5597
44 Ga0070692_10018391 3300005345 Bacteria 3360
45 Ga0070668_100057885 3300005347 Bacteria 2997
46 Ga0070668_100147812 3300005347 Bacteria 1898
47 Ga0070669_100059868 3300005353 Bacteria 2796
48 Ga0070675_100024992 3300005354 Bacteria 4787
49 Ga0070674_100026052 3300005356 Bacteria 3815
50 Ga0070659_100004889 3300005366 Bacteria 9578
51 Ga0070659_100059948 3300005366 Bacteria 3005
52 Ga0070667_100001622 3300005367 Bacteria 20131
53 Ga0070663_100034632 3300005455 Bacteria 3498
54 Ga0070663_100069803 3300005455 Bacteria 2554
55 Ga0070663_100084348 3300005455 Bacteria 2342
56 Ga0070663_100151453 3300005455 Bacteria 1779
57 Ga0070663_100188985 3300005455 Bacteria 1602
58 Ga0070678_100003872 3300005456 Bacteria 8409
59 Ga0070662_100013171 3300005457 Bacteria 5497
60 Ga0070662_100147403 3300005457 Bacteria 1829
61 Ga0070681_10003236 3300005458 Bacteria 15189
62 Ga0070681_10015132 3300005458 Bacteria 7673
63 Ga0070681_10018915 3300005458 Bacteria 6893
64 Ga0070681_10019170 3300005458 Bacteria 6846
65 Ga0070681_10030610 3300005458 Bacteria 5401
66 Ga0070681_10039868 3300005458 Bacteria 4708
67 Ga0070681_10042958 3300005458 Bacteria 4529
68 Ga0068867_100000267 3300005459 Bacteria 34224
69 Ga0070679_100002570 3300005530 Bacteria 16476
70 Ga0070679_100002602 3300005530 Bacteria 16414
71 Ga0070679_100006621 3300005530 Bacteria 10800
72 Ga0070679_100008470 3300005530 Bacteria 9683
73 Ga0070679_100011486 3300005530 Bacteria 8440
74 Ga0070679_100054701 3300005530 Bacteria 3975
75 Ga0070684_100053401 3300005535 Bacteria 3518
76 Ga0070684_100270322 3300005535 Bacteria 1556
77 Ga0068853_100002122 3300005539 Bacteria 14740
78 Ga0068853_100005356 3300005539 Bacteria 10048
79 Ga0070672_100005456 3300005543 Bacteria 8431
80 Ga0070672_100059128 3300005543 Bacteria 3015
81 Ga0070696_100036418 3300005546 Bacteria 3392
82 Ga0070696_100070345 3300005546 Bacteria 2461
83 Ga0070665_100000203 3300005548 Bacteria 104072
84 Ga0070665_100157195 3300005548 Bacteria 2275
85 Ga0068855_100054069 3300005563 Bacteria 4721
86 Ga0068855_100057270 3300005563 Bacteria 4569
87 Ga0068855_100092995 3300005563 Bacteria 3477
88 Ga0068855_100201315 3300005563 Bacteria 2241
89 Ga0070664_100143319 3300005564 Bacteria 2105
90 Ga0068857_100000003 3300005577 Bacteria 174630
91 Ga0068857_100108164 3300005577 Bacteria 2498
92 Ga0068857_100205315 3300005577 Bacteria 1797
93 Ga0068854_100002882 3300005578 Bacteria 10701
94 Ga0068854_100031873 3300005578 Bacteria 3664
95 Ga0068856_100119111 3300005614 Bacteria 2641
96 Ga0068856_100156189 3300005614 Bacteria 2291
97 Ga0068856_100265172 3300005614 Bacteria 1733
98 Ga0068852_100027673 3300005616 Bacteria 4624
99 Ga0068852_100029880 3300005616 Bacteria 4480
100 Ga0068852_100255563 3300005616 Bacteria 1680
101 Ga0068859_100052163 3300005617 Bacteria 4112
102 Ga0068859_100113393 3300005617 Bacteria 2774
103 Ga0068866_10027651 3300005718 Bacteria 2694
104 Ga0068861_100017541 3300005719 Bacteria 5086
105 Ga0068863_100096633 3300005841 Bacteria 2805
106 Ga0068860_100000833 3300005843 Bacteria 34495
107 Ga0068860_100104603 3300005843 Bacteria 2703
108 Ga0081539_10000037 3300005985 Bacteria 296160
109 Ga0075363_100063964 3300006048 Bacteria 1987
110 Ga0075364_10015162 3300006051 Bacteria 4773
111 Ga0075364_10024053 3300006051 Bacteria 3863
112 Ga0097621_100016075 3300006237 Bacteria 5649
113 Ga0097621_100250271 3300006237 Bacteria 1551
114 Ga0068871_100002413 3300006358 Bacteria 12752
115 Ga0068871_100053924 3300006358 Bacteria 3260
116 Ga0068865_100027627 3300006881 Bacteria 3749
117 Ga0097620_100052163 3300006931 Bacteria 4112
118 Ga0097620_100113399 3300006931 Bacteria 2774
119 Ga0079104_1000248 3300006946 Bacteria 72191
120 Ga0079104_1000824 3300006946 Bacteria 25792
121 Ga0079104_1001251 3300006946 Bacteria 17746
122 Ga0079104_1002062 3300006946 Bacteria 11618
123 Ga0079104_1002064 3300006946 Bacteria 11613
124 Ga0079104_1003837 3300006946 Bacteria 6734
125 Ga0079104_1006583 3300006946 Bacteria 4361
126 Ga0105251_10000076 3300009011 Bacteria 93688
127 Ga0105251_10000812 3300009011 Bacteria 28139
128 Ga0105251_10000983 3300009011 Bacteria 25136
129 Ga0105251_10001816 3300009011 Bacteria 17651
130 Ga0105251_10016286 3300009011 Bacteria 4024
131 Ga0105251_10020013 3300009011 Bacteria 3522
132 Ga0105244_10000087 3300009036 Bacteria 102130
133 Ga0105244_10000298 3300009036 Bacteria 48389
134 Ga0105244_10000858 3300009036 Bacteria 25623
135 Ga0105244_10003210 3300009036 Bacteria 11842
136 Ga0105244_10008118 3300009036 Bacteria 6591
137 Ga0105244_10009750 3300009036 Bacteria 5872
138 Ga0105244_10038249 3300009036 Bacteria 2503
139 Ga0105250_10000025 3300009092 Bacteria 215424
140 Ga0105250_10000044 3300009092 Bacteria 128269
141 Ga0105250_10002818 3300009092 Bacteria 8512
142 Ga0105250_10006892 3300009092 Bacteria 4926
143 Ga0105250_10015255 3300009092 Bacteria 3148
144 Ga0105240_10028320 3300009093 Bacteria 7319
145 Ga0105240_10050711 3300009093 Bacteria 5230
146 Ga0105240_10103869 3300009093 Bacteria 3451
147 Ga0105240_10133525 3300009093 Bacteria 2974
148 Ga0105240_10175591 3300009093 Bacteria 2533
149 Ga0105240_10356307 3300009093 Bacteria 1659
150 Ga0111539_10023624 3300009094 Bacteria 7555
151 Ga0105243_10002042 3300009148 Bacteria 17120
152 Ga0105243_10048053 3300009148 Bacteria 3362
153 Ga0105243_10049212 3300009148 Bacteria 3324
154 Ga0105237_10053378 3300009545 Bacteria 4054
155 Ga0105238_10008662 3300009551 Bacteria 10181
156 Ga0105249_10013582 3300009553 Bacteria 7194
157 Ga0105239_10030044 3300010375 Bacteria 5976
158 Ga0157373_10004475 3300013100 Bacteria 10521
159 Ga0157373_10022121 3300013100 Bacteria 4615
160 Ga0157373_10032466 3300013100 Bacteria 3758
161 Ga0157371_10022278 3300013102 Bacteria 4645
162 Ga0157371_10068650 3300013102 Bacteria 2509
163 Ga0157371_10103473 3300013102 Bacteria 2020
164 Ga0157370_10003679 3300013104 Bacteria 17908
165 Ga0157370_10005320 3300013104 Bacteria 14454
166 Ga0157370_10015593 3300013104 Bacteria 7721
167 Ga0157370_10019402 3300013104 Bacteria 6822
168 Ga0157370_10024713 3300013104 Bacteria 5948
169 Ga0157370_10033441 3300013104 Bacteria 5014
170 Ga0157370_10049188 3300013104 Bacteria 4036
171 Ga0157369_10031962 3300013105 Bacteria 5790
172 Ga0157378_10006582 3300013297 Bacteria 10149
173 Ga0163162_10004915 3300013306 Bacteria 12885
174 Ga0163162_10013691 3300013306 Bacteria 7925
175 Ga0157372_10009910 3300013307 Bacteria 10134
176 Ga0157372_10013697 3300013307 Bacteria 8667
177 Ga0157372_10084778 3300013307 Bacteria 3592
178 Ga0157372_10133357 3300013307 Bacteria 2859
179 Ga0157372_10279505 3300013307 Bacteria 1941
180 Ga0157380_10003797 3300014326 Bacteria 10390
181 Ga0157376_10126496 3300014969 Bacteria 2274
182 Ga0182006_1000020 3300015261 Bacteria 285318
183 Ga0182006_1023556 3300015261 Bacteria 2549
184 Ga0183366_1001 3300015679 Bacteria 2743932
185 Ga0183370_1001 3300015680 Bacteria 2743932
186 Ga0183369_1001 3300015685 Bacteria 2743932
187 Ga0183368_1001 3300015687 Bacteria 2743932
188 Ga0163161_10069792 3300017792 Bacteria 2569
189 Ga0206354_10893253 3300020081 Bacteria 2439
190 Ga0206353_11588364 3300020082 Bacteria 3272
191 Ga0207425_1000015 3300025245 Bacteria 466368
192 Ga0209129_1000131 3300025258 Bacteria 127801
193 Ga0209675_1000948 3300025291 Bacteria 18431
194 Ga0209676_1009694 3300025292 Bacteria 4121
195 Ga0209676_1016989 3300025292 Bacteria 2596
196 Ga0209025_1000002 3300025294 Bacteria 1393142
197 Ga0209025_1034180 3300025294 Bacteria 2329
198 Ga0209758_1000003 3300025297 Bacteria 1398533
199 Ga0209050_1005760 3300025298 Bacteria 7638
200 Ga0209257_1000136 3300025304 Bacteria 204863
201 Ga0207656_10018950 3300025321 Bacteria 2716
202 Ga0207696_1000003 3300025711 Bacteria 860639
203 Ga0207696_1000007 3300025711 Bacteria 578417
204 Ga0207696_1000517 3300025711 Bacteria 32018
205 Ga0207696_1000769 3300025711 Bacteria 21158
206 Ga0207696_1004495 3300025711 Bacteria 6002
207 Ga0207696_1005968 3300025711 Bacteria 4974
208 Ga0207655_1000001 3300025728 Bacteria 1866413
209 Ga0207655_1000032 3300025728 Bacteria 391253
210 Ga0207655_1000042 3300025728 Bacteria 333039
211 Ga0207655_1000206 3300025728 Bacteria 102975
212 Ga0207655_1001567 3300025728 Bacteria 20571
213 Ga0207655_1004065 3300025728 Bacteria 10536
214 Ga0207655_1013562 3300025728 Bacteria 4668
215 Ga0207655_1013666 3300025728 Bacteria 4644
216 Ga0207655_1020388 3300025728 Bacteria 3409
217 Ga0207713_1000005 3300025735 Bacteria 649958
218 Ga0207713_1000006 3300025735 Bacteria 586163
219 Ga0207713_1000021 3300025735 Bacteria 353108
220 Ga0207713_1000578 3300025735 Bacteria 36427
221 Ga0207713_1001870 3300025735 Bacteria 16010
222 Ga0207713_1002815 3300025735 Bacteria 12271
223 Ga0207713_1004420 3300025735 Bacteria 9119
224 Ga0207713_1014249 3300025735 Bacteria 4144
225 Ga0207713_1055453 3300025735 Bacteria 1547
