F476843

General Info

Members Datasets Scaffolds Average Seq Length
712 377 699 179

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0205096|Ga0373939_0205096_49_666
Length 205
Sequence MRRSTSDSDVVRCARDTHFKSARIRRSLAGAMTLAVRPAMPADIPAITRIYAHAVVHGTASFELEAPDEAEMARRMHDLKSKDFPYLAAERDGALAGYAYAALYRARRAYRFTVEDSVYVAPDGQRRGVGRALLKALIEACEARGFRQMIAVIGDSQRQQASIGLHAVLGFRHVGVFQDVGFKHGRWVDTLLMQRALGKGETAEP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2738541337 Pelomonas sp. BT06 Isolate Unclassified
11 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
221 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
227 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
228 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
229 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
230 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
231 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
232 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
233 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
234 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
235 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
259 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
330 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
331 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
334 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
354 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
359 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
360 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
361 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
362 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
371 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
372 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
377 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0.56
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.87
Nodule 0
Rhizoplane 2.11
Rhizosphere 73.88
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10007026 3300003215 Bacteria 5605
2 rootH1_10007880 3300003316 Bacteria 5854
3 rootH1_10015589 3300003316 Bacteria 1132
4 rootL2_10001083 3300003322 Bacteria 1516
5 rootL2_10066719 3300003322 Bacteria 2548
6 rootH1_10017493 3300003323 Bacteria 1266
7 rootH1_10070345 3300003323 Bacteria 1214
8 rootH1_10077402 3300003323 Bacteria 3164
9 Ga0006562J51391_1182578 3300003578 Bacteria 1597
10 Ga0006562J51391_1182579 3300003578 Bacteria 1720
11 Ga0055526_1006007 3300003771 Bacteria 6741
12 Ga0055530_10007731 3300003791 Bacteria 4464
13 Ga0065165_1003633 3300005262 Bacteria 10560
14 Ga0070658_10175324 3300005327 Bacteria 1803
15 Ga0070676_10005424 3300005328 Bacteria 6795
16 Ga0070676_10014860 3300005328 Bacteria 4285
17 Ga0070676_10233418 3300005328 Bacteria 1220
18 Ga0070690_100025986 3300005330 Bacteria 3608
19 Ga0070670_100034202 3300005331 Bacteria 4374
20 Ga0070670_100154253 3300005331 Bacteria 1988
21 Ga0070670_100189689 3300005331 Bacteria 1785
22 Ga0070670_100201949 3300005331 Bacteria 1727
23 Ga0070670_100203912 3300005331 Bacteria 1719
24 Ga0070670_100310154 3300005331 Bacteria 1381
25 Ga0070670_100546112 3300005331 Bacteria 1033
26 Ga0070677_10010433 3300005333 Bacteria 3178
27 Ga0068869_100068206 3300005334 Bacteria 2626
28 Ga0068869_100072168 3300005334 Bacteria 2558
29 Ga0070666_10031672 3300005335 Bacteria 3491
30 Ga0070666_10648026 3300005335 Bacteria 773
31 Ga0070680_100063571 3300005336 Bacteria 3023
32 Ga0068868_100015848 3300005338 Bacteria 5584
33 Ga0068868_100020753 3300005338 Bacteria 4942
34 Ga0068868_100248955 3300005338 Bacteria 1495
35 Ga0070661_100216549 3300005344 Bacteria 1467
36 Ga0070661_100243120 3300005344 Bacteria 1387
37 Ga0070661_100773009 3300005344 Bacteria 786
38 Ga0070668_100029372 3300005347 Bacteria 4176
39 Ga0070669_100094865 3300005353 Bacteria 2242
40 Ga0070675_100052953 3300005354 Bacteria 3338
41 Ga0070675_100157873 3300005354 Bacteria 1948
42 Ga0070675_100255222 3300005354 Bacteria 1535
43 Ga0070675_100304644 3300005354 Bacteria 1404
44 Ga0070671_100017107 3300005355 Bacteria 5867
45 Ga0070671_100138375 3300005355 Bacteria 2054
46 Ga0070671_100631594 3300005355 Bacteria 927
47 Ga0070671_100716595 3300005355 Bacteria 868
48 Ga0070671_100859344 3300005355 Bacteria 791
49 Ga0070674_100029218 3300005356 Bacteria 3628
50 Ga0070674_100064420 3300005356 Bacteria 2568
51 Ga0070674_100190740 3300005356 Bacteria 1577
52 Ga0070674_101443897 3300005356 Bacteria 617
53 Ga0070673_100005315 3300005364 Bacteria 8225
54 Ga0070673_100267450 3300005364 Bacteria 1495
55 Ga0070673_100354152 3300005364 Bacteria 1303
56 Ga0070673_100609382 3300005364 Unclassified 996
57 Ga0070673_100775346 3300005364 Bacteria 884
58 Ga0070688_100234632 3300005365 Bacteria 1299
59 Ga0070667_100004388 3300005367 Bacteria 11903
60 Ga0070667_100169376 3300005367 Bacteria 1927
61 Ga0070667_100276275 3300005367 Bacteria 1507
62 Ga0070667_101175278 3300005367 Bacteria 718
63 Ga0070667_101231522 3300005367 Bacteria 701
64 Ga0070700_100405888 3300005441 Bacteria 1026
65 Ga0070663_100054597 3300005455 Bacteria 2856
66 Ga0070663_100106355 3300005455 Bacteria 2101
67 Ga0070663_100795743 3300005455 Bacteria 810
68 Ga0070678_100034651 3300005456 Bacteria 3518
69 Ga0070678_100078197 3300005456 Bacteria 2498
70 Ga0070678_100134691 3300005456 Bacteria 1968
71 Ga0070678_100375739 3300005456 Bacteria 1228
72 Ga0070678_101076557 3300005456 Bacteria 742
73 Ga0070662_100022743 3300005457 Bacteria 4296
74 Ga0070662_100023184 3300005457 Bacteria 4261
75 Ga0070662_100073830 3300005457 Bacteria 2521
76 Ga0068867_100007828 3300005459 Bacteria 7553
77 Ga0068867_100095372 3300005459 Bacteria 2263
78 Ga0068867_100635945 3300005459 Bacteria 934
79 Ga0070679_100021313 3300005530 Bacteria 6325
80 Ga0070684_100174632 3300005535 Bacteria 1952
81 Ga0070684_100690595 3300005535 Bacteria 951
82 Ga0070672_100039130 3300005543 Bacteria 3630
83 Ga0070672_100064493 3300005543 Bacteria 2894
84 Ga0070672_100086170 3300005543 Bacteria 2525
85 Ga0070672_100108581 3300005543 Bacteria 2259
86 Ga0070672_100110940 3300005543 Bacteria 2235
87 Ga0070672_100845456 3300005543 Bacteria 807
88 Ga0070686_100119616 3300005544 Bacteria 1806
89 Ga0070693_100648521 3300005547 Bacteria 767
90 Ga0070665_100063002 3300005548 Bacteria 3718
91 Ga0068855_100282473 3300005563 Bacteria 1843
92 Ga0068855_101314445 3300005563 Bacteria 748
93 Ga0070664_100060332 3300005564 Bacteria 3229
94 Ga0070664_100382778 3300005564 Bacteria 1284
95 Ga0070664_100751193 3300005564 Bacteria 910
96 Ga0068857_100081284 3300005577 Bacteria 2894
97 Ga0068857_100557525 3300005577 Bacteria 1080
98 Ga0068857_101110459 3300005577 Bacteria 764
99 Ga0068854_100029855 3300005578 Bacteria 3778
100 Ga0068854_100115079 3300005578 Bacteria 2034
101 Ga0068854_100350207 3300005578 Bacteria 1209
102 Ga0068854_100622988 3300005578 Bacteria 923
103 Ga0068852_100055501 3300005616 Bacteria 3420
104 Ga0068852_100858564 3300005616 Bacteria 923
105 Ga0068852_100979678 3300005616 Bacteria 864
106 Ga0068852_101010263 3300005616 Bacteria 850
107 Ga0068859_100135444 3300005617 Bacteria 2536
108 Ga0068864_100046435 3300005618 Bacteria 3726
109 Ga0068864_100048657 3300005618 Bacteria 3645
110 Ga0068864_100157469 3300005618 Bacteria 2062
111 Ga0068864_100793040 3300005618 Bacteria 930
112 Ga0068864_100807020 3300005618 Bacteria 922
113 Ga0068864_100896548 3300005618 Bacteria 875
114 Ga0068866_10095345 3300005718 Bacteria 1629
115 Ga0068866_10366802 3300005718 Bacteria 920
116 Ga0068861_100301307 3300005719 Bacteria 1388
117 Ga0068861_100499223 3300005719 Unclassified 1100
118 Ga0068851_10189295 3300005834 Bacteria 1143
119 Ga0068870_10039677 3300005840 Bacteria 2437
120 Ga0068863_100053520 3300005841 Bacteria 3826
121 Ga0068863_100315660 3300005841 Bacteria 1517
122 Ga0068858_100003791 3300005842 Bacteria 14951
123 Ga0068860_100004033 3300005843 Bacteria 15080
124 Ga0068862_100005370 3300005844 Bacteria 10728
125 Ga0068862_100746325 3300005844 Bacteria 952
126 Ga0075365_10006162 3300006038 Bacteria 6566
127 Ga0075365_10162891 3300006038 Bacteria 1555
128 Ga0075368_10007583 3300006042 Bacteria 3830
129 Ga0075368_10020604 3300006042 Bacteria 2499
130 Ga0075368_10041721 3300006042 Bacteria 1803
131 Ga0075368_10049413 3300006042 Bacteria 1669
132 Ga0075363_100006792 3300006048 Bacteria 5227
133 Ga0075363_100026281 3300006048 Bacteria 2977
134 Ga0075363_100027648 3300006048 Bacteria 2910
135 Ga0075363_100075353 3300006048 Bacteria 1838
136 Ga0075364_10016731 3300006051 Bacteria 4567
137 Ga0075364_10029373 3300006051 Bacteria 3525
138 Ga0070715_10396644 3300006163 Bacteria 766
139 Ga0075362_10015745 3300006177 Bacteria 3081
140 Ga0075362_10024040 3300006177 Bacteria 2582
141 Ga0075362_10133552 3300006177 Bacteria 1182
142 Ga0075362_10159420 3300006177 Bacteria 1086
143 Ga0075367_10001597 3300006178 Bacteria 9830
144 Ga0075367_10005029 3300006178 Bacteria 6519
145 Ga0075367_10225898 3300006178 Bacteria 1172
146 Ga0075369_10027826 3300006186 Bacteria 2365
147 Ga0075366_10000433 3300006195 Bacteria 19528
148 Ga0075366_10024666 3300006195 Bacteria 3507
149 Ga0075366_10045787 3300006195 Bacteria 2592
150 Ga0075366_10104698 3300006195 Bacteria 1700
151 Ga0075366_10129758 3300006195 Bacteria 1521
152 Ga0075366_10225733 3300006195 Bacteria 1141
153 Ga0075366_10237157 3300006195 Bacteria 1112
154 Ga0097621_100170721 3300006237 Bacteria 1874
155 Ga0097621_100195851 3300006237 Bacteria 1752
156 Ga0097621_100334608 3300006237 Bacteria 1343
157 Ga0097621_101335742 3300006237 Unclassified 678
158 Ga0075370_10000538 3300006353 Bacteria 14505
159 Ga0075370_10000846 3300006353 Bacteria 12403
160 Ga0075370_10004004 3300006353 Bacteria 7081