226 Ga0207647_10000508 3300025904 Bacteria 31144
227 Ga0207705_10000177 3300025909 Bacteria 67227
228 Ga0207705_10001625 3300025909 Bacteria 17827
229 Ga0207705_10046668 3300025909 Bacteria 3114
230 Ga0207707_10000057 3300025912 Bacteria 113186
231 Ga0207707_10000175 3300025912 Bacteria 66455
232 Ga0207707_10000349 3300025912 Bacteria 48530
233 Ga0207707_10002332 3300025912 Bacteria 17099
234 Ga0207707_10002782 3300025912 Bacteria 15602
235 Ga0207707_10006938 3300025912 Bacteria 9877
236 Ga0207707_10030289 3300025912 Bacteria 4735
237 Ga0207707_10034750 3300025912 Bacteria 4410
238 Ga0207707_10057247 3300025912 Bacteria 3393
239 Ga0207707_10108353 3300025912 Bacteria 2428
240 Ga0207695_10009944 3300025913 Bacteria 11691
241 Ga0207695_10038003 3300025913 Bacteria 5190
242 Ga0207695_10052524 3300025913 Bacteria 4269
243 Ga0207695_10193759 3300025913 Bacteria 1949
244 Ga0207660_10000836 3300025917 Bacteria 20276
245 Ga0207660_10001207 3300025917 Bacteria 17303
246 Ga0207660_10006690 3300025917 Bacteria 7469
247 Ga0207660_10007728 3300025917 Bacteria 6960
248 Ga0207660_10009422 3300025917 Bacteria 6320
249 Ga0207660_10022268 3300025917 Bacteria 4269
250 Ga0207660_10068999 3300025917 Bacteria 2566
251 Ga0207660_10151997 3300025917 Bacteria 1779
252 Ga0207657_10005463 3300025919 Bacteria 13266
253 Ga0207657_10007838 3300025919 Bacteria 10897
254 Ga0207657_10037568 3300025919 Bacteria 4322
255 Ga0207657_10104775 3300025919 Bacteria 2342
256 Ga0207649_10000743 3300025920 Bacteria 21413
257 Ga0207649_10006777 3300025920 Bacteria 6220
258 Ga0207652_10000135 3300025921 Bacteria 78257
259 Ga0207652_10000503 3300025921 Bacteria 39789
260 Ga0207652_10001242 3300025921 Bacteria 22765
261 Ga0207652_10001311 3300025921 Bacteria 22103
262 Ga0207652_10003488 3300025921 Bacteria 12962
263 Ga0207652_10003761 3300025921 Bacteria 12425
264 Ga0207652_10025427 3300025921 Bacteria 4923
265 Ga0207652_10202728 3300025921 Bacteria 1785
266 Ga0207681_10016590 3300025923 Bacteria 4609
267 Ga0207681_10048204 3300025923 Bacteria 2875
268 Ga0207694_10029192 3300025924 Bacteria 4207
269 Ga0207659_10137877 3300025926 Bacteria 1890
270 Ga0207690_10003296 3300025932 Bacteria 9664
271 Ga0207690_10008753 3300025932 Bacteria 6008
272 Ga0207690_10040705 3300025932 Bacteria 3040
273 Ga0207690_10077797 3300025932 Bacteria 2307
274 Ga0207706_10015842 3300025933 Bacteria 6817
275 Ga0207706_10044937 3300025933 Bacteria 3913
276 Ga0207709_10013615 3300025935 Bacteria 4487
277 Ga0207709_10024955 3300025935 Bacteria 3419
278 Ga0207691_10000612 3300025940 Bacteria 35502
279 Ga0207691_10021612 3300025940 Bacteria 6074
280 Ga0207661_10001782 3300025944 Bacteria 14719
281 Ga0207661_10053672 3300025944 Bacteria 3226
282 Ga0207661_10082188 3300025944 Bacteria 2663
283 Ga0207661_10099176 3300025944 Bacteria 2442
284 Ga0207667_10005232 3300025949 Bacteria 15828
285 Ga0207667_10010906 3300025949 Bacteria 10592
286 Ga0207667_10214204 3300025949 Bacteria 1974
287 Ga0207712_10012025 3300025961 Bacteria 5524
288 Ga0207668_10012339 3300025972 Bacteria 5228
289 Ga0207640_10003713 3300025981 Bacteria 8234
290 Ga0207640_10078604 3300025981 Bacteria 2246
291 Ga0207658_10014530 3300025986 Bacteria 5391
292 Ga0207658_10090570 3300025986 Bacteria 2371
293 Ga0207639_10003942 3300026041 Bacteria 10019
294 Ga0207639_10015615 3300026041 Bacteria 5358
295 Ga0207639_10021668 3300026041 Bacteria 4619
296 Ga0207639_10096067 3300026041 Bacteria 2383
297 Ga0207678_10003349 3300026067 Bacteria 14458
298 Ga0207678_10003994 3300026067 Bacteria 13273
299 Ga0207678_10005247 3300026067 Bacteria 11604
300 Ga0207702_10026433 3300026078 Bacteria 4819
301 Ga0207702_10028840 3300026078 Bacteria 4615
302 Ga0207702_10147403 3300026078 Bacteria 2137
303 Ga0207702_10242008 3300026078 Bacteria 1691
304 Ga0207648_10000585 3300026089 Bacteria 40840
305 Ga0207674_10000043 3300026116 Bacteria 124448
306 Ga0207674_10005145 3300026116 Bacteria 15602
307 Ga0207675_100001560 3300026118 Bacteria 22970
308 Ga0207683_10045407 3300026121 Bacteria 3842
309 Ga0207698_10031957 3300026142 Bacteria 3807
310 Ga0207698_10032832 3300026142 Bacteria 3765
311 Ga0207698_10106753 3300026142 Bacteria 2336
312 Ga0209281_1000001 3300027111 Bacteria 1933496
313 Ga0209281_1000021 3300027111 Bacteria 541033
314 Ga0209281_1000041 3300027111 Bacteria 347825
315 Ga0209281_1000075 3300027111 Bacteria 267114
316 Ga0209281_1000079 3300027111 Bacteria 261444
317 Ga0209281_1000122 3300027111 Bacteria 205171
318 Ga0209281_1000335 3300027111 Bacteria 80336
319 Ga0209281_1000837 3300027111 Bacteria 27494
320 Ga0209281_1001682 3300027111 Bacteria 11599
321 Ga0209281_1003643 3300027111 Bacteria 4965
322 Ga0209371_1000001 3300027312 Bacteria 2771503
323 Ga0209371_1000088 3300027312 Bacteria 174446
324 Ga0209371_1000227 3300027312 Bacteria 72894
325 Ga0209371_1001062 3300027312 Bacteria 20562
326 Ga0209371_1001115 3300027312 Bacteria 19852
327 Ga0209371_1009374 3300027312 Bacteria 3119
328 Ga0268266_10000084 3300028379 Bacteria 201874
329 Ga0268266_10015839 3300028379 Bacteria 6453
330 Ga0268265_10024164 3300028380 Bacteria 4295
331 Ga0268265_10125621 3300028380 Bacteria 2122
332 Ga0268264_10002281 3300028381 Bacteria 16987
333 Ga0268264_10004408 3300028381 Bacteria 12009
334 Ga0268264_10134813 3300028381 Bacteria 2194
335 Ga0265338_10000092 3300028800 Bacteria 168538
336 Ga0268256_1000001 3300030500 Bacteria 2771065
337 Ga0268256_1000017 3300030500 Bacteria 600718
338 Ga0268256_1000079 3300030500 Bacteria 174445
339 Ga0268256_1000824 3300030500 Bacteria 22179
340 Ga0268256_1000894 3300030500 Bacteria 20562
341 Ga0268256_1004438 3300030500 Bacteria 5817
342 Ga0268256_1009927 3300030500 Bacteria 3119
343 Ga0265331_10000002 3300031250 Bacteria 511481
344 Ga0265314_10029904 3300031711 Bacteria 4041
345 Ga0373939_0000006 3300035114 Bacteria 78721
346 Ga0373960_0009144 3300035121 Bacteria 2393
347 Ga0395900_0073154 3300037418 Bacteria 3523
348 Ga0395900_0082427 3300037418 Bacteria 3304
349 Ga0395898_0154205 3300037466 Bacteria 2197
350 Ga0436364_1484100 3300037853 Bacteria 1969
351 Ga0395901_0025130 3300038443 Bacteria 6115
352 Ga0395901_0040362 3300038443 Bacteria 4833
353 Ga0395901_0221092 3300038443 Bacteria 1979
354 Ga0237819_00007 3300038705 Bacteria 74520
355 Ga0436361_0210437 3300039447 Bacteria 3726
356 Ga0436361_1124212 3300039447 Bacteria 3667
357 Ga0439438_002067 3300041405 Bacteria 8715
358 Ga0451853_0850445 3300041512 Bacteria 7313
359 Ga0439452_000003 3300042010 Bacteria 942815
360 Ga0439452_000033 3300042010 Bacteria 178345
361 Ga0439452_000364 3300042010 Bacteria 27664
362 Ga0466981_0000006 3300044669 Bacteria 157389
363 Ga0466967_0182807 3300045976 Bacteria 1978
364 Ga0495591_000011 3300046458 Bacteria 309685
365 Ga0495591_004165 3300046458 Bacteria 7179
366 Ga0495591_009820 3300046458 Bacteria 3768
367 Ga0495638_0030293 3300046460 Bacteria 3484
368 Ga0495650_0000033 3300046471 Bacteria 412188
369 Ga0495650_0000175 3300046471 Bacteria 140965
370 Ga0495605_0003254 3300046474 Bacteria 9750
371 Ga0495605_0055313 3300046474 Bacteria 1918
372 Ga0495584_0007520 3300046491 Bacteria 5679
373 Ga0495607_0000687 3300046501 Bacteria 32626
374 Ga0495606_0000627 3300046507 Bacteria 55643
375 Ga0495610_0034717 3300046512 Bacteria 2595
376 Ga0495616_0004108 3300046513 Bacteria 9230
377 Ga0495632_0002588 3300046519 Bacteria 13643
378 Ga0495632_0064665 3300046519 Bacteria 1768
379 Ga0495643_0003136 3300046522 Bacteria 12331
380 Ga0495644_0000325 3300046523 Bacteria 21805
381 Ga0495648_0006866 3300046524 Bacteria 9190
382 Ga0495663_0010070 3300046525 Bacteria 2625
383 Ga0495654_0000020 3300046530 Bacteria 284814
384 Ga0495621_0018978 3300046539 Bacteria 2240
385 Ga0495597_0000129 3300046542 Bacteria 68183
386 Ga0495622_0026559 3300046557 Bacteria 2703
387 Ga0495633_0000825 3300046558 Bacteria 27382
388 Ga0495625_0003123 3300046660 Bacteria 16923
389 Ga0495661_0001380 3300046665 Bacteria 20447
390 Ga0495649_0001266 3300046694 Bacteria 19465
391 Ga0495649_0004698 3300046694 Bacteria 8864
392 Ga0495649_0008607 3300046694 Bacteria 6128
393 Ga0495660_0000011 3300046810 Bacteria 361397
394 Ga0495672_0000004 3300047320 Bacteria 631810
395 Ga0495672_0000027 3300047320 Bacteria 325651
396 Ga0495683_0025654 3300047323 Bacteria 3019
397 Ga0495677_0028923 3300047445 Bacteria 2014
398 Ga0495679_000019 3300047446 Bacteria 231072
399 Ga0495679_001269 3300047446 Bacteria 14828
400 Ga0495673_0000022 3300047469 Bacteria 544086
401 Ga0495673_0000023 3300047469 Bacteria 539904
402 Ga0495686_0000739 3300047472 Bacteria 43610
403 Ga0495686_0147719 3300047472 Bacteria 1382
404 Ga0495626_0004283 3300048091 Bacteria 8809
405 Ga0495626_0008388 3300048091 Bacteria 5673
406 Ga0495626_0013152 3300048091 Bacteria 4311
407 Ga0495626_0037663 3300048091 Bacteria 2296
408 Ga0496100_0001210 3300048903 Bacteria 12539
409 Ga0496100_0098896 3300048903 Bacteria 2006
410 Ga0496102_0000562 3300048905 Bacteria 39530
411 Ga0496102_0026746 3300048905 Bacteria 5149
412 Ga0496103_0000161 3300048906 Bacteria 70714
413 Ga0496103_0031541 3300048906 Bacteria 3229
414 Ga0496104_0000163 3300048907 Bacteria 60138
415 Ga0496104_0000204 3300048907 Bacteria 52844
416 Ga0496105_0000047 3300048908 Bacteria 98232
417 Ga0496105_0029432 3300048908 Bacteria 4495
418 Ga0496107_0017459 3300048910 Bacteria 5048
419 Ga0496112_0004094 3300048915 Bacteria 12252
420 Ga0496113_0000067 3300048916 Bacteria 45110
421 Ga0496116_0000505 3300048919 Bacteria 53281
422 Ga0496116_0001024 3300048919 Bacteria 34122
423 Ga0496116_0006422 3300048919 Bacteria 10658
424 Ga0496116_0023605 3300048919 Bacteria 4576
425 Ga0496116_0030689 3300048919 Bacteria 3857
426 Ga0496117_0000090 3300048920 Bacteria 206388
427 Ga0496117_0002345 3300048920 Bacteria 24206
428 Ga0496117_0003432 3300048920 Bacteria 18430
429 Ga0496117_0003461 3300048920 Bacteria 18347
430 Ga0496117_0032767 3300048920 Bacteria 3941
431 Ga0496118_0000032 3300048921 Bacteria 330072
432 Ga0496118_0002663 3300048921 Bacteria 23602
433 Ga0496118_0011337 3300048921 Bacteria 8713
434 Ga0496118_0021918 3300048921 Bacteria 5603
435 Ga0496118_0022885 3300048921 Bacteria 5446
436 Ga0496118_0025196 3300048921 Bacteria 5109
437 Ga0496119_0000467 3300048922 Bacteria 55035
438 Ga0496119_0001141 3300048922 Bacteria 33321
439 Ga0496119_0001796 3300048922 Bacteria 24965
440 Ga0496119_0002217 3300048922 Bacteria 21686
441 Ga0496119_0002997 3300048922 Bacteria 17911
442 Ga0496119_0004691 3300048922 Bacteria 13456
443 Ga0496119_0015373 3300048922 Bacteria 5898
444 Ga0496119_0015432 3300048922 Bacteria 5882
445 Ga0496119_0019264 3300048922 Bacteria 5036
446 Ga0496119_0070866 3300048922 Bacteria 2043
447 Ga0496120_0000043 3300048923 Bacteria 195584
448 Ga0496120_0000412 3300048923 Bacteria 68157
449 Ga0496120_0000557 3300048923 Bacteria 56887
450 Ga0496120_0000639 3300048923 Bacteria 52052
451 Ga0496120_0002078 3300048923 Bacteria 21510
452 Ga0496120_0012547 3300048923 Bacteria 5762
453 Ga0496120_0014343 3300048923 Bacteria 5288
454 Ga0496120_0075236 3300048923 Bacteria 1843
455 Ga0496121_0002191 3300048924 Bacteria 30572
456 Ga0496121_0003443 3300048924 Bacteria 22609
457 Ga0496121_0003835 3300048924 Bacteria 20919
458 Ga0496121_0016242 3300048924 Bacteria 7702
459 Ga0496121_0071071 3300048924 Bacteria 2800
460 Ga0496122_0000026 3300048925 Bacteria 360871
461 Ga0496122_0000233 3300048925 Bacteria 125120
462 Ga0496122_0001575 3300048925 Bacteria 35879
463 Ga0496122_0073594 3300048925 Bacteria 2421
464 Ga0496123_0000005 3300048926 Bacteria 658131
465 Ga0496123_0000759 3300048926 Bacteria 52224
466 Ga0496123_0000769 3300048926 Bacteria 51882
467 Ga0496123_0001260 3300048926 Bacteria 36421
468 Ga0496123_0006211 3300048926 Bacteria 11658
469 Ga0496123_0008641 3300048926 Bacteria 9314
470 Ga0496124_0000020 3300048927 Bacteria 434107
471 Ga0496124_0000288 3300048927 Bacteria 95203
472 Ga0496124_0001445 3300048927 Bacteria 35092
473 Ga0496124_0002079 3300048927 Bacteria 27051
474 Ga0496124_0005340 3300048927 Bacteria 14506
475 Ga0496124_0009593 3300048927 Bacteria 9924
476 Ga0496124_0012736 3300048927 Bacteria 8267
477 Ga0496124_0140492 3300048927 Bacteria 1906
478 Ga0496125_0000016 3300048928 Bacteria 512512
479 Ga0496125_0001010 3300048928 Bacteria 43762
480 Ga0496125_0003003 3300048928 Bacteria 21108
481 Ga0496125_0012188 3300048928 Bacteria 8554
482 Ga0496125_0018969 3300048928 Bacteria 6509
483 Ga0496125_0035711 3300048928 Bacteria 4354
484 Ga0496125_0036171 3300048928 Bacteria 4316
485 Ga0496125_0264593 3300048928 Bacteria 1075
486 Ga0496126_0000028 3300048929 Bacteria 394082
487 Ga0496126_0002177 3300048929 Bacteria 27226
488 Ga0496126_0009165 3300048929 Bacteria 10560
489 Ga0496126_0028311 3300048929 Bacteria 5341
490 Ga0496126_0034905 3300048929 Bacteria 4717
491 Ga0496126_0107821 3300048929 Bacteria 2429
492 Ga0496126_0202711 3300048929 Bacteria 1674
493 Ga0495682_0000004 3300049460 Bacteria 378337
494 Ga0501031_0064948 3300049568 Bacteria 2377
495 Ga0501032_0000556 3300049569 Bacteria 30238
496 Ga0501032_0018319 3300049569 Bacteria 4907
497 Ga0501032_0025306 3300049569 Bacteria 4092
498 Ga0501032_0043548 3300049569 Bacteria 3039
499 Ga0501033_0004530 3300049570 Bacteria 11124
500 Ga0501033_0046415 3300049570 Bacteria 3230
501 Ga0501033_0075755 3300049570 Bacteria 2469
502 Ga0501033_0127394 3300049570 Bacteria 1846
503 Ga0501034_0001429 3300049571 Bacteria 31855
504 Ga0501034_0033378 3300049571 Bacteria 5222
505 Ga0501034_0082500 3300049571 Bacteria 3216
506 Ga0501034_0108244 3300049571 Bacteria 2770
507 Ga0501036_0010147 3300049572 Bacteria 7762
508 Ga0501036_0016372 3300049572 Bacteria 6194
509 Ga0501036_0018005 3300049572 Bacteria 5914
510 Ga0501036_0061208 3300049572 Bacteria 3189
511 Ga0501037_0014932 3300049573 Bacteria 5713
512 Ga0501037_0028985 3300049573 Bacteria 4088
513 Ga0501037_0118994 3300049573 Bacteria 1900
514 Ga0501038_0000102 3300049574 Bacteria 72409
515 Ga0501038_0007933 3300049574 Bacteria 9782
516 Ga0501040_0205576 3300049576 Bacteria 1399
517 Ga0501043_0026511 3300049579 Bacteria 4546
518 Ga0501043_0032780 3300049579 Bacteria 4085
519 Ga0501046_0005371 3300049580 Bacteria 11455
520 Ga0501046_0047222 3300049580 Bacteria 3414
521 Ga0501047_0000070 3300049581 Bacteria 127146
522 Ga0501047_0000768 3300049581 Bacteria 33598
523 Ga0501047_0002430 3300049581 Bacteria 17801
524 Ga0501047_0020236 3300049581 Bacteria 6390
525 Ga0501047_0020294 3300049581 Bacteria 6381
526 Ga0501047_0025174 3300049581 Bacteria 5718
527 Ga0501047_0054024 3300049581 Bacteria 3885
528 Ga0501067_0000124 3300049583 Bacteria 42331
529 Ga0501067_0002161 3300049583 Bacteria 10833
530 Ga0501067_0012879 3300049583 Bacteria 4631
531 Ga0501068_0004248 3300049584 Bacteria 7776
532 Ga0501068_0036399 3300049584 Bacteria 2942
533 Ga0501069_0000307 3300049585 Bacteria 22338
534 Ga0501069_0031062 3300049585 Bacteria 2936
535 Ga0501069_0112791 3300049585 Bacteria 1549
536 Ga0501070_0000062 3300049586 Bacteria 92290
537 Ga0501070_0001521 3300049586 Bacteria 20654
538 Ga0501070_0002921 3300049586 Bacteria 14866
539 Ga0501070_0012091 3300049586 Bacteria 7285
540 Ga0501070_0012510 3300049586 Bacteria 7159
541 Ga0501070_0015787 3300049586 Bacteria 6351
542 Ga0501070_0017963 3300049586 Bacteria 5936
543 Ga0501070_0025012 3300049586 Bacteria 5007
544 Ga0501070_0046784 3300049586 Bacteria 3597
545 Ga0501070_0050530 3300049586 Bacteria 3452
546 Ga0501070_0097373 3300049586 Bacteria 2433
547 Ga0501070_0219529 3300049586 Bacteria 1559
548 Ga0501071_0002292 3300049587 Bacteria 11542
549 Ga0501071_0013122 3300049587 Bacteria 5639
550 Ga0501072_0000129 3300049588 Bacteria 56119
551 Ga0501073_0000691 3300049589 Bacteria 23736
552 Ga0501073_0001873 3300049589 Bacteria 15659
553 Ga0501073_0012476 3300049589 Bacteria 6200
554 Ga0501073_0049657 3300049589 Bacteria 2941
555 Ga0501073_0087363 3300049589 Bacteria 2168
556 Ga0501074_0001914 3300049590 Bacteria 14307
557 Ga0501074_0005621 3300049590 Bacteria 9027
558 Ga0501074_0049268 3300049590 Bacteria 3041
559 Ga0501076_0015853 3300049592 Bacteria 5702
560 Ga0501077_0053741 3300049593 Bacteria 2557
561 Ga0501077_0110012 3300049593 Bacteria 1746
562 Ga0501079_0005850 3300049741 Bacteria 9199
563 Ga0501079_0010713 3300049741 Bacteria 6982
564 Ga0501080_0003577 3300049742 Bacteria 13679
565 Ga0501080_0004738 3300049742 Bacteria 12129
566 Ga0501080_0005039 3300049742 Bacteria 11766
567 Ga0501080_0015339 3300049742 Bacteria 7061
568 Ga0501080_0037325 3300049742 Bacteria 4537
569 Ga0501080_0208783 3300049742 Bacteria 1790
570 Ga0501081_0079098 3300049743 Bacteria 2299
571 Ga0501083_0002708 3300049744 Bacteria 12226
572 Ga0501083_0007165 3300049744 Bacteria 7915
573 Ga0501035_0008809 3300049822 Bacteria 9393
574 Ga0501035_0009520 3300049822 Bacteria 9036
575 Ga0501035_0014690 3300049822 Bacteria 7228
576 Ga0501035_0061900 3300049822 Bacteria 3330
577 Ga0501035_0181928 3300049822 Bacteria 1811
578 Ga0501044_0004421 3300049823 Bacteria 15724
579 Ga0501044_0004424 3300049823 Bacteria 15719
580 Ga0501044_0012370 3300049823 Bacteria 9238
581 Ga0501044_0019888 3300049823 Bacteria 7172
582 Ga0501044_0026491 3300049823 Bacteria 6135
583 Ga0501044_0134573 3300049823 Bacteria 2464
584 Ga0501044_0207921 3300049823 Bacteria 1913
585 Ga0501045_0053188 3300049824 Bacteria 2959
586 nmdc:mga03n38_37585_c1 3300050490 Bacteria 2089
587 nmdc:mga00v17_9580_c1 3300050491 Bacteria 5248
588 Ga0500651_0000040 3300053093 Bacteria 92649
589 Ga0500621_000001 3300053126 Bacteria 1049698
590 Ga0500655_000663 3300053133 Bacteria 6825
591 Ga0500658_0000095 3300053134 Bacteria 40317
592 Ga0500658_0000122 3300053134 Bacteria 37279