161 Ga0075370_10007825 3300006353 Bacteria 5465
162 Ga0075370_10106550 3300006353 Bacteria 1625
163 Ga0075370_10188157 3300006353 Bacteria 1216
164 Ga0075370_10359469 3300006353 Bacteria 870
165 Ga0068871_100037260 3300006358 Bacteria 3877
166 Ga0068871_100137485 3300006358 Bacteria 2076
167 Ga0075430_100000276 3300006846 Bacteria 36027
168 Ga0075430_100138515 3300006846 Bacteria 2027
169 Ga0075431_100034277 3300006847 Bacteria 5230
170 Ga0075429_100682159 3300006880 Bacteria 900
171 Ga0068865_100222079 3300006881 Bacteria 1477
172 Ga0097620_100135435 3300006931 Bacteria 2536
173 Ga0105240_10037356 3300009093 Bacteria 6242
174 Ga0105240_10406149 3300009093 Bacteria 1533
175 Ga0105245_10052074 3300009098 Bacteria 3671
176 Ga0105245_10053820 3300009098 Bacteria 3614
177 Ga0105245_10257453 3300009098 Bacteria 1697
178 Ga0105247_10556682 3300009101 Bacteria 844
179 Ga0105243_10033813 3300009148 Bacteria 3954
180 Ga0105243_10059454 3300009148 Bacteria 3051
181 Ga0105242_10274465 3300009176 Bacteria 1528
182 Ga0105248_10209361 3300009177 Bacteria 2197
183 Ga0105248_10368514 3300009177 Bacteria 1617
184 Ga0105237_10001352 3300009545 Bacteria 32488
185 Ga0105237_10012662 3300009545 Bacteria 8878
186 Ga0105238_10269669 3300009551 Bacteria 1682
187 Ga0105238_11749555 3300009551 Bacteria 653
188 Ga0105249_10044015 3300009553 Bacteria 4060
189 Ga0105239_10003766 3300010375 Bacteria 18446
190 Ga0105239_10037984 3300010375 Bacteria 5277
191 Ga0105246_10691283 3300011119 Bacteria 893
192 Ga0157373_10038721 3300013100 Bacteria 3416
193 Ga0157371_10207035 3300013102 Bacteria 1407
194 Ga0157370_10022640 3300013104 Bacteria 6252
195 Ga0157370_10742816 3300013104 Bacteria 894
196 Ga0157369_10065353 3300013105 Bacteria 3915
197 Ga0157374_10285055 3300013296 Bacteria 1631
198 Ga0157374_10385984 3300013296 Bacteria 1395
199 Ga0157374_10496992 3300013296 Bacteria 1224
200 Ga0157378_10056830 3300013297 Bacteria 3487
201 Ga0157378_10375476 3300013297 Bacteria 1395
202 Ga0163162_10022860 3300013306 Bacteria 6165
203 Ga0163162_11235551 3300013306 Bacteria 848
204 Ga0163162_11561259 3300013306 Bacteria 752
205 Ga0157372_10167119 3300013307 Bacteria 2544
206 Ga0157375_10012775 3300013308 Bacteria 7455
207 Ga0157375_10055359 3300013308 Bacteria 3911
208 Ga0157375_10184225 3300013308 Bacteria 2240
209 Ga0163163_10435639 3300014325 Bacteria 1370
210 Ga0163163_11680361 3300014325 Bacteria 696
211 Ga0157380_10021608 3300014326 Bacteria 4829
212 Ga0157380_10134265 3300014326 Bacteria 2116
213 Ga0157380_10334123 3300014326 Bacteria 1410
214 Ga0157377_10518514 3300014745 Bacteria 836
215 Ga0157379_10048970 3300014968 Bacteria 3772
216 Ga0157379_10085784 3300014968 Bacteria 2823
217 Ga0157379_10282749 3300014968 Bacteria 1510
218 Ga0157379_10879047 3300014968 Unclassified 849
219 Ga0157379_11031976 3300014968 Bacteria 785
220 Ga0157376_10182194 3300014969 Bacteria 1921
221 Ga0182005_1054393 3300015265 Bacteria 1090
222 Ga0163161_11081601 3300017792 Bacteria 688
223 Ga0213872_10000140 3300021361 Bacteria 65308
224 Ga0209129_1000027 3300025258 Bacteria 409587
225 Ga0209565_1015028 3300025263 Bacteria 1758
226 Ga0209673_1004671 3300025273 Bacteria 7229
227 Ga0209673_1008939 3300025273 Bacteria 4401
228 Ga0209564_1000014 3300025295 Bacteria 621501
229 Ga0209758_1000193 3300025297 Bacteria 134744
230 Ga0209758_1000208 3300025297 Bacteria 128596
231 Ga0209050_1000198 3300025298 Bacteria 134820
232 Ga0209256_1040921 3300025299 Bacteria 1180
233 Ga0209051_1013755 3300025303 Bacteria 3825
234 Ga0209257_1035421 3300025304 Bacteria 1545
235 Ga0207697_10022812 3300025315 Bacteria 2563
236 Ga0207656_10118317 3300025321 Bacteria 1231
237 Ga0207682_10008329 3300025893 Bacteria 4101
238 Ga0207682_10015553 3300025893 Bacteria 2963
239 Ga0207642_10017450 3300025899 Bacteria 2731
240 Ga0207642_10283320 3300025899 Bacteria 954
241 Ga0207688_10056594 3300025901 Bacteria 2203
242 Ga0207680_10032671 3300025903 Bacteria 2960
243 Ga0207680_10042631 3300025903 Bacteria 2656
244 Ga0207680_10509812 3300025903 Bacteria 857
245 Ga0207645_10006118 3300025907 Bacteria 8648
246 Ga0207645_10020411 3300025907 Bacteria 4337
247 Ga0207643_10060987 3300025908 Bacteria 2154
248 Ga0207643_10524779 3300025908 Bacteria 758
249 Ga0207695_10388199 3300025913 Bacteria 1281
250 Ga0207695_10970046 3300025913 Bacteria 730
251 Ga0207671_10009654 3300025914 Bacteria 8043
252 Ga0207671_10090935 3300025914 Bacteria 2299
253 Ga0207660_10021246 3300025917 Bacteria 4364
254 Ga0207657_10236997 3300025919 Bacteria 1458
255 Ga0207649_10450271 3300025920 Bacteria 971
256 Ga0207652_10008328 3300025921 Bacteria 8336
257 Ga0207681_10002043 3300025923 Bacteria 12940
258 Ga0207681_10138395 3300025923 Bacteria 1810
259 Ga0207694_10312576 3300025924 Bacteria 1295
260 Ga0207694_10345605 3300025924 Bacteria 1231
261 Ga0207650_10001150 3300025925 Bacteria 19435
262 Ga0207650_10052371 3300025925 Bacteria 3023
263 Ga0207650_10167315 3300025925 Bacteria 1745
264 Ga0207650_10286159 3300025925 Bacteria 1343
265 Ga0207659_10021737 3300025926 Bacteria 4265
266 Ga0207659_10041200 3300025926 Bacteria 3234
267 Ga0207659_10562337 3300025926 Bacteria 970
268 Ga0207687_10024955 3300025927 Bacteria 3998
269 Ga0207687_10164178 3300025927 Bacteria 1707
270 Ga0207687_10608446 3300025927 Bacteria 921
271 Ga0207644_10005994 3300025931 Bacteria 7920
272 Ga0207644_10132144 3300025931 Bacteria 1912
273 Ga0207644_10132941 3300025931 Bacteria 1907
274 Ga0207644_10321717 3300025931 Bacteria 1251
275 Ga0207644_10556920 3300025931 Bacteria 949
276 Ga0207644_10958669 3300025931 Bacteria 717
277 Ga0207690_10477561 3300025932 Bacteria 1006
278 Ga0207690_10572212 3300025932 Bacteria 920
279 Ga0207706_10008308 3300025933 Bacteria 9570
280 Ga0207706_10033661 3300025933 Bacteria 4560
281 Ga0207706_10051513 3300025933 Bacteria 3635
282 Ga0207686_10409046 3300025934 Bacteria 1035
283 Ga0207686_11087071 3300025934 Unclassified 652
284 Ga0207709_10021965 3300025935 Bacteria 3616
285 Ga0207709_10456811 3300025935 Bacteria 988
286 Ga0207670_10197720 3300025936 Bacteria 1525
287 Ga0207669_10123252 3300025937 Bacteria 1764
288 Ga0207669_10138851 3300025937 Bacteria 1683
289 Ga0207669_10326427 3300025937 Bacteria 1176
290 Ga0207704_10008974 3300025938 Bacteria 4805
291 Ga0207691_10060049 3300025940 Bacteria 3456
292 Ga0207691_10268024 3300025940 Bacteria 1471
293 Ga0207691_10342612 3300025940 Bacteria 1279
294 Ga0207691_10501637 3300025940 Bacteria 1031
295 Ga0207711_10063030 3300025941 Bacteria 3199
296 Ga0207711_10726230 3300025941 Bacteria 926
297 Ga0207689_10015180 3300025942 Bacteria 6524
298 Ga0207689_10016368 3300025942 Bacteria 6280
299 Ga0207661_10245559 3300025944 Bacteria 1590
300 Ga0207679_10395117 3300025945 Bacteria 1215
301 Ga0207651_10042268 3300025960 Bacteria 3032
302 Ga0207651_10335609 3300025960 Bacteria 1268
303 Ga0207651_10353012 3300025960 Bacteria 1239
304 Ga0207651_10401972 3300025960 Bacteria 1165
305 Ga0207651_10571754 3300025960 Bacteria 985
306 Ga0207651_10970971 3300025960 Bacteria 758
307 Ga0207651_11290003 3300025960 Unclassified 656
308 Ga0207712_10043014 3300025961 Bacteria 3114
309 Ga0207668_10003052 3300025972 Bacteria 9816
310 Ga0207640_10071608 3300025981 Bacteria 2335
311 Ga0207640_10074430 3300025981 Bacteria 2299
312 Ga0207640_10165065 3300025981 Bacteria 1643
313 Ga0207658_10002236 3300025986 Bacteria 14366
314 Ga0207658_10010815 3300025986 Bacteria 6208
315 Ga0207677_10020077 3300026023 Bacteria 4049
316 Ga0207677_10051400 3300026023 Bacteria 2794
317 Ga0207677_10197248 3300026023 Bacteria 1597
318 Ga0207703_10001541 3300026035 Bacteria 20913
319 Ga0207678_10076508 3300026067 Bacteria 2867
320 Ga0207678_10084333 3300026067 Bacteria 2717
321 Ga0207678_10631026 3300026067 Bacteria 941
322 Ga0207708_10036858 3300026075 Bacteria 3724
323 Ga0207702_10171048 3300026078 Bacteria 1992
324 Ga0207702_11297420 3300026078 Bacteria 722
325 Ga0207641_10000655 3300026088 Bacteria 37743
326 Ga0207641_10037046 3300026088 Bacteria 4072
327 Ga0207641_10244785 3300026088 Bacteria 1672
328 Ga0207641_10423148 3300026088 Bacteria 1283
329 Ga0207648_10006616 3300026089 Bacteria 11512
330 Ga0207648_10010374 3300026089 Bacteria 8833
331 Ga0207648_10091482 3300026089 Bacteria 2659
332 Ga0207676_10060635 3300026095 Bacteria 2993
333 Ga0207676_10271087 3300026095 Bacteria 1537
334 Ga0207676_10321090 3300026095 Bacteria 1421
335 Ga0207676_10514698 3300026095 Bacteria 1138
336 Ga0207676_10913847 3300026095 Bacteria 861
337 Ga0207674_10036354 3300026116 Bacteria 5133
338 Ga0207674_10916080 3300026116 Bacteria 845
339 Ga0207674_11246651 3300026116 Bacteria 713
340 Ga0207675_100095530 3300026118 Bacteria 2797
341 Ga0207675_101036988 3300026118 Bacteria 839
342 Ga0207683_10053290 3300026121 Bacteria 3546
343 Ga0207683_10113189 3300026121 Bacteria 2430
344 Ga0207683_10158397 3300026121 Bacteria 2046
345 Ga0207683_10187000 3300026121 Bacteria 1879
346 Ga0207683_11290885 3300026121 Bacteria 676
347 Ga0207698_10052815 3300026142 Bacteria 3116
348 Ga0207698_10114183 3300026142 Bacteria 2271
349 Ga0207698_10897436 3300026142 Bacteria 893
350 Ga0207698_10932246 3300026142 Bacteria 877
351 Ga0209813_10003088 3300027866 Bacteria 3870
352 Ga0209813_10008646 3300027866 Bacteria 2580
353 Ga0268266_10004915 3300028379 Bacteria 12666
354 Ga0268266_10347242 3300028379 Bacteria 1394
355 Ga0268266_10425655 3300028379 Bacteria 1259
356 Ga0268266_10629787 3300028379 Bacteria 1031
357 Ga0268265_10003715 3300028380 Bacteria 10856
358 Ga0268264_10002170 3300028381 Bacteria 17490
359 Ga0307515_10000020 3300028794 Bacteria 411735
360 Ga0307515_10000525 3300028794 Bacteria 91297
361 Ga0307515_10001484 3300028794 Bacteria 52674
362 Ga0307515_10078173 3300028794 Bacteria 4356
363 Ga0307515_10139043 3300028794 Bacteria 2617
364 Ga0307515_10200216 3300028794 Bacteria 1875
365 Ga0307512_10078927 3300030522 Bacteria 2381
366 Ga0307513_10034000 3300031456 Bacteria 5725
367 Ga0307513_10145072 3300031456 Bacteria 2293
368 Ga0307513_10166466 3300031456 Bacteria 2088
369 Ga0307509_10000181 3300031507 Bacteria 98346
370 Ga0307509_10007667 3300031507 Bacteria 14026
371 Ga0307509_10030721 3300031507 Bacteria 5939
372 Ga0307509_10034467 3300031507 Bacteria 5562
373 Ga0307509_10059624 3300031507 Bacteria 4038
374 Ga0307509_10127494 3300031507 Bacteria 2508
375 Ga0307509_10623570 3300031507 Bacteria 749
376 Ga0307408_100000038 3300031548 Bacteria 183170
377 Ga0307408_100691637 3300031548 Bacteria 916
378 Ga0307408_101041864 3300031548 Bacteria 756
379 Ga0307408_101543763 3300031548 Bacteria 629
380 Ga0307508_10000738 3300031616 Bacteria 38723
381 Ga0307508_10051814 3300031616 Bacteria 3647
382 Ga0307508_10058240 3300031616 Bacteria 3418
383 Ga0307514_10000395 3300031649 Bacteria 99171
384 Ga0307516_10000359 3300031730 Bacteria 59207
385 Ga0307516_10000360 3300031730 Bacteria 59179
386 Ga0307516_10297671 3300031730 Bacteria 1290
387 Ga0307516_10473758 3300031730 Bacteria 907
388 Ga0307518_10479676 3300031838 Bacteria 651
389 Ga0307410_10202966 3300031852 Bacteria 1515
390 Ga0307409_100519124 3300031995 Bacteria 1163
391 Ga0307416_100098684 3300032002 Bacteria 2534
392 Ga0307416_100162336 3300032002 Bacteria 2067
393 Ga0307416_100222125 3300032002 Bacteria 1813
394 Ga0307416_100406162 3300032002 Bacteria 1401
395 Ga0307414_10219966 3300032004 Bacteria 1558
396 Ga0307411_10000214 3300032005 Bacteria 18630
397 Ga0307411_10513124 3300032005 Bacteria 1016
398 Ga0307411_10820882 3300032005 Bacteria 820
399 Ga0307415_100666264 3300032126 Bacteria 935
400 Ga0307507_10033844 3300033179 Bacteria 5296
401 Ga0307510_10006134 3300033180 Bacteria 14325
402 Ga0307510_10032780 3300033180 Bacteria 5848
403 Ga0307510_10229391 3300033180 Bacteria 1360
404 Ga0307510_10372770 3300033180 Bacteria 874
405 Ga0373959_0011717 3300034820 Bacteria 1553
406 Ga0373928_0013749 3300035084 Bacteria 1628
407 Ga0373940_0074835 3300035088 Bacteria 992
408 Ga0373949_0117633 3300035090 Bacteria 743
409 Ga0373951_0006045 3300035091 Bacteria 2786
410 Ga0373932_0079085 3300035112 Bacteria 1035
411 Ga0373939_0000092 3300035114 Bacteria 28418
412 Ga0373939_0205096 3300035114 Bacteria 747
413 Ga0373945_0043125 3300035116 Bacteria 1636
414 Ga0373954_0055761 3300035118 Bacteria 1859
415 Ga0373957_0073248 3300035120 Bacteria 1343
416 Ga0373943_0105569 3300035170 Bacteria 1479
417 Ga0373946_0264695 3300035171 Bacteria 842
418 Ga0373946_0292972 3300035171 Bacteria 803
419 Ga0373924_0092603 3300035410 Bacteria 1294
420 Ga0373931_0000403 3300035691 Bacteria 17660
421 Ga0373931_0069406 3300035691 Bacteria 1920
422 Ga0373935_0118199 3300035692 Bacteria 1768
423 Ga0373927_0059536 3300035695 Bacteria 2470
424 Ga0373933_0246301 3300035724 Bacteria 1150
425 Ga0373947_0186530 3300035725 Bacteria 1352
426 Ga0373947_0596344 3300035725 Bacteria 753
427 Ga0373947_0800336 3300035725 Bacteria 643
428 Ga0373937_0048281 3300036401 Bacteria 3896
429 Ga0373937_0220034 3300036401 Bacteria 1787
430 Ga0373925_0201079 3300037068 Bacteria 1584
431 Ga0373925_0350666 3300037068 Bacteria 1198
432 Ga0373925_0945811 3300037068 Bacteria 710
433 Ga0395899_0489779 3300037312 Bacteria 799
434 Ga0395900_0131850 3300037418 Bacteria 2561
435 Ga0395905_0007537 3300037471 Bacteria 10820
436 Ga0395905_0024849 3300037471 Bacteria 5653
437 Ga0395905_0085909 3300037471 Bacteria 2948
438 Ga0395905_0131557 3300037471 Bacteria 2353
439 Ga0436365_1527322 3300039437 Bacteria 3108
440 Ga0436365_1746291 3300039437 Bacteria 1550
441 Ga0436361_0033949 3300039447 Bacteria 5118
442 Ga0436361_0749433 3300039447 Bacteria 31549
443 Ga0439461_0075895 3300041410 Bacteria 786
444 Ga0439465_0048728 3300041413 Bacteria 1383
445 Ga0451789_0961199 3300041443 Bacteria 3212
446 Ga0451793_1185119 3300041452 Bacteria 2085
447 Ga0451800_0946979 3300041459 Bacteria 1832
448 Ga0451802_1454478 3300041460 Bacteria 1512
449 Ga0451804_0697290 3300041463 Bacteria 814
450 Ga0451839_0267159 3300041496 Bacteria 902
451 Ga0451839_0314440 3300041496 Bacteria 749
452 Ga0451849_0782838 3300041505 Bacteria 1216
453 Ga0451849_1333857 3300041505 Bacteria 745
454 Ga0451843_1276605 3300041509 Bacteria 769
455 Ga0451853_3167327 3300041512 Bacteria 2483
456 Ga0439431_0002967 3300041997 Bacteria 3725
457 Ga0439445_0039050 3300042004 Bacteria 1257
458 Ga0450912_003383 3300042116 Bacteria 1132
459 Ga0450888_001013 3300042126 Bacteria 2654
460 Ga0450888_005684 3300042126 Bacteria 1337
461 Ga0450890_000737 3300042127 Bacteria 4756
462 Ga0450890_016996 3300042127 Bacteria 966
463 Ga0450891_000527 3300042129 Bacteria 3990
464 Ga0450892_001234 3300042130 Bacteria 2621
465 Ga0450898_036966 3300042134 Bacteria 913
466 Ga0450899_008846 3300042135 Bacteria 1105
467 Ga0450902_002503 3300042137 Bacteria 2611
468 Ga0450903_007340 3300042138 Bacteria 1815
469 Ga0450889_000335 3300042144 Bacteria 5261
470 Ga0439446_0168573 3300042156 Bacteria 727
471 Ga0439446_0179155 3300042156 Bacteria 708
472 Ga0439434_0120828 3300042435 Bacteria 854
473 Ga0451577_0004100 3300042876 Bacteria 15627
474 Ga0451577_0811344 3300042876 Bacteria 845
475 Ga0466969_0000640 3300044656 Bacteria 18904
476 Ga0466969_0017146 3300044656 Bacteria 3785
477 Ga0466969_0026791 3300044656 Bacteria 2955
478 Ga0466972_0115940 3300044658 Bacteria 1264
479 Ga0466965_0020695 3300044683 Bacteria 3165
480 Ga0466965_0052368 3300044683 Bacteria 2027
481 Ga0466966_0001617 3300044684 Bacteria 14507
482 Ga0466966_0002104 3300044684 Bacteria 12935
483 Ga0466966_0014227 3300044684 Bacteria 5268
484 Ga0466961_0004564 3300044693 Bacteria 8686
485 Ga0466961_0042894 3300044693 Bacteria 2898
486 Ga0466961_0053983 3300044693 Bacteria 2563
487 Ga0466963_0006052 3300044694 Bacteria 7129
488 Ga0466963_0422087 3300044694 Bacteria 940
489 Ga0466964_0003715 3300044706 Bacteria 5592
490 Ga0466964_0007328 3300044706 Bacteria 4124
491 Ga0453684_0008512 3300044712 Bacteria 18337
492 Ga0453684_0028231 3300044712 Bacteria 8018
493 Ga0453684_0042087 3300044712 Bacteria 6164
494 Ga0453684_1724022 3300044712 Bacteria 639
495 Ga0466971_0004691 3300044719 Bacteria 5907
496 Ga0466971_0004888 3300044719 Bacteria 5794
497 Ga0466971_0104848 3300044719 Bacteria 1301
498 Ga0466968_0063314 3300044735 Bacteria 1598
499 Ga0466970_0019609 3300044765 Bacteria 3507
500 Ga0466970_0038027 3300044765 Bacteria 2552
501 Ga0466957_0002193 3300044842 Bacteria 10465
502 Ga0466957_0040992 3300044842 Bacteria 2799
503 Ga0466957_0154003 3300044842 Bacteria 1488
504 Ga0466959_0001105 3300045049 Bacteria 16198
505 Ga0466959_0001324 3300045049 Bacteria 15052
506 Ga0466959_0005794 3300045049 Bacteria 8508
507 Ga0451576_0004811 3300045051 Bacteria 17299
508 Ga0451576_0041466 3300045051 Bacteria 4866
509 Ga0451576_0316796 3300045051 Bacteria 1632
510 Ga0466958_0073357 3300045836 Bacteria 2096
511 Ga0466958_0188840 3300045836 Bacteria 1309
512 Ga0466967_0035175 3300045976 Bacteria 4260
513 Ga0466967_0057621 3300045976 Bacteria 3430
514 Ga0466967_0997075 3300045976 Bacteria 834
515 Ga0495617_028456 3300046452 Bacteria 1878
516 Ga0495617_063430 3300046452 Bacteria 1220
517 Ga0495627_000064 3300046453 Bacteria 132648
518 Ga0495592_0000234 3300046454 Bacteria 47791
519 Ga0495590_0063523 3300046457 Bacteria 1292
520 Ga0495591_007342 3300046458 Bacteria 4701
521 Ga0495629_0210294 3300046459 Bacteria 1344
522 Ga0495638_0024870 3300046460 Bacteria 3898
523 Ga0495638_0228235 3300046460 Bacteria 1037
524 Ga0495650_0022520 3300046471 Bacteria 3019
525 Ga0495580_0279121 3300046472 Bacteria 1140
526 Ga0495605_0161223 3300046474 Bacteria 995
527 Ga0495584_0011483 3300046491 Bacteria 4537
528 Ga0495585_0157347 3300046492 Bacteria 1181
529 Ga0495596_0013038 3300046500 Bacteria 3540
530 Ga0495607_0014048 3300046501 Bacteria 5226
531 Ga0495630_0049651 3300046517 Bacteria 3140
532 Ga0495631_0000188 3300046518 Bacteria 42112
533 Ga0495631_0069679 3300046518 Bacteria 1521
534 Ga0495632_0002230 3300046519 Bacteria 14956
535 Ga0495632_0059359 3300046519 Bacteria 1861
536 Ga0495632_0145766 3300046519 Bacteria 1096
537 Ga0495632_0182342 3300046519 Bacteria 961
538 Ga0495637_0000027 3300046520 Bacteria 146241
539 Ga0495648_0018920 3300046524 Bacteria 4859
540 Ga0495648_0121022 3300046524 Bacteria 1407
541 Ga0495642_0025588 3300046528 Bacteria 2340
542 Ga0495654_0004383 3300046530 Bacteria 8397
543 Ga0495654_0033670 3300046530 Bacteria 2591
544 Ga0495586_0083944 3300046535 Bacteria 1753
545 Ga0495587_0501596 3300046536 Bacteria 671
546 Ga0495598_0005228 3300046537 Bacteria 2863
547 Ga0495645_0305689 3300046543 Bacteria 1037
548 Ga0495645_0348092 3300046543 Bacteria 955
549 Ga0495668_0066838 3300046616 Bacteria 1978
550 Ga0495668_0111330 3300046616 Bacteria 1497
551 Ga0495668_0168760 3300046616 Bacteria 1199
552 Ga0495611_0000387 3300046648 Bacteria 27957
553 Ga0495611_0085217 3300046648 Bacteria 1457
554 Ga0495625_0109410 3300046660 Bacteria 1890
555 Ga0495625_0167567 3300046660 Bacteria 1468
556 Ga0495625_0267362 3300046660 Bacteria 1105
557 Ga0495635_0177890 3300046663 Bacteria 1446
558 Ga0495661_0000119 3300046665 Bacteria 94133
559 Ga0495646_0302222 3300046680 Bacteria 846
560 Ga0495647_0016908 3300046681 Bacteria 2575
561 Ga0495658_0054733 3300046683 Bacteria 2271
562 Ga0495658_0275941 3300046683 Unclassified 1060
563 Ga0495624_0422115 3300046690 Bacteria 800
564 Ga0495671_0004098 3300046692 Bacteria 8790
565 Ga0495671_0351677 3300046692 Bacteria 707
566 Ga0495671_0443020 3300046692 Bacteria 621