593 Ga0500559_0004969 3300053136 Bacteria 6182
594 Ga0500568_0000569 3300053139 Bacteria 27012
595 Ga0500616_0025379 3300053153 Bacteria 3287
596 Ga0500634_0000248 3300053161 Bacteria 17305
597 Ga0500634_0001126 3300053161 Bacteria 9943
598 Ga0500638_049124 3300053162 Bacteria 2041
599 Ga0500645_003684 3300053730 Bacteria 6120
600 Ga0501084_0000644 3300054114 Bacteria 26555
601 Ga0501084_0007121 3300054114 Bacteria 9215
602 Ga0501084_0183251 3300054114 Bacteria 1768
603 Ga0501082_0088003 3300060353 Bacteria 2680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0018978 Ga0495621_0018978_1105_2223 316
2 3300048928 Ga0496125_0264593 Ga0496125_0264593_33_1064 325
3 3300005457 Ga0070662_100147403 Ga0070662_1001474032 343
4 3300025933 Ga0207706_10044937 Ga0207706_100449374 343
5 3300046460 Ga0495638_0030293 Ga0495638_0030293_1878_3101 343
6 3300046512 Ga0495610_0034717 Ga0495610_0034717_895_2118 343
7 3300048929 Ga0496126_0107821 Ga0496126_0107821_1169_2392 343
8 3300053093 Ga0500651_0000040 Ga0500651_0000040_32698_33921 343
9 3300053134 Ga0500658_0000095 Ga0500658_0000095_31994_33217 343
10 3300053134 Ga0500658_0000122 Ga0500658_0000122_8343_9566 343
11 3300053136 Ga0500559_0004969 Ga0500559_0004969_1044_2267 343
12 3300053139 Ga0500568_0000569 Ga0500568_0000569_21747_22970 343
13 3300053153 Ga0500616_0025379 Ga0500616_0025379_1229_2452 343
14 3300053161 Ga0500634_0001126 Ga0500634_0001126_6172_7395 343
15 3300005614 Ga0068856_100119111 Ga0068856_1001191111 344
16 3300049587 Ga0501071_0013122 Ga0501071_0013122_25_1182 344
17 3300009036 Ga0105244_10008118 Ga0105244_100081185 345
18 3300046519 Ga0495632_0064665 Ga0495632_0064665_298_1407 347
19 3300053161 Ga0500634_0000248 Ga0500634_0000248_11197_12306 347
20 3300013104 Ga0157370_10049188 Ga0157370_100491883 348
21 3300025913 Ga0207695_10052524 Ga0207695_100525242 348
22 3300049586 Ga0501070_0001521 Ga0501070_0001521_18333_19532 352
23 3300045976 Ga0466967_0182807 Ga0466967_0182807_203_1366 353
24 3300028381 Ga0268264_10002281 Ga0268264_1000228111 357
25 3300049586 Ga0501070_0050530 Ga0501070_0050530_966_2117 357
26 3300006237 Ga0097621_100250271 Ga0097621_1002502712 358
27 3300006358 Ga0068871_100002413 Ga0068871_1000024133 358
28 3300014969 Ga0157376_10126496 Ga0157376_101264962 358
29 3300025304 Ga0209257_1000136 Ga0209257_100013686 359
30 3300031250 Ga0265331_10000002 Ga0265331_1000000216 359
31 3300046525 Ga0495663_0010070 Ga0495663_0010070_90_1319 359
32 3300046558 Ga0495633_0000825 Ga0495633_0000825_1399_2628 359
33 3300048927 Ga0496124_0000020 Ga0496124_0000020_326823_328082 359
34 3300020081 Ga0206354_10893253 Ga0206354_108932532 360
35 3300046501 Ga0495607_0000687 Ga0495607_0000687_23473_24690 360
36 3300046513 Ga0495616_0004108 Ga0495616_0004108_7380_8597 360
37 3300046519 Ga0495632_0002588 Ga0495632_0002588_3961_5178 360
38 3300046665 Ga0495661_0001380 Ga0495661_0001380_4904_6121 360
39 3300047445 Ga0495677_0028923 Ga0495677_0028923_337_1554 360
40 3300001915 JGI24741J21665_1000657 JGI24741J21665_100065711 362
41 3300002773 JGI25152J39213_1000101 JGI25152J39213_10001011 362
42 3300002774 JGI25150J39212_1000588 JGI25150J39212_10005881 362
43 3300003187 JGI25151J46595_10002896 JGI25151J46595_100028967 362
44 3300003215 JGI25153J46596_10000061 JGI25153J46596_100000611 362
45 3300005336 Ga0070680_100033731 Ga0070680_1000337312 362
46 3300005458 Ga0070681_10018915 Ga0070681_100189153 362
47 3300005535 Ga0070684_100270322 Ga0070684_1002703221 362
48 3300013104 Ga0157370_10019402 Ga0157370_100194024 362
49 3300025245 Ga0207425_1000015 Ga0207425_1000015314 362
50 3300025258 Ga0209129_1000131 Ga0209129_100013111 362
51 3300025294 Ga0209025_1000002 Ga0209025_10000021212 362
52 3300025297 Ga0209758_1000003 Ga0209758_10000031219 362
53 3300049573 Ga0501037_0014932 Ga0501037_0014932_4124_5368 362
54 3300049581 Ga0501047_0020294 Ga0501047_0020294_1008_2252 362
55 3300049586 Ga0501070_0046784 Ga0501070_0046784_226_1470 362
56 3300049589 Ga0501073_0012476 Ga0501073_0012476_828_2072 362
57 3300049590 Ga0501074_0005621 Ga0501074_0005621_5582_6826 362
58 3300049742 Ga0501080_0015339 Ga0501080_0015339_1501_2745 362
59 3300049822 Ga0501035_0061900 Ga0501035_0061900_1862_3106 362
60 3300049823 Ga0501044_0004421 Ga0501044_0004421_4317_5561 362
61 3300005336 Ga0070680_100031469 Ga0070680_1000314693 363
62 3300005356 Ga0070674_100026052 Ga0070674_1000260522 363
63 3300005458 Ga0070681_10030610 Ga0070681_100306106 363
64 3300005530 Ga0070679_100002602 Ga0070679_10000260213 363
65 3300025912 Ga0207707_10002332 Ga0207707_1000233220 363
66 3300025917 Ga0207660_10022268 Ga0207660_100222683 363
67 3300025921 Ga0207652_10001311 Ga0207652_1000131124 363
68 3300001915 JGI24741J21665_1002210 JGI24741J21665_10022103 364
69 3300001979 JGI24740J21852_10005286 JGI24740J21852_100052863 364
70 3300005337 Ga0070682_100026586 Ga0070682_1000265862 364
71 3300005457 Ga0070662_100013171 Ga0070662_1000131713 364
72 3300020082 Ga0206353_11588364 Ga0206353_115883642 364
73 3300025292 Ga0209676_1016989 Ga0209676_10169891 364
74 3300025298 Ga0209050_1005760 Ga0209050_10057603 364
75 3300025904 Ga0207647_10000508 Ga0207647_1000050823 364
76 3300025909 Ga0207705_10001625 Ga0207705_100016259 364
77 3300025912 Ga0207707_10002782 Ga0207707_100027829 364
78 3300025913 Ga0207695_10038003 Ga0207695_100380032 364
79 3300025917 Ga0207660_10001207 Ga0207660_1000120713 364
80 3300025917 Ga0207660_10009422 Ga0207660_100094223 364
81 3300025919 Ga0207657_10007838 Ga0207657_100078385 364
82 3300025921 Ga0207652_10003761 Ga0207652_100037613 364
83 3300025924 Ga0207694_10029192 Ga0207694_100291922 364
84 3300025932 Ga0207690_10040705 Ga0207690_100407052 364
85 3300025933 Ga0207706_10015842 Ga0207706_100158423 364
86 3300025944 Ga0207661_10001782 Ga0207661_1000178210 364
87 3300025949 Ga0207667_10005232 Ga0207667_100052327 364
88 3300025981 Ga0207640_10078604 Ga0207640_100786042 364
89 3300026041 Ga0207639_10015615 Ga0207639_100156154 364
90 3300026067 Ga0207678_10005247 Ga0207678_100052479 364
91 3300026116 Ga0207674_10005145 Ga0207674_100051457 364
92 3300026142 Ga0207698_10106753 Ga0207698_101067532 364
93 3300037418 Ga0395900_0082427 Ga0395900_0082427_874_2160 364
94 3300038443 Ga0395901_0025130 Ga0395901_0025130_913_2199 364
95 3300038443 Ga0395901_0040362 Ga0395901_0040362_2744_4006 364
96 3300001979 JGI24740J21852_10004760 JGI24740J21852_100047606 365
97 3300005336 Ga0070680_100004644 Ga0070680_1000046445 365
98 3300005458 Ga0070681_10015132 Ga0070681_1001513211 365
99 3300005530 Ga0070679_100011486 Ga0070679_1000114866 365
100 3300005535 Ga0070684_100053401 Ga0070684_1000534013 365
101 3300005577 Ga0068857_100108164 Ga0068857_1001081642 365
102 3300025321 Ga0207656_10018950 Ga0207656_100189502 365
103 3300025912 Ga0207707_10108353 Ga0207707_101083532 365
104 3300025917 Ga0207660_10006690 Ga0207660_100066905 365
105 3300025917 Ga0207660_10151997 Ga0207660_101519972 365
106 3300025944 Ga0207661_10053672 Ga0207661_100536722 365
107 3300026078 Ga0207702_10028840 Ga0207702_100288403 365
108 3300026142 Ga0207698_10032832 Ga0207698_100328322 365
109 3300005336 Ga0070680_100003796 Ga0070680_1000037967 366
110 3300005341 Ga0070691_10000750 Ga0070691_100007506 366
111 3300005458 Ga0070681_10003236 Ga0070681_1000323613 366
112 3300005530 Ga0070679_100002570 Ga0070679_10000257011 366
113 3300005546 Ga0070696_100036418 Ga0070696_1000364182 366
114 3300005564 Ga0070664_100143319 Ga0070664_1001433192 366
115 3300005614 Ga0068856_100156189 Ga0068856_1001561892 366
116 3300005614 Ga0068856_100265172 Ga0068856_1002651722 366
117 3300005616 Ga0068852_100029880 Ga0068852_1000298802 366
118 3300009093 Ga0105240_10103869 Ga0105240_101038692 366
119 3300025909 Ga0207705_10046668 Ga0207705_100466684 366
120 3300025912 Ga0207707_10000175 Ga0207707_100001757 366
121 3300025917 Ga0207660_10000836 Ga0207660_100008368 366
122 3300025921 Ga0207652_10000135 Ga0207652_1000013554 366
123 3300026078 Ga0207702_10026433 Ga0207702_100264332 366
124 3300026078 Ga0207702_10147403 Ga0207702_101474031 366
125 3300037418 Ga0395900_0073154 Ga0395900_0073154_131_1366 366
126 3300037466 Ga0395898_0154205 Ga0395898_0154205_832_2067 366
127 3300038443 Ga0395901_0221092 Ga0395901_0221092_553_1788 366
128 3300048922 Ga0496119_0004691 Ga0496119_0004691_9523_10908 366
129 3300048923 Ga0496120_0000412 Ga0496120_0000412_17810_19195 366
130 3300049569 Ga0501032_0018319 Ga0501032_0018319_1670_2884 366
131 3300049570 Ga0501033_0004530 Ga0501033_0004530_5130_6377 366
132 3300049571 Ga0501034_0001429 Ga0501034_0001429_10507_11721 366
133 3300049571 Ga0501034_0082500 Ga0501034_0082500_1338_2639 366
134 3300049571 Ga0501034_0108244 Ga0501034_0108244_1474_2721 366
135 3300049572 Ga0501036_0061208 Ga0501036_0061208_1526_2827 366
136 3300049574 Ga0501038_0007933 Ga0501038_0007933_1870_3117 366