567 Ga0495649_0033682 3300046694 Bacteria 2819
568 Ga0495600_0218774 3300046809 Bacteria 1219
569 Ga0495660_0009019 3300046810 Bacteria 5827
570 Ga0495636_0206736 3300047318 Bacteria 898
571 Ga0495672_0001209 3300047320 Bacteria 26035
572 Ga0495672_0303791 3300047320 Bacteria 755
573 Ga0495683_0067765 3300047323 Bacteria 1757
574 Ga0495687_067083 3300047443 Bacteria 1453
575 Ga0495679_003634 3300047446 Bacteria 7369
576 Ga0495673_0000619 3300047469 Bacteria 35084
577 Ga0495673_0015333 3300047469 Bacteria 3950
578 Ga0495673_0104030 3300047469 Bacteria 1144
579 Ga0495681_0018390 3300047470 Bacteria 3852
580 Ga0495681_0020867 3300047470 Bacteria 3543
581 Ga0495684_0131409 3300047471 Bacteria 1880
582 Ga0495686_0002472 3300047472 Bacteria 17402
583 Ga0495686_0017940 3300047472 Bacteria 4758
584 Ga0495593_0045829 3300047673 Bacteria 2332
585 Ga0495615_0109221 3300048090 Bacteria 790
586 Ga0495626_0024170 3300048091 Bacteria 2982
587 Ga0496102_0005822 3300048905 Bacteria 10484
588 Ga0496104_0324693 3300048907 Bacteria 1452
589 Ga0496106_0164194 3300048909 Bacteria 1757
590 Ga0496108_0174344 3300048911 Bacteria 1861
591 Ga0496108_0386617 3300048911 Bacteria 1222
592 Ga0496109_1002921 3300048912 Bacteria 772
593 Ga0496110_0563763 3300048913 Bacteria 1035
594 Ga0496113_0169424 3300048916 Bacteria 1729
595 Ga0496114_0085754 3300048917 Bacteria 2668
596 Ga0496114_0809535 3300048917 Bacteria 816
597 Ga0496124_0001949 3300048927 Bacteria 28205
598 Ga0501309_000375 3300049129 Bacteria 3443
599 Ga0501310_000289 3300049130 Bacteria 4621
600 Ga0495678_003717 3300049459 Bacteria 9229
601 Ga0501296_015210 3300049519 Bacteria 948
602 Ga0501031_0023849 3300049568 Bacteria 3989
603 Ga0501033_0614811 3300049570 Bacteria 744
604 Ga0501034_0192270 3300049571 Bacteria 2002
605 Ga0501037_0588831 3300049573 Bacteria 748
606 Ga0501038_0074082 3300049574 Bacteria 2881
607 Ga0501043_0000038 3300049579 Bacteria 128656
608 Ga0501043_0040718 3300049579 Bacteria 3652
609 Ga0501046_0000049 3300049580 Bacteria 135088
610 Ga0501047_0000039 3300049581 Bacteria 187849
611 Ga0501047_0772724 3300049581 Bacteria 776
612 Ga0501048_0004056 3300049582 Bacteria 11148
613 Ga0501070_0651930 3300049586 Bacteria 836
614 Ga0501073_0258670 3300049589 Bacteria 1201
615 Ga0501222_002799 3300049662 Bacteria 2415
616 Ga0501235_006024 3300049669 Bacteria 2639
617 Ga0501229_001801 3300049706 Bacteria 2510
618 Ga0501083_0020387 3300049744 Bacteria 4612
619 Ga0501083_0234072 3300049744 Bacteria 1196
620 Ga0501265_007658 3300049762 Bacteria 1275
621 Ga0501272_013324 3300049769 Bacteria 941
622 Ga0501044_0422711 3300049823 Bacteria 1242
623 Ga0501045_0064557 3300049824 Bacteria 2687
624 nmdc:mga03683_119957_c1 3300050489 Bacteria 1169
625 nmdc:mga03683_19275_c1 3300050489 Bacteria 2603
626 nmdc:mga03n38_346253_c1 3300050490 Bacteria 808
627 nmdc:mga03n38_7556_c1 3300050490 Bacteria 3851
628 nmdc:mga03n38_82306_c1 3300050490 Bacteria 1515
629 nmdc:mga00v17_28164_c1 3300050491 Bacteria 3289
630 nmdc:mga0yw44_13938_c1 3300050492 Bacteria 4250
631 nmdc:mga0yw44_460892_c1 3300050492 Bacteria 861
632 nmdc:mga0k408_110234_c1 3300050493 Bacteria 1627
633 nmdc:mga0k408_1103_c1 3300050493 Bacteria 14781
634 nmdc:mga0k408_117393_c1 3300050493 Bacteria 1575
635 nmdc:mga0k408_192315_c1 3300050493 Bacteria 1218
636 nmdc:mga0k408_203424_c1 3300050493 Bacteria 1182
637 nmdc:mga0k408_250777_c1 3300050493 Bacteria 1057
638 nmdc:mga0k408_416660_c1 3300050493 Bacteria 799
639 nmdc:mga0k408_53151_c2 3300050493 Bacteria 2023
640 nmdc:mga0k408_5513_c1 3300050493 Bacteria 6735
641 nmdc:mga0k408_57336_c1 3300050493 Bacteria 2261
642 nmdc:mga06z11_123202_c1 3300050494 Bacteria 1448
643 nmdc:mga06z11_38598_c1 3300050494 Bacteria 2373
644 nmdc:mga06z11_862_c1 3300050494 Bacteria 11061
645 nmdc:mga04h51_3500_c1 3300050495 Bacteria 3819
646 nmdc:mga04h51_9485_c1 3300050495 Bacteria 2641
647 nmdc:mga07m45_17593_c1 3300050496 Bacteria 3843
648 nmdc:mga07m45_25358_c1 3300050496 Bacteria 3252
649 nmdc:mga07m45_349666_c1 3300050496 Bacteria 859
650 nmdc:mga07m45_3671_c1 3300050496 Bacteria 7418
651 nmdc:mga07m45_42_c1 3300050496 Bacteria 58731
652 nmdc:mga07m45_53357_c1 3300050496 Bacteria 2284
653 nmdc:mga07m45_6482_c1 3300050496 Bacteria 5919
654 nmdc:mga07m45_678_c2 3300050496 Bacteria 13120
655 nmdc:mga07m45_74121_c1 3300050496 Bacteria 1939
656 nmdc:mga07m45_74737_c1 3300050496 Bacteria 1931
657 nmdc:mga07m45_9426_c1 3300050496 Bacteria 5066
658 nmdc:mga09592_691080_c1 3300050508 Bacteria 869
659 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
660 nmdc:mga0qj67_256481_c1 3300050509 Bacteria 1419
661 nmdc:mga06r32_968087_c1 3300050510 Bacteria 805
662 nmdc:mga08y16_437046_c1 3300050511 Bacteria 1336
663 nmdc:mga0sz30_8809_c1 3300050516 Bacteria 3823
664 Ga0495601_0042029 3300053077 Bacteria 2867
665 Ga0495595_0194234 3300053084 Bacteria 1009
666 Ga0495619_0012300 3300053085 Bacteria 5386
667 Ga0495619_0161263 3300053085 Bacteria 1549
668 Ga0500578_0001649 3300053086 Bacteria 21508
669 Ga0500578_0031796 3300053086 Bacteria 3392
670 Ga0500644_0000852 3300053088 Bacteria 10154
671 Ga0500646_0035588 3300053090 Bacteria 1384
672 Ga0500583_0076367 3300053092 Bacteria 1611
673 Ga0500583_0314632 3300053092 Bacteria 764
674 Ga0500651_0030527 3300053093 Bacteria 3390
675 Ga0500651_0074794 3300053093 Bacteria 2105
676 Ga0500650_0065133 3300053098 Bacteria 1702
677 Ga0500650_0227918 3300053098 Bacteria 841
678 Ga0500593_122548 3300053117 Bacteria 1051
679 Ga0500642_0024727 3300053130 Bacteria 2430
680 Ga0500652_000263 3300053131 Bacteria 19634
681 Ga0500652_026551 3300053131 Bacteria 2231
682 Ga0500655_025944 3300053133 Bacteria 1113
683 Ga0500658_0005271 3300053134 Bacteria 4810
684 Ga0500561_0040562 3300053137 Bacteria 1227
685 Ga0500568_0087511 3300053139 Bacteria 1177
686 Ga0500568_0144076 3300053139 Bacteria 882
687 Ga0500577_0155974 3300053142 Bacteria 970
688 Ga0500616_0000001 3300053153 Bacteria 1986011
689 Ga0500619_031869 3300053154 Bacteria 1612
690 Ga0500622_0001292 3300053156 Bacteria 20381
691 Ga0500627_0012493 3300053158 Bacteria 3186
692 Ga0500636_0176962 3300053177 Bacteria 1149
693 Ga0500570_119664 3300053724 Bacteria 1038
694 Ga0500645_062633 3300053730 Bacteria 1074
695 Ga0501082_0210377 3300060353 Bacteria 1692
696 Ga0501082_0605194 3300060353 Bacteria 959
697 Ga0466962_0001856 3300061719 Bacteria 9932
698 Ga0466962_0005417 3300061719 Bacteria 6135
699 Ga0466962_0044851 3300061719 Bacteria 2114

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0085909 Ga0395905_0085909_2372_2908 169
2 3300044656 Ga0466969_0000640 Ga0466969_0000640_16137_16673 169
3 3300044684 Ga0466966_0002104 Ga0466966_0002104_5927_6463 169
4 3300044693 Ga0466961_0042894 Ga0466961_0042894_1813_2349 169
5 3300044719 Ga0466971_0004888 Ga0466971_0004888_3563_4099 169
6 3300044765 Ga0466970_0038027 Ga0466970_0038027_1279_1815 169
7 3300044842 Ga0466957_0040992 Ga0466957_0040992_2166_2702 169
8 3300045049 Ga0466959_0001324 Ga0466959_0001324_12434_12970 169
9 3300061719 Ga0466962_0001856 Ga0466962_0001856_7595_8131 169
10 3300006846 Ga0075430_100000276 Ga0075430_10000027622 171
11 3300047320 Ga0495672_0303791 Ga0495672_0303791_229_744 171
12 3300050509 nmdc:mga0qj67_18_c1 nmdc:mga0qj67_18_c1_76077_76592 171
13 iso_pu_bacteria 8008485437 8008489359 171
14 iso_pu_bacteria 8025524527 8025529065 171
15 3300031995 Ga0307409_100519124 Ga0307409_1005191242 172
16 3300032005 Ga0307411_10820882 Ga0307411_108208822 172
17 3300050493 nmdc:mga0k408_57336_c1 nmdc:mga0k408_57336_c1_1111_1629 172
18 3300039437 Ga0436365_1527322 Ga0436365_1527322_440_961 173
19 3300041505 Ga0451849_1333857 Ga0451849_1333857_14_535 173
20 3300049570 Ga0501033_0614811 Ga0501033_0614811_96_620 173
21 3300049581 Ga0501047_0772724 Ga0501047_0772724_233_757 173
22 3300053088 Ga0500644_0000852 Ga0500644_0000852_1088_1624 173
23 3300053153 Ga0500616_0000001 Ga0500616_0000001_1400566_1401102 173
24 iso_pu_bacteria 2643221544 2643746873 173
25 iso_pu_bacteria 2643221646 2644259894 173
26 iso_pu_bacteria 2738541337 2739057555 173
27 3300005356 Ga0070674_101443897 Ga0070674_1014438971 174
28 3300006846 Ga0075430_100138515 Ga0075430_1001385153 174
29 3300006847 Ga0075431_100034277 Ga0075431_1000342773 174
30 3300006880 Ga0075429_100682159 Ga0075429_1006821592 174
31 3300009098 Ga0105245_10257453 Ga0105245_102574532 174
32 3300013306 Ga0163162_11235551 Ga0163162_112355512 174
33 3300037418 Ga0395900_0131850 Ga0395900_0131850_1601_2125 174
34 3300037471 Ga0395905_0131557 Ga0395905_0131557_1019_1543 174
35 3300044735 Ga0466968_0063314 Ga0466968_0063314_372_902 174
36 3300049744 Ga0501083_0020387 Ga0501083_0020387_1844_2368 174
37 3300050492 nmdc:mga0yw44_460892_c1 nmdc:mga0yw44_460892_c1_128_652 174
38 3300050493 nmdc:mga0k408_53151_c2 nmdc:mga0k408_53151_c2_120_644 174
39 3300050508 nmdc:mga09592_691080_c1 nmdc:mga09592_691080_c1_290_832 174
40 3300050509 nmdc:mga0qj67_256481_c1 nmdc:mga0qj67_256481_c1_508_1050 174
41 3300050510 nmdc:mga06r32_968087_c1 nmdc:mga06r32_968087_c1_16_558 174
42 iso_pu_bacteria 2928972540 2928975075 174
43 3300005327 Ga0070658_10175324 Ga0070658_101753243 175
44 3300005328 Ga0070676_10014860 Ga0070676_100148604 175
45 3300005330 Ga0070690_100025986 Ga0070690_1000259864 175
46 3300005331 Ga0070670_100034202 Ga0070670_1000342024 175
47 3300005331 Ga0070670_100154253 Ga0070670_1001542533 175
48 3300005331 Ga0070670_100189689 Ga0070670_1001896893 175
49 3300005331 Ga0070670_100201949 Ga0070670_1002019494 175
50 3300005331 Ga0070670_100546112 Ga0070670_1005461122 175
51 3300005333 Ga0070677_10010433 Ga0070677_100104334 175
52 3300005334 Ga0068869_100068206 Ga0068869_1000682064 175
53 3300005335 Ga0070666_10031672 Ga0070666_100316723 175
54 3300005335 Ga0070666_10648026 Ga0070666_106480261 175
55 3300005336 Ga0070680_100063571 Ga0070680_1000635714 175
56 3300005344 Ga0070661_100216549 Ga0070661_1002165493 175
57 3300005344 Ga0070661_100243120 Ga0070661_1002431202 175
58 3300005344 Ga0070661_100773009 Ga0070661_1007730091 175
59 3300005347 Ga0070668_100029372 Ga0070668_1000293722 175
60 3300005353 Ga0070669_100094865 Ga0070669_1000948652 175
61 3300005354 Ga0070675_100157873 Ga0070675_1001578731 175
62 3300005354 Ga0070675_100255222 Ga0070675_1002552223 175
63 3300005354 Ga0070675_100304644 Ga0070675_1003046441 175
64 3300005355 Ga0070671_100017107 Ga0070671_1000171075 175
65 3300005355 Ga0070671_100716595 Ga0070671_1007165951 175
66 3300005355 Ga0070671_100859344 Ga0070671_1008593441 175
67 3300005356 Ga0070674_100029218 Ga0070674_1000292181 175
68 3300005356 Ga0070674_100064420 Ga0070674_1000644204 175
69 3300005364 Ga0070673_100267450 Ga0070673_1002674503 175
70 3300005364 Ga0070673_100354152 Ga0070673_1003541522 175
71 3300005364 Ga0070673_100609382 Ga0070673_1006093822 175
72 3300005367 Ga0070667_100004388 Ga0070667_10000438817 175
73 3300005367 Ga0070667_100169376 Ga0070667_1001693764 175
74 3300005367 Ga0070667_100276275 Ga0070667_1002762753 175
75 3300005441 Ga0070700_100405888 Ga0070700_1004058881 175
76 3300005455 Ga0070663_100106355 Ga0070663_1001063554 175
77 3300005455 Ga0070663_100795743 Ga0070663_1007957431 175
78 3300005456 Ga0070678_100078197 Ga0070678_1000781973 175
79 3300005456 Ga0070678_100134691 Ga0070678_1001346913 175
80 3300005456 Ga0070678_100375739 Ga0070678_1003757392 175
81 3300005456 Ga0070678_101076557 Ga0070678_1010765571 175
82 3300005457 Ga0070662_100023184 Ga0070662_1000231844 175
83 3300005457 Ga0070662_100073830 Ga0070662_1000738304 175
84 3300005459 Ga0068867_100095372 Ga0068867_1000953722 175
85 3300005459 Ga0068867_100635945 Ga0068867_1006359452 175
86 3300005530 Ga0070679_100021313 Ga0070679_1000213134 175
87 3300005535 Ga0070684_100174632 Ga0070684_1001746323 175
88 3300005535 Ga0070684_100690595 Ga0070684_1006905952 175
89 3300005543 Ga0070672_100039130 Ga0070672_1000391303 175
90 3300005543 Ga0070672_100064493 Ga0070672_1000644932 175
91 3300005543 Ga0070672_100108581 Ga0070672_1001085813 175
92 3300005543 Ga0070672_100110940 Ga0070672_1001109402 175
93 3300005543 Ga0070672_100845456 Ga0070672_1008454562 175
94 3300005544 Ga0070686_100119616 Ga0070686_1001196163 175
95 3300005547 Ga0070693_100648521 Ga0070693_1006485211 175
96 3300005563 Ga0068855_100282473 Ga0068855_1002824732 175
97 3300005563 Ga0068855_101314445 Ga0068855_1013144452 175
98 3300005564 Ga0070664_100060332 Ga0070664_1000603324 175
99 3300005564 Ga0070664_100382778 Ga0070664_1003827782 175
100 3300005564 Ga0070664_100751193 Ga0070664_1007511932 175
101 3300005578 Ga0068854_100350207 Ga0068854_1003502072 175
102 3300005578 Ga0068854_100622988 Ga0068854_1006229882 175
103 3300005616 Ga0068852_100858564 Ga0068852_1008585642 175
104 3300005616 Ga0068852_100979678 Ga0068852_1009796782 175
105 3300005616 Ga0068852_101010263 Ga0068852_1010102632 175
106 3300005617 Ga0068859_100135444 Ga0068859_1001354443 175
107 3300005618 Ga0068864_100046435 Ga0068864_1000464352 175
108 3300005618 Ga0068864_100157469 Ga0068864_1001574692 175
109 3300005618 Ga0068864_100793040 Ga0068864_1007930402 175
110 3300005618 Ga0068864_100807020 Ga0068864_1008070202 175
111 3300005618 Ga0068864_100896548 Ga0068864_1008965481 175
112 3300005718 Ga0068866_10095345 Ga0068866_100953452 175
113 3300005718 Ga0068866_10366802 Ga0068866_103668022 175
114 3300005719 Ga0068861_100301307 Ga0068861_1003013073 175
115 3300005719 Ga0068861_100499223 Ga0068861_1004992231 175
116 3300005841 Ga0068863_100053520 Ga0068863_1000535203 175
117 3300005841 Ga0068863_100315660 Ga0068863_1003156603 175
118 3300005842 Ga0068858_100003791 Ga0068858_10000379118 175
119 3300005843 Ga0068860_100004033 Ga0068860_10000403317 175
120 3300005844 Ga0068862_100005370 Ga0068862_10000537010 175
121 3300006163 Ga0070715_10396644 Ga0070715_103966441 175
122 3300006237 Ga0097621_100170721 Ga0097621_1001707212 175
123 3300006237 Ga0097621_101335742 Ga0097621_1013357421 175
124 3300006358 Ga0068871_100037260 Ga0068871_1000372606 175
125 3300006358 Ga0068871_100137485 Ga0068871_1001374853 175
126 3300006881 Ga0068865_100222079 Ga0068865_1002220793 175
127 3300006931 Ga0097620_100135435 Ga0097620_1001354353 175
128 3300009176 Ga0105242_10274465 Ga0105242_102744652 175
129 3300009177 Ga0105248_10209361 Ga0105248_102093613 175
130 3300009177 Ga0105248_10368514 Ga0105248_103685143 175
131 3300009551 Ga0105238_11749555 Ga0105238_117495551 175
132 3300013100 Ga0157373_10038721 Ga0157373_100387213 175
133 3300013102 Ga0157371_10207035 Ga0157371_102070352 175
134 3300013104 Ga0157370_10742816 Ga0157370_107428162 175
135 3300013105 Ga0157369_10065353 Ga0157369_100653532 175
136 3300013296 Ga0157374_10385984 Ga0157374_103859842 175
137 3300013296 Ga0157374_10496992 Ga0157374_104969922 175
138 3300013297 Ga0157378_10056830 Ga0157378_100568303 175
139 3300013307 Ga0157372_10167119 Ga0157372_101671194 175
140 3300013308 Ga0157375_10012775 Ga0157375_100127753 175
141 3300013308 Ga0157375_10184225 Ga0157375_101842254 175
142 3300014325 Ga0163163_10435639 Ga0163163_104356392 175
143 3300014325 Ga0163163_11680361 Ga0163163_116803611 175
144 3300014326 Ga0157380_10134265 Ga0157380_101342652 175
145 3300014745 Ga0157377_10518514 Ga0157377_105185142 175
146 3300014968 Ga0157379_10282749 Ga0157379_102827492 175
147 3300014968 Ga0157379_10879047 Ga0157379_108790471 175
148 3300014968 Ga0157379_11031976 Ga0157379_110319762 175
149 3300015265 Ga0182005_1054393 Ga0182005_10543932 175
150 3300017792 Ga0163161_11081601 Ga0163161_110816011 175
151 3300025315 Ga0207697_10022812 Ga0207697_100228122 175
152 3300025893 Ga0207682_10008329 Ga0207682_100083294 175
153 3300025893 Ga0207682_10015553 Ga0207682_100155533 175
154 3300025899 Ga0207642_10017450 Ga0207642_100174504 175
155 3300025899 Ga0207642_10283320 Ga0207642_102833202 175
156 3300025901 Ga0207688_10056594 Ga0207688_100565943 175
157 3300025903 Ga0207680_10032671 Ga0207680_100326713 175
158 3300025903 Ga0207680_10042631 Ga0207680_100426312 175
159 3300025907 Ga0207645_10020411 Ga0207645_100204114 175
160 3300025908 Ga0207643_10524779 Ga0207643_105247792 175
161 3300025917 Ga0207660_10021246 Ga0207660_100212464 175
162 3300025919 Ga0207657_10236997 Ga0207657_102369972 175
163 3300025920 Ga0207649_10450271 Ga0207649_104502712 175
164 3300025921 Ga0207652_10008328 Ga0207652_100083284 175
165 3300025923 Ga0207681_10002043 Ga0207681_1000204313 175
166 3300025923 Ga0207681_10138395 Ga0207681_101383952 175
167 3300025924 Ga0207694_10345605 Ga0207694_103456052 175
168 3300025925 Ga0207650_10001150 Ga0207650_1000115017 175
169 3300025925 Ga0207650_10052371 Ga0207650_100523712 175
170 3300025925 Ga0207650_10286159 Ga0207650_102861592 175
171 3300025926 Ga0207659_10021737 Ga0207659_100217376 175
172 3300025926 Ga0207659_10562337 Ga0207659_105623372 175
173 3300025931 Ga0207644_10005994 Ga0207644_100059947 175
174 3300025931 Ga0207644_10556920 Ga0207644_105569202 175
175 3300025931 Ga0207644_10958669 Ga0207644_109586691 175
176 3300025932 Ga0207690_10477561 Ga0207690_104775612 175
177 3300025932 Ga0207690_10572212 Ga0207690_105722122 175
178 3300025933 Ga0207706_10033661 Ga0207706_100336614 175
179 3300025933 Ga0207706_10051513 Ga0207706_100515134 175
180 3300025934 Ga0207686_10409046 Ga0207686_104090462 175
181 3300025934 Ga0207686_11087071 Ga0207686_110870711 175
182 3300025935 Ga0207709_10021965 Ga0207709_100219652 175
183 3300025936 Ga0207670_10197720 Ga0207670_101977203 175
184 3300025937 Ga0207669_10123252 Ga0207669_101232524 175
185 3300025937 Ga0207669_10138851 Ga0207669_101388513 175
186 3300025937 Ga0207669_10326427 Ga0207669_103264272 175
187 3300025938 Ga0207704_10008974 Ga0207704_100089744 175
188 3300025940 Ga0207691_10268024 Ga0207691_102680243 175
189 3300025940 Ga0207691_10342612 Ga0207691_103426123 175
190 3300025940 Ga0207691_10501637 Ga0207691_105016372 175
191 3300025941 Ga0207711_10063030 Ga0207711_100630305 175
192 3300025941 Ga0207711_10726230 Ga0207711_107262302 175
193 3300025942 Ga0207689_10016368 Ga0207689_100163684 175
194 3300025944 Ga0207661_10245559 Ga0207661_102455592 175
195 3300025945 Ga0207679_10395117 Ga0207679_103951172 175
196 3300025960 Ga0207651_10335609 Ga0207651_103356093 175
197 3300025960 Ga0207651_10401972 Ga0207651_104019722 175
198 3300025960 Ga0207651_10571754 Ga0207651_105717542 175
199 3300025960 Ga0207651_10970971 Ga0207651_109709711 175
200 3300025960 Ga0207651_11290003 Ga0207651_112900031 175
201 3300025961 Ga0207712_10043014 Ga0207712_100430144 175
202 3300025972 Ga0207668_10003052 Ga0207668_100030527 175
203 3300025981 Ga0207640_10071608 Ga0207640_100716083 175
204 3300025981 Ga0207640_10165065 Ga0207640_101650652 175
205 3300025986 Ga0207658_10010815 Ga0207658_100108154 175
206 3300026023 Ga0207677_10197248 Ga0207677_101972482 175
207 3300026035 Ga0207703_10001541 Ga0207703_1000154118 175
208 3300026067 Ga0207678_10076508 Ga0207678_100765084 175
209 3300026067 Ga0207678_10631026 Ga0207678_106310262 175
210 3300026075 Ga0207708_10036858 Ga0207708_100368584 175
211 3300026078 Ga0207702_10171048 Ga0207702_101710483 175
212 3300026078 Ga0207702_11297420 Ga0207702_112974201 175
213 3300026088 Ga0207641_10000655 Ga0207641_1000065529 175
214 3300026088 Ga0207641_10037046 Ga0207641_100370464 175
215 3300026088 Ga0207641_10244785 Ga0207641_102447853 175
216 3300026089 Ga0207648_10006616 Ga0207648_100066162 175