137 3300049579 Ga0501043_0026511 Ga0501043_0026511_3165_4412 366
138 3300049581 Ga0501047_0000768 Ga0501047_0000768_20139_21353 366
139 3300049581 Ga0501047_0054024 Ga0501047_0054024_2131_3378 366
140 3300049583 Ga0501067_0000124 Ga0501067_0000124_29214_30428 366
141 3300049583 Ga0501067_0002161 Ga0501067_0002161_1617_2918 366
142 3300049583 Ga0501067_0012879 Ga0501067_0012879_1421_2722 366
143 3300049584 Ga0501068_0004248 Ga0501068_0004248_3021_4235 366
144 3300049584 Ga0501068_0036399 Ga0501068_0036399_13_1314 366
145 3300049585 Ga0501069_0112791 Ga0501069_0112791_164_1411 366
146 3300049586 Ga0501070_0002921 Ga0501070_0002921_3863_5077 366
147 3300049586 Ga0501070_0012510 Ga0501070_0012510_1979_3280 366
148 3300049586 Ga0501070_0017963 Ga0501070_0017963_4604_5905 366
149 3300049587 Ga0501071_0002292 Ga0501071_0002292_10189_11490 366
150 3300049588 Ga0501072_0000129 Ga0501072_0000129_49351_50565 366
151 3300049589 Ga0501073_0001873 Ga0501073_0001873_13827_15041 366
152 3300049741 Ga0501079_0010713 Ga0501079_0010713_4221_5435 366
153 3300049742 Ga0501080_0003577 Ga0501080_0003577_10269_11570 366
154 3300049742 Ga0501080_0005039 Ga0501080_0005039_24_1238 366
155 3300049743 Ga0501081_0079098 Ga0501081_0079098_428_1729 366
156 3300049744 Ga0501083_0002708 Ga0501083_0002708_6587_7801 366
157 3300049744 Ga0501083_0007165 Ga0501083_0007165_6091_7392 366
158 3300049822 Ga0501035_0014690 Ga0501035_0014690_5105_6352 366
159 3300049822 Ga0501035_0181928 Ga0501035_0181928_614_1792 366
160 3300049823 Ga0501044_0012370 Ga0501044_0012370_7910_9124 366
161 3300049823 Ga0501044_0207921 Ga0501044_0207921_133_1296 366
162 3300054114 Ga0501084_0000644 Ga0501084_0000644_14318_15565 366
163 3300054114 Ga0501084_0007121 Ga0501084_0007121_7798_9099 366
164 3300054114 Ga0501084_0183251 Ga0501084_0183251_366_1580 366
165 3300005617 Ga0068859_100113393 Ga0068859_1001133932 367
166 3300006931 Ga0097620_100113399 Ga0097620_1001133992 367
167 3300005336 Ga0070680_100007196 Ga0070680_1000071964 368
168 3300005347 Ga0070668_100147812 Ga0070668_1001478122 368
169 3300005458 Ga0070681_10039868 Ga0070681_100398682 368
170 3300005459 Ga0068867_100000267 Ga0068867_10000026724 368
171 3300005530 Ga0070679_100008470 Ga0070679_1000084704 368
172 3300005543 Ga0070672_100005456 Ga0070672_1000054566 368
173 3300005718 Ga0068866_10027651 Ga0068866_100276513 368
174 3300005719 Ga0068861_100017541 Ga0068861_1000175414 368
175 3300005843 Ga0068860_100000833 Ga0068860_10000083310 368
176 3300006048 Ga0075363_100063964 Ga0075363_1000639642 368
177 3300006881 Ga0068865_100027627 Ga0068865_1000276272 368
178 3300009148 Ga0105243_10048053 Ga0105243_100480533 368
179 3300013297 Ga0157378_10006582 Ga0157378_100065823 368
180 3300013306 Ga0163162_10004915 Ga0163162_100049157 368
181 3300014326 Ga0157380_10003797 Ga0157380_1000379713 368
182 3300025912 Ga0207707_10006938 Ga0207707_100069388 368
183 3300025917 Ga0207660_10068999 Ga0207660_100689992 368
184 3300025921 Ga0207652_10025427 Ga0207652_100254274 368
185 3300025923 Ga0207681_10048204 Ga0207681_100482043 368
186 3300025940 Ga0207691_10021612 Ga0207691_100216123 368
187 3300026089 Ga0207648_10000585 Ga0207648_1000058532 368
188 3300026118 Ga0207675_100001560 Ga0207675_10000156010 368
189 3300028381 Ga0268264_10004408 Ga0268264_100044084 368
190 3300046474 Ga0495605_0003254 Ga0495605_0003254_4593_5810 368
191 3300048091 Ga0495626_0004283 Ga0495626_0004283_7458_8675 368
192 3300049581 Ga0501047_0002430 Ga0501047_0002430_15066_16319 368
193 3300049586 Ga0501070_0015787 Ga0501070_0015787_3344_4597 368
194 3300049590 Ga0501074_0049268 Ga0501074_0049268_923_2176 368
195 3300049742 Ga0501080_0004738 Ga0501080_0004738_10762_12015 368
196 3300050490 nmdc:mga03n38_37585_c1 nmdc:mga03n38_37585_c1_457_1683 368
197 3300060353 Ga0501082_0088003 Ga0501082_0088003_1323_2576 368
198 3300005985 Ga0081539_10000037 Ga0081539_10000037236 369
199 3300025919 Ga0207657_10037568 Ga0207657_100375684 369
200 3300046474 Ga0495605_0055313 Ga0495605_0055313_704_1903 369
201 3300046557 Ga0495622_0026559 Ga0495622_0026559_724_1947 369
202 3300048919 Ga0496116_0000505 Ga0496116_0000505_24537_25736 369
203 3300048922 Ga0496119_0001796 Ga0496119_0001796_2082_3281 369
204 3300048923 Ga0496120_0000043 Ga0496120_0000043_192296_193495 369
205 3300005366 Ga0070659_100059948 Ga0070659_1000599482 370
206 3300005539 Ga0068853_100005356 Ga0068853_1000053564 370
207 3300005563 Ga0068855_100054069 Ga0068855_1000540692 370
208 3300009551 Ga0105238_10008662 Ga0105238_100086622 370
209 3300013100 Ga0157373_10004475 Ga0157373_100044753 370
210 3300013102 Ga0157371_10022278 Ga0157371_100222783 370
211 3300013104 Ga0157370_10033441 Ga0157370_100334411 370
212 3300013307 Ga0157372_10013697 Ga0157372_100136972 370
213 3300025932 Ga0207690_10077797 Ga0207690_100777972 370
214 3300025949 Ga0207667_10214204 Ga0207667_102142042 370
215 3300026041 Ga0207639_10096067 Ga0207639_100960671 370
216 3300049570 Ga0501033_0127394 Ga0501033_0127394_511_1776 370
217 3300049572 Ga0501036_0016372 Ga0501036_0016372_1204_2469 370
218 3300049741 Ga0501079_0005850 Ga0501079_0005850_3356_4690 370
219 iso_pu_bacteria 2842757796 2842760183 370
220 3300005336 Ga0070680_100000962 Ga0070680_1000009625 371
221 3300005339 Ga0070660_100038796 Ga0070660_1000387962 371
222 3300005455 Ga0070663_100069803 Ga0070663_1000698032 371
223 3300005458 Ga0070681_10019170 Ga0070681_100191707 371
224 3300005530 Ga0070679_100006621 Ga0070679_10000662110 371
225 3300049593 Ga0501077_0110012 Ga0501077_0110012_260_1537 371
226 3300049823 Ga0501044_0134573 Ga0501044_0134573_125_1411 371
227 iso_pu_bacteria 2687453257 2688065888 371
228 iso_pu_bacteria 2928959182 2928962847 371
229 3300005455 Ga0070663_100084348 Ga0070663_1000843482 372
230 3300005563 Ga0068855_100201315 Ga0068855_1002013152 372
231 3300005577 Ga0068857_100205315 Ga0068857_1002053152 372
232 3300005578 Ga0068854_100002882 Ga0068854_1000028827 372
233 3300005616 Ga0068852_100027673 Ga0068852_1000276734 372
234 3300009093 Ga0105240_10356307 Ga0105240_103563072 372
235 3300013307 Ga0157372_10133357 Ga0157372_101333573 372
236 3300025909 Ga0207705_10000177 Ga0207705_100001779 372
237 3300025913 Ga0207695_10009944 Ga0207695_100099449 372
238 3300025919 Ga0207657_10005463 Ga0207657_100054639 372
239 3300025920 Ga0207649_10006777 Ga0207649_100067772 372
240 3300025932 Ga0207690_10008753 Ga0207690_100087533 372
241 3300025949 Ga0207667_10010906 Ga0207667_100109069 372
242 3300025981 Ga0207640_10003713 Ga0207640_100037136 372
243 3300026041 Ga0207639_10003942 Ga0207639_100039422 372
244 3300026067 Ga0207678_10003349 Ga0207678_1000334910 372
245 3300026142 Ga0207698_10031957 Ga0207698_100319572 372
246 3300046522 Ga0495643_0003136 Ga0495643_0003136_10134_11351 372
247 3300048091 Ga0495626_0008388 Ga0495626_0008388_3735_4952 372
248 3300048091 Ga0495626_0013152 Ga0495626_0013152_352_1569 372
249 3300048091 Ga0495626_0037663 Ga0495626_0037663_728_1945 372
250 3300053730 Ga0500645_003684 Ga0500645_003684_4845_6062 372
251 iso_pu_bacteria 2928100450 2928103925 372
252 iso_pu_bacteria 2958512119 2958513362 372
253 3300005336 Ga0070680_100014393 Ga0070680_1000143933 373
254 3300005455 Ga0070663_100188985 Ga0070663_1001889851 373
255 3300005539 Ga0068853_100002122 Ga0068853_10000212216 373
256 3300005563 Ga0068855_100057270 Ga0068855_1000572702 373
257 3300005563 Ga0068855_100092995 Ga0068855_10009299510 373
258 3300005578 Ga0068854_100031873 Ga0068854_1000318732 373
259 3300005616 Ga0068852_100255563 Ga0068852_1002555631 373
260 3300009093 Ga0105240_10133525 Ga0105240_101335252 373
261 3300009093 Ga0105240_10175591 Ga0105240_101755912 373
262 3300009094 Ga0111539_10023624 Ga0111539_100236241 373
263 3300013100 Ga0157373_10022121 Ga0157373_100221214 373
264 3300013104 Ga0157370_10015593 Ga0157370_100155937 373
265 3300013307 Ga0157372_10084778 Ga0157372_100847782 373
266 3300013307 Ga0157372_10279505 Ga0157372_102795052 373
267 3300025912 Ga0207707_10000057 Ga0207707_1000005747 373
268 3300025919 Ga0207657_10104775 Ga0207657_101047752 373
269 3300025921 Ga0207652_10000503 Ga0207652_1000050334 373
270 3300026067 Ga0207678_10003994 Ga0207678_100039947 373
271 3300026078 Ga0207702_10242008 Ga0207702_102420082 373
272 3300038705 Ga0237819_00007 Ga0237819_00007_8957_10192 373
273 3300039447 Ga0436361_0210437 Ga0436361_0210437_712_1926 373
274 3300049585 Ga0501069_0000307 Ga0501069_0000307_15852_17123 373
275 iso_pu_bacteria 2847085930 2847088699 373
276 iso_pu_bacteria 2852684882 2852686791 373
277 iso_pu_bacteria 2889415604 2889417540 373
278 3300005329 Ga0070683_100212661 Ga0070683_1002126612 374
279 3300005336 Ga0070680_100080840 Ga0070680_1000808402 374
280 3300005341 Ga0070691_10008594 Ga0070691_100085942 374
281 3300005344 Ga0070661_100014266 Ga0070661_1000142662 374