217 3300026095 Ga0207676_10060635 Ga0207676_100606352 175
218 3300026095 Ga0207676_10271087 Ga0207676_102710871 175
219 3300026095 Ga0207676_10321090 Ga0207676_103210902 175
220 3300026095 Ga0207676_10514698 Ga0207676_105146983 175
221 3300026116 Ga0207674_10916080 Ga0207674_109160802 175
222 3300026116 Ga0207674_11246651 Ga0207674_112466511 175
223 3300026118 Ga0207675_100095530 Ga0207675_1000955304 175
224 3300026118 Ga0207675_101036988 Ga0207675_1010369882 175
225 3300026121 Ga0207683_10113189 Ga0207683_101131892 175
226 3300026121 Ga0207683_10158397 Ga0207683_101583973 175
227 3300026121 Ga0207683_10187000 Ga0207683_101870001 175
228 3300026121 Ga0207683_11290885 Ga0207683_112908851 175
229 3300026142 Ga0207698_10114183 Ga0207698_101141834 175
230 3300026142 Ga0207698_10897436 Ga0207698_108974362 175
231 3300026142 Ga0207698_10932246 Ga0207698_109322462 175
232 3300028379 Ga0268266_10347242 Ga0268266_103472423 175
233 3300028380 Ga0268265_10003715 Ga0268265_1000371510 175
234 3300028381 Ga0268264_10002170 Ga0268264_1000217013 175
235 3300031616 Ga0307508_10058240 Ga0307508_100582402 175
236 3300031730 Ga0307516_10297671 Ga0307516_102976712 175
237 3300035116 Ga0373945_0043125 Ga0373945_0043125_200_727 175
238 3300035118 Ga0373954_0055761 Ga0373954_0055761_336_863 175
239 3300035120 Ga0373957_0073248 Ga0373957_0073248_85_612 175
240 3300035171 Ga0373946_0264695 Ga0373946_0264695_13_540 175
241 3300035410 Ga0373924_0092603 Ga0373924_0092603_206_733 175
242 3300035692 Ga0373935_0118199 Ga0373935_0118199_998_1525 175
243 3300035724 Ga0373933_0246301 Ga0373933_0246301_603_1130 175
244 3300035725 Ga0373947_0596344 Ga0373947_0596344_24_551 175
245 3300035725 Ga0373947_0800336 Ga0373947_0800336_53_580 175
246 3300036401 Ga0373937_0048281 Ga0373937_0048281_2082_2609 175
247 3300036401 Ga0373937_0220034 Ga0373937_0220034_1173_1700 175
248 3300037068 Ga0373925_0945811 Ga0373925_0945811_153_680 175
249 3300039437 Ga0436365_1746291 Ga0436365_1746291_514_1041 175
250 3300041463 Ga0451804_0697290 Ga0451804_0697290_21_548 175
251 3300046459 Ga0495629_0210294 Ga0495629_0210294_540_1067 175
252 3300046472 Ga0495580_0279121 Ga0495580_0279121_345_872 175
253 3300046535 Ga0495586_0083944 Ga0495586_0083944_366_893 175
254 3300046536 Ga0495587_0501596 Ga0495587_0501596_87_614 175
255 3300046537 Ga0495598_0005228 Ga0495598_0005228_23_550 175
256 3300046543 Ga0495645_0305689 Ga0495645_0305689_158_685 175
257 3300046543 Ga0495645_0348092 Ga0495645_0348092_65_592 175
258 3300046663 Ga0495635_0177890 Ga0495635_0177890_396_923 175
259 3300046681 Ga0495647_0016908 Ga0495647_0016908_711_1238 175
260 3300046683 Ga0495658_0054733 Ga0495658_0054733_320_847 175
261 3300046809 Ga0495600_0218774 Ga0495600_0218774_156_683 175
262 3300047471 Ga0495684_0131409 Ga0495684_0131409_515_1042 175
263 3300047472 Ga0495686_0002472 Ga0495686_0002472_13660_14187 175
264 3300048090 Ga0495615_0109221 Ga0495615_0109221_253_780 175
265 3300048907 Ga0496104_0324693 Ga0496104_0324693_416_943 175
266 3300048911 Ga0496108_0174344 Ga0496108_0174344_530_1057 175
267 3300048911 Ga0496108_0386617 Ga0496108_0386617_254_781 175
268 3300048912 Ga0496109_1002921 Ga0496109_1002921_176_703 175
269 3300048913 Ga0496110_0563763 Ga0496110_0563763_141_668 175
270 3300048917 Ga0496114_0085754 Ga0496114_0085754_1475_2002 175
271 3300048917 Ga0496114_0809535 Ga0496114_0809535_224_751 175
272 3300049568 Ga0501031_0023849 Ga0501031_0023849_21_551 175
273 3300049571 Ga0501034_0192270 Ga0501034_0192270_475_1005 175
274 3300049573 Ga0501037_0588831 Ga0501037_0588831_53_583 175
275 3300049574 Ga0501038_0074082 Ga0501038_0074082_2324_2854 175
276 3300049579 Ga0501043_0040718 Ga0501043_0040718_2275_2805 175
277 3300049586 Ga0501070_0651930 Ga0501070_0651930_261_791 175
278 3300049823 Ga0501044_0422711 Ga0501044_0422711_584_1114 175
279 3300050511 nmdc:mga08y16_437046_c1 nmdc:mga08y16_437046_c1_261_788 175
280 3300053077 Ga0495601_0042029 Ga0495601_0042029_1324_1851 175
281 3300053084 Ga0495595_0194234 Ga0495595_0194234_331_858 175
282 3300053085 Ga0495619_0012300 Ga0495619_0012300_1107_1634 175
283 3300053085 Ga0495619_0161263 Ga0495619_0161263_977_1504 175
284 3300005844 Ga0068862_100746325 Ga0068862_1007463251 176
285 3300006038 Ga0075365_10162891 Ga0075365_101628912 176
286 3300006042 Ga0075368_10049413 Ga0075368_100494132 176
287 3300006048 Ga0075363_100027648 Ga0075363_1000276483 176
288 3300006051 Ga0075364_10016731 Ga0075364_100167312 176
289 3300006195 Ga0075366_10024666 Ga0075366_100246662 176
290 3300006353 Ga0075370_10007825 Ga0075370_100078256 176
291 3300028794 Ga0307515_10078173 Ga0307515_100781733 176
292 3300031456 Ga0307513_10034000 Ga0307513_100340008 176
293 3300032005 Ga0307411_10513124 Ga0307411_105131241 176
294 3300032126 Ga0307415_100666264 Ga0307415_1006662642 176
295 3300035114 Ga0373939_0205096 Ga0373939_0205096_49_666 176
296 3300046452 Ga0495617_063430 Ga0495617_063430_325_855 176
297 3300046453 Ga0495627_000064 Ga0495627_000064_112429_112983 176
298 3300046471 Ga0495650_0022520 Ga0495650_0022520_2080_2610 176
299 3300046518 Ga0495631_0000188 Ga0495631_0000188_6953_7507 176
300 3300046519 Ga0495632_0059359 Ga0495632_0059359_441_971 176
301 3300046530 Ga0495654_0004383 Ga0495654_0004383_3707_4261 176
302 3300046692 Ga0495671_0004098 Ga0495671_0004098_449_979 176
303 3300047320 Ga0495672_0001209 Ga0495672_0001209_19360_19914 176
304 3300050493 nmdc:mga0k408_110234_c1 nmdc:mga0k408_110234_c1_95_625 176
305 3300050494 nmdc:mga06z11_38598_c1 nmdc:mga06z11_38598_c1_842_1372 176
306 3300050496 nmdc:mga07m45_53357_c1 nmdc:mga07m45_53357_c1_1128_1658 176
307 iso_pu_bacteria 2585428057 2587725006 176
308 iso_pu_bacteria 2585428058 2587731632 176
309 iso_pu_bacteria 2588253510 2588292513 176
310 iso_pu_bacteria 2643221592 2643968112 176
311 iso_pu_bacteria 2643221625 2644142532 176
312 iso_pu_bacteria 2643221648 2644276969 176
313 iso_pu_bacteria 2643221654 2644304064 176
314 3300003316 rootH1_10007880 rootH1_100078804 177
315 3300003322 rootL2_10001083 rootL2_100010831 177
316 3300003322 rootL2_10066719 rootL2_100667192 177
317 3300003323 rootH1_10017493 rootH1_100174933 177
318 3300003323 rootH1_10077402 rootH1_100774025 177
319 3300005328 Ga0070676_10233418 Ga0070676_102334181 177
320 3300005355 Ga0070671_100631594 Ga0070671_1006315941 177
321 3300005356 Ga0070674_100190740 Ga0070674_1001907401 177
322 3300005364 Ga0070673_100775346 Ga0070673_1007753461 177
323 3300005367 Ga0070667_101231522 Ga0070667_1012315221 177
324 3300005455 Ga0070663_100054597 Ga0070663_1000545973 177
325 3300005457 Ga0070662_100022743 Ga0070662_1000227433 177
326 3300005577 Ga0068857_100081284 Ga0068857_1000812844 177
327 3300005577 Ga0068857_100557525 Ga0068857_1005575252 177
328 3300005577 Ga0068857_101110459 Ga0068857_1011104592 177
329 3300005578 Ga0068854_100115079 Ga0068854_1001150793 177
330 3300005616 Ga0068852_100055501 Ga0068852_1000555014 177
331 3300006038 Ga0075365_10006162 Ga0075365_100061626 177
332 3300006042 Ga0075368_10007583 Ga0075368_100075834 177
333 3300006042 Ga0075368_10020604 Ga0075368_100206042 177
334 3300006048 Ga0075363_100006792 Ga0075363_1000067927 177
335 3300006048 Ga0075363_100026281 Ga0075363_1000262812 177
336 3300006051 Ga0075364_10029373 Ga0075364_100293736 177
337 3300006177 Ga0075362_10015745 Ga0075362_100157453 177
338 3300006177 Ga0075362_10024040 Ga0075362_100240405 177
339 3300006177 Ga0075362_10159420 Ga0075362_101594202 177
340 3300006178 Ga0075367_10001597 Ga0075367_100015974 177
341 3300006178 Ga0075367_10005029 Ga0075367_100050297 177
342 3300006178 Ga0075367_10225898 Ga0075367_102258981 177
343 3300006186 Ga0075369_10027826 Ga0075369_100278263 177
344 3300006195 Ga0075366_10000433 Ga0075366_1000043323 177
345 3300006195 Ga0075366_10045787 Ga0075366_100457873 177
346 3300006195 Ga0075366_10104698 Ga0075366_101046982 177
347 3300006195 Ga0075366_10237157 Ga0075366_102371572 177
348 3300006353 Ga0075370_10000538 Ga0075370_1000053812 177
349 3300006353 Ga0075370_10000846 Ga0075370_1000084614 177
350 3300006353 Ga0075370_10106550 Ga0075370_101065503 177
351 3300006353 Ga0075370_10359469 Ga0075370_103594691 177
352 3300009093 Ga0105240_10406149 Ga0105240_104061492 177
353 3300009148 Ga0105243_10033813 Ga0105243_100338136 177
354 3300009148 Ga0105243_10059454 Ga0105243_100594541 177
355 3300009545 Ga0105237_10012662 Ga0105237_100126628 177
356 3300009553 Ga0105249_10044015 Ga0105249_100440155 177
357 3300010375 Ga0105239_10037984 Ga0105239_100379844 177
358 3300013297 Ga0157378_10375476 Ga0157378_103754762 177
359 3300013306 Ga0163162_10022860 Ga0163162_100228603 177
360 3300013308 Ga0157375_10055359 Ga0157375_100553593 177
361 3300014326 Ga0157380_10021608 Ga0157380_100216082 177
362 3300014968 Ga0157379_10048970 Ga0157379_100489703 177
363 3300014969 Ga0157376_10182194 Ga0157376_101821943 177
364 3300021361 Ga0213872_10000140 Ga0213872_1000014028 177
365 3300025903 Ga0207680_10509812 Ga0207680_105098121 177
366 3300025913 Ga0207695_10388199 Ga0207695_103881992 177
367 3300025914 Ga0207671_10090935 Ga0207671_100909352 177
368 3300025931 Ga0207644_10321717 Ga0207644_103217172 177
369 3300025933 Ga0207706_10008308 Ga0207706_100083085 177
370 3300025935 Ga0207709_10456811 Ga0207709_104568111 177
371 3300025960 Ga0207651_10353012 Ga0207651_103530122 177
372 3300025981 Ga0207640_10074430 Ga0207640_100744303 177
373 3300026067 Ga0207678_10084333 Ga0207678_100843333 177
374 3300026116 Ga0207674_10036354 Ga0207674_100363546 177
375 3300026142 Ga0207698_10052815 Ga0207698_100528154 177
376 3300027866 Ga0209813_10003088 Ga0209813_100030882 177
377 3300027866 Ga0209813_10008646 Ga0209813_100086464 177
378 3300028794 Ga0307515_10200216 Ga0307515_102002162 177
379 3300031456 Ga0307513_10166466 Ga0307513_101664663 177
380 3300031548 Ga0307408_100000038 Ga0307408_10000003899 177
381 3300031548 Ga0307408_100691637 Ga0307408_1006916371 177
382 3300032002 Ga0307416_100098684 Ga0307416_1000986844 177
383 3300032004 Ga0307414_10219966 Ga0307414_102199663 177
384 3300032005 Ga0307411_10000214 Ga0307411_1000021417 177
385 3300034820 Ga0373959_0011717 Ga0373959_0011717_830_1372 177
386 3300035090 Ga0373949_0117633 Ga0373949_0117633_12_557 177
387 3300035091 Ga0373951_0006045 Ga0373951_0006045_531_1076 177
388 3300035114 Ga0373939_0000092 Ga0373939_0000092_16129_16674 177
389 3300035691 Ga0373931_0000403 Ga0373931_0000403_8542_9087 177
390 3300037471 Ga0395905_0007537 Ga0395905_0007537_4088_4636 177
391 3300039447 Ga0436361_0033949 Ga0436361_0033949_829_1389 177
392 3300039447 Ga0436361_0749433 Ga0436361_0749433_25353_25922 177
393 3300042004 Ga0439445_0039050 Ga0439445_0039050_195_743 177
394 3300042116 Ga0450912_003383 Ga0450912_003383_378_926 177
395 3300042126 Ga0450888_001013 Ga0450888_001013_1264_1812 177
396 3300042127 Ga0450890_000737 Ga0450890_000737_1605_2153 177
397 3300042127 Ga0450890_016996 Ga0450890_016996_312_860 177
398 3300042129 Ga0450891_000527 Ga0450891_000527_1390_1938 177
399 3300042130 Ga0450892_001234 Ga0450892_001234_439_987 177
400 3300042137 Ga0450902_002503 Ga0450902_002503_729_1277 177
401 3300042138 Ga0450903_007340 Ga0450903_007340_446_994 177
402 3300042144 Ga0450889_000335 Ga0450889_000335_3371_3919 177
403 3300045051 Ga0451576_0041466 Ga0451576_0041466_3818_4363 177
404 3300046452 Ga0495617_028456 Ga0495617_028456_372_905 177
405 3300046457 Ga0495590_0063523 Ga0495590_0063523_192_725 177
406 3300046458 Ga0495591_007342 Ga0495591_007342_2502_3035 177
407 3300046474 Ga0495605_0161223 Ga0495605_0161223_133_666 177
408 3300046491 Ga0495584_0011483 Ga0495584_0011483_1519_2052 177
409 3300046492 Ga0495585_0157347 Ga0495585_0157347_455_988 177
410 3300046500 Ga0495596_0013038 Ga0495596_0013038_1058_1591 177
411 3300046501 Ga0495607_0014048 Ga0495607_0014048_1075_1608 177
412 3300046518 Ga0495631_0069679 Ga0495631_0069679_361_894 177
413 3300046519 Ga0495632_0182342 Ga0495632_0182342_171_704 177
414 3300046520 Ga0495637_0000027 Ga0495637_0000027_117442_117975 177
415 3300046524 Ga0495648_0018920 Ga0495648_0018920_1783_2316 177
416 3300046528 Ga0495642_0025588 Ga0495642_0025588_819_1352 177
417 3300046530 Ga0495654_0033670 Ga0495654_0033670_944_1477 177
418 3300046616 Ga0495668_0111330 Ga0495668_0111330_167_700 177
419 3300046648 Ga0495611_0000387 Ga0495611_0000387_25434_25967 177
420 3300046648 Ga0495611_0085217 Ga0495611_0085217_185_718 177
421 3300046660 Ga0495625_0109410 Ga0495625_0109410_1284_1817 177
422 3300046665 Ga0495661_0000119 Ga0495661_0000119_10286_10819 177
423 3300046692 Ga0495671_0351677 Ga0495671_0351677_23_556 177
424 3300046694 Ga0495649_0033682 Ga0495649_0033682_1539_2072 177
425 3300046810 Ga0495660_0009019 Ga0495660_0009019_1925_2458 177
426 3300047318 Ga0495636_0206736 Ga0495636_0206736_207_740 177
427 3300047323 Ga0495683_0067765 Ga0495683_0067765_447_980 177
428 3300047443 Ga0495687_067083 Ga0495687_067083_259_792 177
429 3300047446 Ga0495679_003634 Ga0495679_003634_4443_4976 177
430 3300047469 Ga0495673_0015333 Ga0495673_0015333_208_741 177
431 3300047470 Ga0495681_0018390 Ga0495681_0018390_2876_3409 177
432 3300047472 Ga0495686_0017940 Ga0495686_0017940_3160_3693 177
433 3300048091 Ga0495626_0024170 Ga0495626_0024170_2061_2594 177
434 3300048927 Ga0496124_0001949 Ga0496124_0001949_12743_13276 177
435 3300049129 Ga0501309_000375 Ga0501309_000375_460_1008 177
436 3300049130 Ga0501310_000289 Ga0501310_000289_2709_3257 177
437 3300049459 Ga0495678_003717 Ga0495678_003717_6225_6758 177
438 3300049519 Ga0501296_015210 Ga0501296_015210_18_566 177
439 3300049589 Ga0501073_0258670 Ga0501073_0258670_222_764 177
440 3300049662 Ga0501222_002799 Ga0501222_002799_754_1302 177
441 3300049669 Ga0501235_006024 Ga0501235_006024_966_1514 177
442 3300049706 Ga0501229_001801 Ga0501229_001801_1630_2178 177
443 3300049762 Ga0501265_007658 Ga0501265_007658_129_662 177
444 3300049769 Ga0501272_013324 Ga0501272_013324_16_564 177
445 3300050489 nmdc:mga03683_119957_c1 nmdc:mga03683_119957_c1_533_1066 177
446 3300050489 nmdc:mga03683_19275_c1 nmdc:mga03683_19275_c1_1148_1681 177
447 3300050490 nmdc:mga03n38_346253_c1 nmdc:mga03n38_346253_c1_114_650 177
448 3300050490 nmdc:mga03n38_7556_c1 nmdc:mga03n38_7556_c1_1818_2351 177
449 3300050490 nmdc:mga03n38_82306_c1 nmdc:mga03n38_82306_c1_947_1483 177
450 3300050491 nmdc:mga00v17_28164_c1 nmdc:mga00v17_28164_c1_786_1322 177
451 3300050492 nmdc:mga0yw44_13938_c1 nmdc:mga0yw44_13938_c1_2481_3014 177
452 3300050493 nmdc:mga0k408_1103_c1 nmdc:mga0k408_1103_c1_9289_9822 177
453 3300050493 nmdc:mga0k408_192315_c1 nmdc:mga0k408_192315_c1_472_1008 177
454 3300050493 nmdc:mga0k408_203424_c1 nmdc:mga0k408_203424_c1_152_685 177
455 3300050493 nmdc:mga0k408_250777_c1 nmdc:mga0k408_250777_c1_253_792 177
456 3300050493 nmdc:mga0k408_416660_c1 nmdc:mga0k408_416660_c1_73_609 177
457 3300050493 nmdc:mga0k408_5513_c1 nmdc:mga0k408_5513_c1_4292_4828 177
458 3300050494 nmdc:mga06z11_123202_c1 nmdc:mga06z11_123202_c1_816_1352 177
459 3300050494 nmdc:mga06z11_862_c1 nmdc:mga06z11_862_c1_1867_2400 177
460 3300050495 nmdc:mga04h51_3500_c1 nmdc:mga04h51_3500_c1_614_1150 177
461 3300050495 nmdc:mga04h51_9485_c1 nmdc:mga04h51_9485_c1_2035_2568 177
462 3300050496 nmdc:mga07m45_17593_c1 nmdc:mga07m45_17593_c1_144_677 177
463 3300050496 nmdc:mga07m45_25358_c1 nmdc:mga07m45_25358_c1_1759_2292 177
464 3300050496 nmdc:mga07m45_3671_c1 nmdc:mga07m45_3671_c1_4655_5200 177
465 3300050496 nmdc:mga07m45_42_c1 nmdc:mga07m45_42_c1_22044_22580 177
466 3300050496 nmdc:mga07m45_6482_c1 nmdc:mga07m45_6482_c1_4597_5133 177
467 3300050496 nmdc:mga07m45_74121_c1 nmdc:mga07m45_74121_c1_724_1260 177
468 3300050496 nmdc:mga07m45_74737_c1 nmdc:mga07m45_74737_c1_963_1499 177
469 3300050496 nmdc:mga07m45_9426_c1 nmdc:mga07m45_9426_c1_4069_4605 177
470 3300050516 nmdc:mga0sz30_8809_c1 nmdc:mga0sz30_8809_c1_1938_2471 177
471 3300053092 Ga0500583_0314632 Ga0500583_0314632_202_735 177
472 3300053134 Ga0500658_0005271 Ga0500658_0005271_689_1222 177
473 3300003578 Ga0006562J51391_1182578 Ga0006562J51391_11825782 178
474 3300003578 Ga0006562J51391_1182579 Ga0006562J51391_11825793 178
475 3300006177 Ga0075362_10133552 Ga0075362_101335522 178
476 3300013104 Ga0157370_10022640 Ga0157370_100226403 178
477 3300014326 Ga0157380_10334123 Ga0157380_103341232 178
478 3300028794 Ga0307515_10000020 Ga0307515_1000002011 178
479 3300028794 Ga0307515_10000525 Ga0307515_1000052546 178
480 3300028794 Ga0307515_10001484 Ga0307515_1000148459 178
481 3300031730 Ga0307516_10000359 Ga0307516_1000035922 178
482 3300032002 Ga0307416_100222125 Ga0307416_1002221253 178
483 3300035170 Ga0373943_0105569 Ga0373943_0105569_631_1167 178
484 3300035695 Ga0373927_0059536 Ga0373927_0059536_822_1358 178
485 3300035725 Ga0373947_0186530 Ga0373947_0186530_596_1132 178
486 3300037068 Ga0373925_0201079 Ga0373925_0201079_836_1372 178
487 3300037312 Ga0395899_0489779 Ga0395899_0489779_73_609 178
488 3300037471 Ga0395905_0024849 Ga0395905_0024849_3421_3966 178
489 3300041410 Ga0439461_0075895 Ga0439461_0075895_221_757 178
490 3300041413 Ga0439465_0048728 Ga0439465_0048728_162_701 178
491 3300041997 Ga0439431_0002967 Ga0439431_0002967_2524_3063 178
492 3300042126 Ga0450888_005684 Ga0450888_005684_635_1174 178
493 3300042134 Ga0450898_036966 Ga0450898_036966_221_760 178
494 3300042135 Ga0450899_008846 Ga0450899_008846_489_1061 178
495 3300042156 Ga0439446_0168573 Ga0439446_0168573_70_609 178
496 3300042435 Ga0439434_0120828 Ga0439434_0120828_83_622 178
497 3300042876 Ga0451577_0004100 Ga0451577_0004100_11590_12135 178
498 3300044656 Ga0466969_0017146 Ga0466969_0017146_1433_1969 178
499 3300044683 Ga0466965_0052368 Ga0466965_0052368_665_1201 178
500 3300044684 Ga0466966_0014227 Ga0466966_0014227_1391_1927 178
501 3300044693 Ga0466961_0053983 Ga0466961_0053983_1152_1688 178
502 3300044694 Ga0466963_0422087 Ga0466963_0422087_18_554 178
503 3300044706 Ga0466964_0007328 Ga0466964_0007328_1604_2140 178
504 3300044712 Ga0453684_0042087 Ga0453684_0042087_1644_2216 178
505 3300044712 Ga0453684_1724022 Ga0453684_1724022_67_612 178
506 3300044719 Ga0466971_0104848 Ga0466971_0104848_748_1284 178
507 3300044765 Ga0466970_0019609 Ga0466970_0019609_1683_2219 178
508 3300044842 Ga0466957_0154003 Ga0466957_0154003_118_654 178
509 3300045049 Ga0466959_0005794 Ga0466959_0005794_4428_4964 178
510 3300045051 Ga0451576_0316796 Ga0451576_0316796_557_1129 178
511 3300045836 Ga0466958_0073357 Ga0466958_0073357_1391_1927 178
512 3300045836 Ga0466958_0188840 Ga0466958_0188840_263_799 178
513 3300045976 Ga0466967_0057621 Ga0466967_0057621_2877_3413 178
514 3300045976 Ga0466967_0997075 Ga0466967_0997075_94_642 178
515 3300046683 Ga0495658_0275941 Ga0495658_0275941_295_831 178
516 3300048905 Ga0496102_0005822 Ga0496102_0005822_3324_3860 178
517 3300048916 Ga0496113_0169424 Ga0496113_0169424_711_1256 178
518 3300053139 Ga0500568_0087511 Ga0500568_0087511_535_1107 178
519 3300053158 Ga0500627_0012493 Ga0500627_0012493_273_818 178
520 3300060353 Ga0501082_0210377 Ga0501082_0210377_363_914 178
521 3300061719 Ga0466962_0044851 Ga0466962_0044851_616_1152 178
522 3300003316 rootH1_10015589 rootH1_100155892 179
523 3300047469 Ga0495673_0000619 Ga0495673_0000619_29675_30274 179
524 3300003215 JGI25153J46596_10007026 JGI25153J46596_100070268 180
525 3300003323 rootH1_10070345 rootH1_100703452 180
526 3300003771 Ga0055526_1006007 Ga0055526_10060074 180