282 3300005345 Ga0070692_10018391 Ga0070692_100183912 374
283 3300005455 Ga0070663_100034632 Ga0070663_1000346322 374
284 3300009545 Ga0105237_10053378 Ga0105237_100533782 374
285 3300009553 Ga0105249_10013582 Ga0105249_100135828 374
286 3300013102 Ga0157371_10068650 Ga0157371_100686502 374
287 3300013105 Ga0157369_10031962 Ga0157369_100319626 374
288 3300025944 Ga0207661_10082188 Ga0207661_100821884 374
289 3300049569 Ga0501032_0043548 Ga0501032_0043548_1753_3027 374
290 3300049572 Ga0501036_0018005 Ga0501036_0018005_503_1837 374
291 3300049586 Ga0501070_0097373 Ga0501070_0097373_283_1617 374
292 3300049586 Ga0501070_0219529 Ga0501070_0219529_160_1410 374
293 3300049824 Ga0501045_0053188 Ga0501045_0053188_1299_2573 374
294 iso_pu_bacteria 2919130084 2919134013 374
295 iso_pu_bacteria 2923634449 2923638349 374
296 iso_pu_bacteria 2929195423 2929196663 374
297 iso_pu_bacteria 8021622325 8021625143 374
298 iso_pu_bacteria 8021626552 8021629458 374
299 iso_pu_bacteria 8021648035 8021650550 374
300 3300003856 Ga0058692_1000033 Ga0058692_100003352 375
301 3300005327 Ga0070658_10186952 Ga0070658_101869522 375
302 3300005329 Ga0070683_100003087 Ga0070683_1000030876 375
303 3300005331 Ga0070670_100000851 Ga0070670_1000008512 375
304 3300009011 Ga0105251_10000076 Ga0105251_1000007674 375
305 3300009093 Ga0105240_10028320 Ga0105240_100283205 375
306 3300009093 Ga0105240_10050711 Ga0105240_100507115 375
307 3300010375 Ga0105239_10030044 Ga0105239_100300443 375
308 3300013104 Ga0157370_10003679 Ga0157370_1000367911 375
309 3300013104 Ga0157370_10024713 Ga0157370_100247137 375
310 3300013307 Ga0157372_10009910 Ga0157372_100099107 375
311 3300015261 Ga0182006_1023556 Ga0182006_10235562 375
312 3300025735 Ga0207713_1000578 Ga0207713_10005784 375
313 3300025912 Ga0207707_10034750 Ga0207707_100347502 375
314 3300025920 Ga0207649_10000743 Ga0207649_1000074319 375
315 3300025921 Ga0207652_10003488 Ga0207652_100034885 375
316 3300025944 Ga0207661_10099176 Ga0207661_100991763 375
317 3300027312 Ga0209371_1000088 Ga0209371_100008884 375
318 3300030500 Ga0268256_1000079 Ga0268256_100007953 375
319 3300031711 Ga0265314_10029904 Ga0265314_100299044 375
320 3300048905 Ga0496102_0026746 Ga0496102_0026746_1100_2602 375
321 3300048906 Ga0496103_0031541 Ga0496103_0031541_925_2427 375
322 3300048920 Ga0496117_0000090 Ga0496117_0000090_95932_97434 375
323 3300048920 Ga0496117_0003432 Ga0496117_0003432_6426_7640 375
324 3300048921 Ga0496118_0000032 Ga0496118_0000032_107603_109105 375
325 3300048921 Ga0496118_0022885 Ga0496118_0022885_1506_2720 375
326 3300048922 Ga0496119_0001141 Ga0496119_0001141_3180_4394 375
327 3300048922 Ga0496119_0015373 Ga0496119_0015373_3619_4998 375
328 3300048923 Ga0496120_0000557 Ga0496120_0000557_28925_30139 375
329 3300048924 Ga0496121_0071071 Ga0496121_0071071_487_1989 375
330 3300048925 Ga0496122_0001575 Ga0496122_0001575_5767_6981 375
331 3300048926 Ga0496123_0001260 Ga0496123_0001260_6054_7268 375
332 3300048927 Ga0496124_0012736 Ga0496124_0012736_2932_4434 375
333 iso_pu_bacteria 2818991457 2819660915 375
334 iso_pu_bacteria 2932422444 2932424339 375
335 2162886007 SwRhRL2b_contig_91143 SwRhRL2b_0480.00005020 376
336 3300005289 Ga0065704_10070381 Ga0065704_1007038131 376
337 3300005289 Ga0065704_10071710 Ga0065704_100717106 376
338 3300005336 Ga0070680_100017699 Ga0070680_1000176992 376
339 3300005337 Ga0070682_100002329 Ga0070682_1000023297 376
340 3300005339 Ga0070660_100015944 Ga0070660_1000159446 376
341 3300005347 Ga0070668_100057885 Ga0070668_1000578852 376
342 3300005353 Ga0070669_100059868 Ga0070669_1000598682 376
343 3300005366 Ga0070659_100004889 Ga0070659_1000048898 376
344 3300005367 Ga0070667_100001622 Ga0070667_1000016225 376
345 3300005455 Ga0070663_100151453 Ga0070663_1001514532 376
346 3300005458 Ga0070681_10042958 Ga0070681_100429581 376
347 3300005530 Ga0070679_100054701 Ga0070679_1000547012 376
348 3300005546 Ga0070696_100070345 Ga0070696_1000703451 376
349 3300005617 Ga0068859_100052163 Ga0068859_1000521635 376
350 3300005843 Ga0068860_100104603 Ga0068860_1001046032 376
351 3300006931 Ga0097620_100052163 Ga0097620_1000521635 376
352 3300009092 Ga0105250_10015255 Ga0105250_100152553 376
353 3300013102 Ga0157371_10103473 Ga0157371_101034732 376
354 3300013306 Ga0163162_10013691 Ga0163162_100136919 376
355 3300025711 Ga0207696_1005968 Ga0207696_10059686 376
356 3300025912 Ga0207707_10000349 Ga0207707_1000034918 376
357 3300025912 Ga0207707_10030289 Ga0207707_100302895 376
358 3300025912 Ga0207707_10057247 Ga0207707_100572472 376
359 3300025917 Ga0207660_10007728 Ga0207660_100077284 376
360 3300025921 Ga0207652_10001242 Ga0207652_1000124219 376
361 3300025921 Ga0207652_10202728 Ga0207652_102027282 376
362 3300025923 Ga0207681_10016590 Ga0207681_100165902 376
363 3300025932 Ga0207690_10003296 Ga0207690_100032966 376
364 3300025972 Ga0207668_10012339 Ga0207668_100123395 376
365 3300025986 Ga0207658_10014530 Ga0207658_100145303 376
366 3300028380 Ga0268265_10024164 Ga0268265_100241643 376
367 3300028381 Ga0268264_10134813 Ga0268264_101348132 376
368 3300047472 Ga0495686_0000739 Ga0495686_0000739_34801_36039 376
369 3300048903 Ga0496100_0001210 Ga0496100_0001210_9693_10898 376
370 3300048905 Ga0496102_0000562 Ga0496102_0000562_16130_17335 376
371 3300048906 Ga0496103_0000161 Ga0496103_0000161_21816_23021 376
372 3300048907 Ga0496104_0000204 Ga0496104_0000204_22251_23456 376
373 3300048908 Ga0496105_0000047 Ga0496105_0000047_74018_75223 376
374 3300048910 Ga0496107_0017459 Ga0496107_0017459_3005_4210 376
375 3300048915 Ga0496112_0004094 Ga0496112_0004094_829_2034 376
376 3300048916 Ga0496113_0000067 Ga0496113_0000067_22001_23206 376
377 3300048919 Ga0496116_0006422 Ga0496116_0006422_4895_6127 376
378 3300048919 Ga0496116_0023605 Ga0496116_0023605_2012_3217 376
379 3300048920 Ga0496117_0002345 Ga0496117_0002345_16846_18051 376
380 3300048921 Ga0496118_0025196 Ga0496118_0025196_863_2068 376
381 3300048922 Ga0496119_0000467 Ga0496119_0000467_43958_45163 376
382 3300048923 Ga0496120_0000639 Ga0496120_0000639_5056_6261 376
383 3300048925 Ga0496122_0000233 Ga0496122_0000233_80086_81291 376
384 3300048926 Ga0496123_0000769 Ga0496123_0000769_33160_34365 376
385 3300048927 Ga0496124_0001445 Ga0496124_0001445_8082_9329 376
386 3300048927 Ga0496124_0009593 Ga0496124_0009593_5422_6627 376
387 3300048928 Ga0496125_0001010 Ga0496125_0001010_36955_38160 376
388 3300048929 Ga0496126_0000028 Ga0496126_0000028_370134_371339 376
389 3300049570 Ga0501033_0046415 Ga0501033_0046415_898_2175 376
390 3300049586 Ga0501070_0000062 Ga0501070_0000062_24865_26112 376
391 3300049586 Ga0501070_0025012 Ga0501070_0025012_1105_2382 376
392 3300049589 Ga0501073_0049657 Ga0501073_0049657_1283_2560 376
393 3300049592 Ga0501076_0015853 Ga0501076_0015853_4279_5613 376
394 3300049593 Ga0501077_0053741 Ga0501077_0053741_44_1300 376
395 3300049823 Ga0501044_0019888 Ga0501044_0019888_4539_5816 376
396 3300049823 Ga0501044_0026491 Ga0501044_0026491_3171_4505 376
397 iso_pu_bacteria 2858688981 2858696343 376
398 iso_pu_bacteria 2891670763 2891674945 376
399 iso_pu_bacteria 2939602548 2939603008 376
400 iso_pu_bacteria 8054844752 8054847326 376
401 iso_pu_bacteria 8054849141 8054854191 376
402 3300039447 Ga0436361_1124212 Ga0436361_1124212_397_1611 377
403 3300049581 Ga0501047_0000070 Ga0501047_0000070_117169_118380 377
404 iso_pu_bacteria 2547132181 2547694251 377
405 iso_pu_bacteria 2561511199 2562466322 377
406 iso_pu_bacteria 2600255256 2601531786 377
407 iso_pu_bacteria 2600255257 2601537158 377
408 iso_pu_bacteria 2600255310 2601755504 377
409 iso_pu_bacteria 2600255311 2601760871 377
410 iso_pu_bacteria 2602042046 2603639085 377
411 iso_pu_bacteria 2738543013 2739251328 377
412 iso_pu_bacteria 2791355010 2792313746 377
413 iso_pu_bacteria 2811995292 2813730131 377
414 iso_pu_bacteria 2814123068 2814697710 377
415 iso_pu_bacteria 2939607340 2939610766 377
416 iso_pu_bacteria 8055087960 8055091217 377
417 iso_pu_bacteria 8055092621 8055096522 377
418 iso_pu_bacteria 8055097453 8055101322 377
419 3300001915 JGI24741J21665_1001198 JGI24741J21665_10011984 378
420 3300026041 Ga0207639_10021668 Ga0207639_100216682 378
421 3300035114 Ga0373939_0000006 Ga0373939_0000006_25945_27165 378
422 3300035121 Ga0373960_0009144 Ga0373960_0009144_286_1506 378
423 3300046458 Ga0495591_009820 Ga0495591_009820_2491_3693 378
424 3300046471 Ga0495650_0000033 Ga0495650_0000033_251987_253189 378
425 3300046491 Ga0495584_0007520 Ga0495584_0007520_46_1248 378
426 3300046507 Ga0495606_0000627 Ga0495606_0000627_27420_28622 378
427 3300046523 Ga0495644_0000325 Ga0495644_0000325_1821_3023 378
428 3300046524 Ga0495648_0006866 Ga0495648_0006866_2560_3762 378
429 3300046530 Ga0495654_0000020 Ga0495654_0000020_153710_154912 378
430 3300046694 Ga0495649_0008607 Ga0495649_0008607_3512_4714 378
431 3300046810 Ga0495660_0000011 Ga0495660_0000011_122946_124148 378
432 3300047320 Ga0495672_0000004 Ga0495672_0000004_412511_413713 378
433 3300047323 Ga0495683_0025654 Ga0495683_0025654_567_1769 378
434 3300047469 Ga0495673_0000023 Ga0495673_0000023_365686_366888 378
435 3300049460 Ga0495682_0000004 Ga0495682_0000004_160025_161227 378
436 3300049581 Ga0501047_0025174 Ga0501047_0025174_1170_2456 378
437 3300049585 Ga0501069_0031062 Ga0501069_0031062_190_1476 378
438 3300049586 Ga0501070_0012091 Ga0501070_0012091_2666_3952 378
439 3300049589 Ga0501073_0087363 Ga0501073_0087363_663_1949 378
440 3300049590 Ga0501074_0001914 Ga0501074_0001914_10355_11641 378
441 3300049742 Ga0501080_0037325 Ga0501080_0037325_44_1330 378
442 3300049822 Ga0501035_0009520 Ga0501035_0009520_3702_4988 378
443 3300049823 Ga0501044_0004424 Ga0501044_0004424_11828_13114 378
444 3300053126 Ga0500621_000001 Ga0500621_000001_218025_219227 378
445 iso_pu_bacteria 2711768156 2712472758 378
446 iso_pu_bacteria 2919108558 2919109796 378
447 iso_pu_bacteria 3000376612 3000380124 378
448 iso_pu_bacteria 644736347 644746367 378
449 3300003781 Ga0055536_1022130 Ga0055536_10221301 379
450 3300003784 Ga0055534_1000455 Ga0055534_100045521 379
451 3300025291 Ga0209675_1000948 Ga0209675_100094811 379
452 3300025292 Ga0209676_1009694 Ga0209676_10096944 379
453 3300025294 Ga0209025_1034180 Ga0209025_10341802 379
454 3300037853 Ga0436364_1484100 Ga0436364_1484100_486_1724 379
455 3300047472 Ga0495686_0147719 Ga0495686_0147719_43_1275 379
456 3300049568 Ga0501031_0064948 Ga0501031_0064948_895_2145 379
457 3300049569 Ga0501032_0000556 Ga0501032_0000556_28866_30116 379
458 3300049573 Ga0501037_0028985 Ga0501037_0028985_137_1387 379
459 3300049574 Ga0501038_0000102 Ga0501038_0000102_341_1591 379
460 3300049576 Ga0501040_0205576 Ga0501040_0205576_42_1292 379
461 3300049579 Ga0501043_0032780 Ga0501043_0032780_2702_3952 379
462 3300049581 Ga0501047_0020236 Ga0501047_0020236_154_1404 379
463 3300049589 Ga0501073_0000691 Ga0501073_0000691_22190_23440 379
464 3300049742 Ga0501080_0208783 Ga0501080_0208783_131_1381 379
465 3300049822 Ga0501035_0008809 Ga0501035_0008809_7081_8331 379
466 iso_pu_bacteria 2547132416 2548648861 379
467 iso_pu_bacteria 2602042067 2603704126 379
468 iso_pu_bacteria 2671180115 2671588079 379
469 iso_pu_bacteria 2681812866 2681995888 379
470 iso_pu_bacteria 2681812869 2682008906 379
471 iso_pu_bacteria 2751185917 2753854934 379
472 iso_pu_bacteria 2765235842 2765587800 379
473 iso_pu_bacteria 2775506706 2775541800 379
474 iso_pu_bacteria 2821118458 2821118713 379
475 iso_pu_bacteria 2823373977 2823377084 379
476 iso_pu_bacteria 2927833300 2927835207 379
477 iso_pu_bacteria 2974310843 2974313267 379
478 iso_pu_bacteria 8018405270 8018405854 379
479 3300003856 Ga0058692_1005450 Ga0058692_10054502 380
480 3300009011 Ga0105251_10001816 Ga0105251_1000181615 380
481 3300009036 Ga0105244_10003210 Ga0105244_1000321010 380
482 3300009092 Ga0105250_10002818 Ga0105250_100028182 380
483 3300025711 Ga0207696_1000517 Ga0207696_10005172 380
484 3300025728 Ga0207655_1013562 Ga0207655_10135622 380
485 3300025728 Ga0207655_1013666 Ga0207655_10136662 380
486 3300027312 Ga0209371_1001062 Ga0209371_10010623 380
487 3300027312 Ga0209371_1009374 Ga0209371_10093742 380
488 3300028800 Ga0265338_10000092 Ga0265338_1000009277 380
489 3300030500 Ga0268256_1000894 Ga0268256_100089415 380
490 3300030500 Ga0268256_1009927 Ga0268256_10099272 380
491 3300046542 Ga0495597_0000129 Ga0495597_0000129_55768_56976 380
492 3300046660 Ga0495625_0003123 Ga0495625_0003123_5530_6738 380
493 3300047320 Ga0495672_0000027 Ga0495672_0000027_136792_138000 380
494 3300047446 Ga0495679_000019 Ga0495679_000019_95029_96237 380
495 3300053133 Ga0500655_000663 Ga0500655_000663_808_2031 380
496 3300053162 Ga0500638_049124 Ga0500638_049124_317_1540 380
497 iso_pu_bacteria 2554235234 2555259373 380
498 iso_pu_bacteria 2599185169 2599411958 380
499 iso_pu_bacteria 2600255254 2601525136 380
500 iso_pu_bacteria 2600255255 2601530323 380
501 iso_pu_bacteria 2600255280 2601617073 380
502 iso_pu_bacteria 2600255281 2601621580 380
503 iso_pu_bacteria 2600255287 2601645008 380
504 iso_pu_bacteria 2600255288 2601650696 380
505 iso_pu_bacteria 2600255289 2601654904 380
506 iso_pu_bacteria 2600255290 2601660429 380
507 iso_pu_bacteria 2600255291 2601665021 380
508 iso_pu_bacteria 2600255298 2601697637 380
509 iso_pu_bacteria 2600255299 2601703025 380
510 iso_pu_bacteria 2600255300 2601708277 380
511 iso_pu_bacteria 2600255301 2601713370 380
512 iso_pu_bacteria 2600255302 2601718463 380
513 iso_pu_bacteria 2600255303 2601723186 380
514 iso_pu_bacteria 2600255304 2601728304 380
515 iso_pu_bacteria 2600255305 2601733411 380
516 iso_pu_bacteria 2600255306 2601738288 380
517 iso_pu_bacteria 2600255307 2601742412 380
518 iso_pu_bacteria 2600255309 2601753626 380
519 iso_pu_bacteria 2600255392 2602019987 380
520 iso_pu_bacteria 2602042052 2603661817 380
521 iso_pu_bacteria 2602042053 2603666715 380
522 iso_pu_bacteria 2602042066 2603700137 380
523 iso_pu_bacteria 2602042103 2603840522 380
524 iso_pu_bacteria 2602042104 2603845815 380
525 iso_pu_bacteria 2602042105 2603850888 380
526 iso_pu_bacteria 2602042106 2603855739 380
527 iso_pu_bacteria 2602042109 2603866273 380
528 iso_pu_bacteria 2602042110 2603873321 380
529 iso_pu_bacteria 2602042111 2603877630 380
530 iso_pu_bacteria 2603880178 2606050717 380
531 iso_pu_bacteria 2603880184 2606071147 380
532 iso_pu_bacteria 2603880202 2606148401 380
533 iso_pu_bacteria 2603880211 2606178390 380
534 iso_pu_bacteria 2636415599 2637226705 380
535 iso_pu_bacteria 2675903046 2676407143 380
536 iso_pu_bacteria 2775507074 2777022430 380
537 iso_pu_bacteria 2791355275 2793406522 380
538 iso_pu_bacteria 2834641062 2834644004 380
539 iso_pu_bacteria 2844425489 2844426487 380
540 iso_pu_bacteria 2884086401 2884090013 380
541 iso_pu_bacteria 2904513164 2904514971 380
542 iso_pu_bacteria 2937539931 2937542913 380
543 iso_pu_bacteria 2939568625 2939570691 380
544 iso_pu_bacteria 2939573065 2939574865 380
545 iso_pu_bacteria 2939642701 2939644797 380
546 iso_pu_bacteria 2969079654 2969083688 380
547 iso_pu_bacteria 2971820967 2971825154 380
548 iso_pu_bacteria 2984559226 2984560789 380
549 iso_pu_bacteria 2984595703 2984598865 380
550 iso_pu_bacteria 8003400568 8003404958 380
551 iso_pu_bacteria 8018221730 8018224244 380
552 iso_pu_bacteria 8057304971 8057306226 380
553 3300005331 Ga0070670_100004348 Ga0070670_10000434814 381
554 3300005354 Ga0070675_100024992 Ga0070675_1000249922 381
555 3300005456 Ga0070678_100003872 Ga0070678_1000038725 381
556 3300005543 Ga0070672_100059128 Ga0070672_1000591283 381
557 3300005548 Ga0070665_100157195 Ga0070665_1001571952 381
558 3300005841 Ga0068863_100096633 Ga0068863_1000966333 381
559 3300006237 Ga0097621_100016075 Ga0097621_1000160752 381
560 3300006358 Ga0068871_100053924 Ga0068871_1000539242 381
561 3300025926 Ga0207659_10137877 Ga0207659_101378772 381
562 3300025940 Ga0207691_10000612 Ga0207691_1000061233 381
563 3300025961 Ga0207712_10012025 Ga0207712_100120252 381
564 3300025986 Ga0207658_10090570 Ga0207658_100905703 381
565 3300026121 Ga0207683_10045407 Ga0207683_100454074 381
566 3300027312 Ga0209371_1000227 Ga0209371_100022778 381
567 3300028379 Ga0268266_10015839 Ga0268266_100158396 381
568 3300028380 Ga0268265_10125621 Ga0268265_101256211 381
569 3300030500 Ga0268256_1000017 Ga0268256_1000017335 381
570 3300030500 Ga0268256_1004438 Ga0268256_10044381 381
571 3300041405 Ga0439438_002067 Ga0439438_002067_2091_3296 381
572 3300048903 Ga0496100_0098896 Ga0496100_0098896_752_1957 381
573 3300049569 Ga0501032_0025306 Ga0501032_0025306_830_2113 381
574 3300049570 Ga0501033_0075755 Ga0501033_0075755_285_1550 381
575 3300049571 Ga0501034_0033378 Ga0501034_0033378_173_1438 381
576 3300049572 Ga0501036_0010147 Ga0501036_0010147_221_1486 381
577 3300049580 Ga0501046_0005371 Ga0501046_0005371_161_1426 381
578 3300049580 Ga0501046_0047222 Ga0501046_0047222_1304_2587 381
579 3300049573 Ga0501037_0118994 Ga0501037_0118994_368_1651 382
580 3300003856 Ga0058692_1012726 Ga0058692_10127262 383
581 3300003856 Ga0058692_1014700 Ga0058692_10147002 383
582 3300009036 Ga0105244_10038249 Ga0105244_100382492 383
583 3300015679 Ga0183366_1001 Ga0183366_1001234 383
584 3300015680 Ga0183370_1001 Ga0183370_1001234 383
585 3300015685 Ga0183369_1001 Ga0183369_1001234 383
586 3300015687 Ga0183368_1001 Ga0183368_1001234 383
587 3300025735 Ga0207713_1002815 Ga0207713_10028151 383
588 3300025735 Ga0207713_1055453 Ga0207713_10554531 383
589 3300025913 Ga0207695_10193759 Ga0207695_101937592 383
590 3300027111 Ga0209281_1000079 Ga0209281_100007962 383
591 3300027312 Ga0209371_1000001 Ga0209371_1000001191 383
592 3300027312 Ga0209371_1001115 Ga0209371_10011155 383
593 3300030500 Ga0268256_1000001 Ga0268256_10000012450 383
594 3300030500 Ga0268256_1000824 Ga0268256_10008247 383
595 3300044669 Ga0466981_0000006 Ga0466981_0000006_98029_99237 383
596 3300048907 Ga0496104_0000163 Ga0496104_0000163_6194_7402 383
597 3300048908 Ga0496105_0029432 Ga0496105_0029432_2588_3796 383
598 3300048922 Ga0496119_0019264 Ga0496119_0019264_1071_2279 383
599 3300048922 Ga0496119_0070866 Ga0496119_0070866_201_1421 383
600 3300048923 Ga0496120_0014343 Ga0496120_0014343_2851_4059 383
601 3300048923 Ga0496120_0075236 Ga0496120_0075236_159_1367 383
602 3300048924 Ga0496121_0003443 Ga0496121_0003443_5446_6654 383
603 3300048927 Ga0496124_0005340 Ga0496124_0005340_2445_3653 383
604 3300048928 Ga0496125_0012188 Ga0496125_0012188_3460_4668 383
605 3300048928 Ga0496125_0018969 Ga0496125_0018969_3325_4533 383
606 3300048928 Ga0496125_0035711 Ga0496125_0035711_2841_4049 383
607 3300048929 Ga0496126_0002177 Ga0496126_0002177_6101_7321 383
608 3300048929 Ga0496126_0009165 Ga0496126_0009165_8668_9876 383
609 3300048929 Ga0496126_0202711 Ga0496126_0202711_308_1516 383
610 iso_pu_bacteria 2791354903 2791924614 383
611 2162886007 SwRhRL2b_contig_538696 SwRhRL2b_0184.00002440 384
612 3300005289 Ga0065704_10000433 Ga0065704_1000043322 384
613 3300005289 Ga0065704_10000665 Ga0065704_1000066514 384
614 3300005289 Ga0065704_10001659 Ga0065704_100016592 384
615 3300005548 Ga0070665_100000203 Ga0070665_10000020395 384
616 3300005577 Ga0068857_100000003 Ga0068857_10000000380 384
617 3300006051 Ga0075364_10015162 Ga0075364_100151622 384
618 3300006051 Ga0075364_10024053 Ga0075364_100240532 384
619 3300006946 Ga0079104_1000248 Ga0079104_100024865 384
620 3300006946 Ga0079104_1000824 Ga0079104_100082419 384
621 3300006946 Ga0079104_1001251 Ga0079104_100125116 384
622 3300006946 Ga0079104_1002062 Ga0079104_10020624 384
623 3300006946 Ga0079104_1002064 Ga0079104_10020644 384
624 3300006946 Ga0079104_1003837 Ga0079104_10038372 384
625 3300006946 Ga0079104_1006583 Ga0079104_10065832 384
626 3300009011 Ga0105251_10000812 Ga0105251_1000081218 384
627 3300009011 Ga0105251_10000983 Ga0105251_100009839 384
628 3300009011 Ga0105251_10016286 Ga0105251_100162862 384
629 3300009011 Ga0105251_10020013 Ga0105251_100200133 384
630 3300009036 Ga0105244_10000087 Ga0105244_1000008731 384
631 3300009036 Ga0105244_10000298 Ga0105244_1000029821 384
632 3300009036 Ga0105244_10000858 Ga0105244_100008586 384
633 3300009036 Ga0105244_10009750 Ga0105244_100097501 384
634 3300009092 Ga0105250_10000025 Ga0105250_10000025102 384
635 3300009092 Ga0105250_10000044 Ga0105250_1000004447 384
636 3300009092 Ga0105250_10006892 Ga0105250_100068923 384
637 3300009148 Ga0105243_10002042 Ga0105243_100020422 384
638 3300009148 Ga0105243_10049212 Ga0105243_100492122 384
639 3300013100 Ga0157373_10032466 Ga0157373_100324662 384
640 3300013104 Ga0157370_10005320 Ga0157370_100053205 384
641 3300015261 Ga0182006_1000020 Ga0182006_1000020190 384
642 3300017792 Ga0163161_10069792 Ga0163161_100697922 384
643 3300025711 Ga0207696_1000003 Ga0207696_1000003311 384
644 3300025711 Ga0207696_1000007 Ga0207696_1000007310 384
645 3300025711 Ga0207696_1000769 Ga0207696_10007694 384
646 3300025711 Ga0207696_1004495 Ga0207696_10044952 384
647 3300025728 Ga0207655_1000001 Ga0207655_1000001211 384
648 3300025728 Ga0207655_1000032 Ga0207655_10000326 384
649 3300025728 Ga0207655_1000042 Ga0207655_100004221 384
650 3300025728 Ga0207655_1000206 Ga0207655_100020667 384
651 3300025728 Ga0207655_1001567 Ga0207655_100156721 384
652 3300025728 Ga0207655_1004065 Ga0207655_10040655 384
653 3300025728 Ga0207655_1020388 Ga0207655_10203882 384
654 3300025735 Ga0207713_1000005 Ga0207713_1000005448 384
655 3300025735 Ga0207713_1000006 Ga0207713_100000643 384
656 3300025735 Ga0207713_1000021 Ga0207713_1000021259 384
657 3300025735 Ga0207713_1001870 Ga0207713_100187012 384
658 3300025735 Ga0207713_1004420 Ga0207713_10044204 384
659 3300025735 Ga0207713_1014249 Ga0207713_10142492 384
660 3300025935 Ga0207709_10013615 Ga0207709_100136153 384
661 3300025935 Ga0207709_10024955 Ga0207709_100249552 384
662 3300026116 Ga0207674_10000043 Ga0207674_1000004380 384
663 3300027111 Ga0209281_1000001 Ga0209281_10000011653 384
664 3300027111 Ga0209281_1000021 Ga0209281_1000021316 384
665 3300027111 Ga0209281_1000041 Ga0209281_100004176 384
666 3300027111 Ga0209281_1000075 Ga0209281_100007562 384
667 3300027111 Ga0209281_1000122 Ga0209281_10001226 384
668 3300027111 Ga0209281_1000335 Ga0209281_100033568 384
669 3300027111 Ga0209281_1000837 Ga0209281_10008374 384
670 3300027111 Ga0209281_1001682 Ga0209281_10016824 384
671 3300027111 Ga0209281_1003643 Ga0209281_10036434 384
672 3300028379 Ga0268266_10000084 Ga0268266_10000084118 384
673 3300041512 Ga0451853_0850445 Ga0451853_0850445_1386_2594 384
674 3300042010 Ga0439452_000003 Ga0439452_000003_749450_750667 384
675 3300042010 Ga0439452_000033 Ga0439452_000033_90461_91669 384
676 3300042010 Ga0439452_000364 Ga0439452_000364_5120_6340 384
677 3300046458 Ga0495591_000011 Ga0495591_000011_39792_41012 384
678 3300046458 Ga0495591_004165 Ga0495591_004165_1048_2268 384
679 3300046471 Ga0495650_0000175 Ga0495650_0000175_77155_78363 384
680 3300046694 Ga0495649_0001266 Ga0495649_0001266_3123_4343 384
681 3300046694 Ga0495649_0004698 Ga0495649_0004698_2577_3797 384
682 3300047446 Ga0495679_001269 Ga0495679_001269_2361_3581 384
683 3300047469 Ga0495673_0000022 Ga0495673_0000022_540657_541877 384
684 3300048919 Ga0496116_0001024 Ga0496116_0001024_5938_7146 384
685 3300048919 Ga0496116_0030689 Ga0496116_0030689_1173_2393 384
686 3300048920 Ga0496117_0003461 Ga0496117_0003461_5739_6947 384
687 3300048920 Ga0496117_0032767 Ga0496117_0032767_42_1250 384
688 3300048921 Ga0496118_0002663 Ga0496118_0002663_11706_12914 384
689 3300048921 Ga0496118_0011337 Ga0496118_0011337_7465_8673 384
690 3300048921 Ga0496118_0021918 Ga0496118_0021918_583_1803 384
691 3300048922 Ga0496119_0002217 Ga0496119_0002217_1585_2793 384
692 3300048922 Ga0496119_0002997 Ga0496119_0002997_441_1661 384
693 3300048922 Ga0496119_0015432 Ga0496119_0015432_827_2047 384
694 3300048923 Ga0496120_0002078 Ga0496120_0002078_4729_5937 384
695 3300048923 Ga0496120_0012547 Ga0496120_0012547_101_1321 384
696 3300048924 Ga0496121_0002191 Ga0496121_0002191_19110_20318 384
697 3300048924 Ga0496121_0003835 Ga0496121_0003835_17610_18830 384
698 3300048924 Ga0496121_0016242 Ga0496121_0016242_769_1989 384
699 3300048925 Ga0496122_0000026 Ga0496122_0000026_295864_297084 384
700 3300048925 Ga0496122_0073594 Ga0496122_0073594_370_1578 384
701 3300048926 Ga0496123_0000005 Ga0496123_0000005_596179_597399 384
702 3300048926 Ga0496123_0000759 Ga0496123_0000759_10257_11465 384
703 3300048926 Ga0496123_0006211 Ga0496123_0006211_6036_7256 384
704 3300048926 Ga0496123_0008641 Ga0496123_0008641_3875_5083 384
705 3300048927 Ga0496124_0000288 Ga0496124_0000288_23030_24250 384
706 3300048927 Ga0496124_0002079 Ga0496124_0002079_22131_23351 384
707 3300048927 Ga0496124_0140492 Ga0496124_0140492_519_1727 384
708 3300048928 Ga0496125_0000016 Ga0496125_0000016_464730_465950 384
709 3300048928 Ga0496125_0003003 Ga0496125_0003003_17142_18362 384
710 3300048928 Ga0496125_0036171 Ga0496125_0036171_1746_2966 384
711 3300048929 Ga0496126_0028311 Ga0496126_0028311_2813_4033 384
712 3300048929 Ga0496126_0034905 Ga0496126_0034905_2163_3371 384
713 3300050491 nmdc:mga00v17_9580_c1 nmdc:mga00v17_9580_c1_1873_3093 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

295

472

0.91

PF07690

MFS_1

Major Facilitator Superfamily

72

407

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.7938 18 384
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.7831 20 377
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.7806 19 375
7sp5-assembly2.cif.gz_B crystal structure of a eukaryotic phosphate transporter 0.7805 19 378
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.7799 18 375
ID Description Score Start End Superfamily
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9818 13 202 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9767 13 202 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9465 218 384 1.20.1250.20
af_P54219_107_289_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9136 57 195 1.20.1250.20
af_P9WLG3_19_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.878 17 198 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2X2DF22-F1-model_v4 deleted 0.9242 1 203
AF-A0A353ILR4-F1-model_v4 MFS transporter 0.908 1 250 GO:0005886
GO:0022857
AF-A0A353ILR4-F1-model_v4 MFS transporter 0.881 1 250 GO:0005886
GO:0022857
AF-A0A529M9Q1-F1-model_v4 MFS transporter 0.8791 1 150 GO:0005886
GO:0022857
AF-A0A662JQN3-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8584 17 205 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map