527 3300003791 Ga0055530_10007731 Ga0055530_100077314 180
528 3300005262 Ga0065165_1003633 Ga0065165_10036338 180
529 3300005328 Ga0070676_10005424 Ga0070676_100054248 180
530 3300005331 Ga0070670_100203912 Ga0070670_1002039123 180
531 3300005331 Ga0070670_100310154 Ga0070670_1003101543 180
532 3300005334 Ga0068869_100072168 Ga0068869_1000721684 180
533 3300005338 Ga0068868_100015848 Ga0068868_1000158485 180
534 3300005338 Ga0068868_100020753 Ga0068868_1000207536 180
535 3300005338 Ga0068868_100248955 Ga0068868_1002489552 180
536 3300005354 Ga0070675_100052953 Ga0070675_1000529534 180
537 3300005355 Ga0070671_100138375 Ga0070671_1001383753 180
538 3300005364 Ga0070673_100005315 Ga0070673_1000053158 180
539 3300005365 Ga0070688_100234632 Ga0070688_1002346322 180
540 3300005367 Ga0070667_101175278 Ga0070667_1011752782 180
541 3300005456 Ga0070678_100034651 Ga0070678_1000346512 180
542 3300005459 Ga0068867_100007828 Ga0068867_1000078287 180
543 3300005543 Ga0070672_100086170 Ga0070672_1000861704 180
544 3300005548 Ga0070665_100063002 Ga0070665_1000630024 180
545 3300005578 Ga0068854_100029855 Ga0068854_1000298553 180
546 3300005618 Ga0068864_100048657 Ga0068864_1000486572 180
547 3300005834 Ga0068851_10189295 Ga0068851_101892951 180
548 3300005840 Ga0068870_10039677 Ga0068870_100396772 180
549 3300006042 Ga0075368_10041721 Ga0075368_100417213 180
550 3300006048 Ga0075363_100075353 Ga0075363_1000753532 180
551 3300006195 Ga0075366_10129758 Ga0075366_101297583 180
552 3300006195 Ga0075366_10225733 Ga0075366_102257332 180
553 3300006237 Ga0097621_100195851 Ga0097621_1001958513 180
554 3300006237 Ga0097621_100334608 Ga0097621_1003346083 180
555 3300006353 Ga0075370_10004004 Ga0075370_100040044 180
556 3300006353 Ga0075370_10188157 Ga0075370_101881572 180
557 3300009093 Ga0105240_10037356 Ga0105240_100373567 180
558 3300009098 Ga0105245_10052074 Ga0105245_100520743 180
559 3300009098 Ga0105245_10053820 Ga0105245_100538203 180
560 3300009101 Ga0105247_10556682 Ga0105247_105566822 180
561 3300009545 Ga0105237_10001352 Ga0105237_1000135226 180
562 3300009551 Ga0105238_10269669 Ga0105238_102696693 180
563 3300010375 Ga0105239_10003766 Ga0105239_100037668 180
564 3300011119 Ga0105246_10691283 Ga0105246_106912832 180
565 3300013296 Ga0157374_10285055 Ga0157374_102850553 180
566 3300013306 Ga0163162_11561259 Ga0163162_115612591 180
567 3300014968 Ga0157379_10085784 Ga0157379_100857844 180
568 3300025258 Ga0209129_1000027 Ga0209129_1000027216 180
569 3300025263 Ga0209565_1015028 Ga0209565_10150284 180
570 3300025273 Ga0209673_1004671 Ga0209673_10046713 180
571 3300025273 Ga0209673_1008939 Ga0209673_10089394 180
572 3300025295 Ga0209564_1000014 Ga0209564_1000014565 180
573 3300025297 Ga0209758_1000193 Ga0209758_10001932 180
574 3300025297 Ga0209758_1000208 Ga0209758_1000208120 180
575 3300025298 Ga0209050_1000198 Ga0209050_1000198105 180
576 3300025299 Ga0209256_1040921 Ga0209256_10409213 180
577 3300025303 Ga0209051_1013755 Ga0209051_10137553 180
578 3300025304 Ga0209257_1035421 Ga0209257_10354213 180
579 3300025321 Ga0207656_10118317 Ga0207656_101183172 180
580 3300025907 Ga0207645_10006118 Ga0207645_100061188 180
581 3300025908 Ga0207643_10060987 Ga0207643_100609873 180
582 3300025913 Ga0207695_10970046 Ga0207695_109700462 180
583 3300025914 Ga0207671_10009654 Ga0207671_100096543 180
584 3300025924 Ga0207694_10312576 Ga0207694_103125762 180
585 3300025925 Ga0207650_10167315 Ga0207650_101673152 180
586 3300025926 Ga0207659_10041200 Ga0207659_100412004 180
587 3300025927 Ga0207687_10024955 Ga0207687_100249552 180
588 3300025927 Ga0207687_10164178 Ga0207687_101641783 180
589 3300025927 Ga0207687_10608446 Ga0207687_106084462 180
590 3300025931 Ga0207644_10132144 Ga0207644_101321443 180
591 3300025931 Ga0207644_10132941 Ga0207644_101329413 180
592 3300025940 Ga0207691_10060049 Ga0207691_100600495 180
593 3300025942 Ga0207689_10015180 Ga0207689_100151801 180
594 3300025960 Ga0207651_10042268 Ga0207651_100422682 180
595 3300025986 Ga0207658_10002236 Ga0207658_1000223616 180
596 3300026023 Ga0207677_10020077 Ga0207677_100200774 180
597 3300026023 Ga0207677_10051400 Ga0207677_100514004 180
598 3300026088 Ga0207641_10423148 Ga0207641_104231481 180
599 3300026089 Ga0207648_10010374 Ga0207648_100103745 180
600 3300026089 Ga0207648_10091482 Ga0207648_100914823 180
601 3300026095 Ga0207676_10913847 Ga0207676_109138472 180
602 3300026121 Ga0207683_10053290 Ga0207683_100532907 180
603 3300028379 Ga0268266_10004915 Ga0268266_1000491515 180
604 3300028379 Ga0268266_10425655 Ga0268266_104256552 180
605 3300028379 Ga0268266_10629787 Ga0268266_106297872 180
606 3300028794 Ga0307515_10139043 Ga0307515_101390434 180
607 3300030522 Ga0307512_10078927 Ga0307512_100789273 180
608 3300031456 Ga0307513_10145072 Ga0307513_101450724 180
609 3300031507 Ga0307509_10000181 Ga0307509_1000018169 180
610 3300031507 Ga0307509_10007667 Ga0307509_1000766711 180
611 3300031507 Ga0307509_10030721 Ga0307509_100307217 180
612 3300031507 Ga0307509_10034467 Ga0307509_100344678 180
613 3300031507 Ga0307509_10059624 Ga0307509_100596243 180
614 3300031507 Ga0307509_10127494 Ga0307509_101274943 180
615 3300031507 Ga0307509_10623570 Ga0307509_106235702 180
616 3300031548 Ga0307408_101041864 Ga0307408_1010418641 180
617 3300031548 Ga0307408_101543763 Ga0307408_1015437631 180
618 3300031616 Ga0307508_10000738 Ga0307508_1000073834 180
619 3300031616 Ga0307508_10051814 Ga0307508_100518143 180
620 3300031649 Ga0307514_10000395 Ga0307514_1000039541 180
621 3300031730 Ga0307516_10000360 Ga0307516_1000036053 180
622 3300031730 Ga0307516_10473758 Ga0307516_104737582 180
623 3300031838 Ga0307518_10479676 Ga0307518_104796761 180
624 3300031852 Ga0307410_10202966 Ga0307410_102029663 180
625 3300032002 Ga0307416_100162336 Ga0307416_1001623362 180
626 3300032002 Ga0307416_100406162 Ga0307416_1004061622 180
627 3300033179 Ga0307507_10033844 Ga0307507_100338443 180
628 3300033180 Ga0307510_10006134 Ga0307510_1000613410 180
629 3300033180 Ga0307510_10032780 Ga0307510_100327809 180
630 3300033180 Ga0307510_10229391 Ga0307510_102293911 180
631 3300033180 Ga0307510_10372770 Ga0307510_103727701 180
632 3300035084 Ga0373928_0013749 Ga0373928_0013749_42_584 180
633 3300035088 Ga0373940_0074835 Ga0373940_0074835_177_719 180
634 3300035112 Ga0373932_0079085 Ga0373932_0079085_308_850 180
635 3300035171 Ga0373946_0292972 Ga0373946_0292972_167_709 180
636 3300035691 Ga0373931_0069406 Ga0373931_0069406_872_1414 180
637 3300037068 Ga0373925_0350666 Ga0373925_0350666_371_913 180
638 3300041443 Ga0451789_0961199 Ga0451789_0961199_1949_2491 180
639 3300041452 Ga0451793_1185119 Ga0451793_1185119_746_1288 180
640 3300041459 Ga0451800_0946979 Ga0451800_0946979_283_825 180
641 3300041460 Ga0451802_1454478 Ga0451802_1454478_952_1494 180
642 3300041496 Ga0451839_0267159 Ga0451839_0267159_64_609 180
643 3300041496 Ga0451839_0314440 Ga0451839_0314440_156_698 180
644 3300041505 Ga0451849_0782838 Ga0451849_0782838_165_710 180
645 3300041509 Ga0451843_1276605 Ga0451843_1276605_12_554 180
646 3300041512 Ga0451853_3167327 Ga0451853_3167327_1681_2223 180
647 3300042156 Ga0439446_0179155 Ga0439446_0179155_40_582 180
648 3300042876 Ga0451577_0811344 Ga0451577_0811344_64_606 180
649 3300044656 Ga0466969_0026791 Ga0466969_0026791_406_975 180
650 3300044658 Ga0466972_0115940 Ga0466972_0115940_220_789 180
651 3300044683 Ga0466965_0020695 Ga0466965_0020695_1664_2233 180
652 3300044684 Ga0466966_0001617 Ga0466966_0001617_7959_8528 180
653 3300044693 Ga0466961_0004564 Ga0466961_0004564_4842_5411 180
654 3300044694 Ga0466963_0006052 Ga0466963_0006052_3044_3613 180
655 3300044706 Ga0466964_0003715 Ga0466964_0003715_3311_3880 180
656 3300044712 Ga0453684_0008512 Ga0453684_0008512_4942_5484 180
657 3300044712 Ga0453684_0028231 Ga0453684_0028231_2064_2606 180
658 3300044719 Ga0466971_0004691 Ga0466971_0004691_3289_3858 180
659 3300044842 Ga0466957_0002193 Ga0466957_0002193_1669_2238 180
660 3300045049 Ga0466959_0001105 Ga0466959_0001105_4713_5282 180
661 3300045051 Ga0451576_0004811 Ga0451576_0004811_13795_14337 180
662 3300045976 Ga0466967_0035175 Ga0466967_0035175_2050_2619 180
663 3300046454 Ga0495592_0000234 Ga0495592_0000234_17331_17873 180
664 3300046460 Ga0495638_0024870 Ga0495638_0024870_1772_2314 180
665 3300046460 Ga0495638_0228235 Ga0495638_0228235_54_596 180
666 3300046517 Ga0495630_0049651 Ga0495630_0049651_525_1067 180
667 3300046519 Ga0495632_0002230 Ga0495632_0002230_13216_13758 180
668 3300046519 Ga0495632_0145766 Ga0495632_0145766_540_1082 180
669 3300046524 Ga0495648_0121022 Ga0495648_0121022_444_986 180
670 3300046616 Ga0495668_0066838 Ga0495668_0066838_291_833 180
671 3300046616 Ga0495668_0168760 Ga0495668_0168760_47_589 180
672 3300046660 Ga0495625_0167567 Ga0495625_0167567_273_815 180
673 3300046660 Ga0495625_0267362 Ga0495625_0267362_218_760 180
674 3300046680 Ga0495646_0302222 Ga0495646_0302222_257_799 180
675 3300046690 Ga0495624_0422115 Ga0495624_0422115_134_676 180
676 3300046692 Ga0495671_0443020 Ga0495671_0443020_49_591 180
677 3300047469 Ga0495673_0104030 Ga0495673_0104030_304_846 180
678 3300047470 Ga0495681_0020867 Ga0495681_0020867_2077_2637 180
679 3300047673 Ga0495593_0045829 Ga0495593_0045829_879_1421 180
680 3300048909 Ga0496106_0164194 Ga0496106_0164194_359_901 180
681 3300049579 Ga0501043_0000038 Ga0501043_0000038_30776_31318 180
682 3300049580 Ga0501046_0000049 Ga0501046_0000049_97362_97904 180
683 3300049581 Ga0501047_0000039 Ga0501047_0000039_89969_90511 180
684 3300049582 Ga0501048_0004056 Ga0501048_0004056_490_1032 180
685 3300049744 Ga0501083_0234072 Ga0501083_0234072_139_681 180
686 3300049824 Ga0501045_0064557 Ga0501045_0064557_1368_1910 180
687 3300050493 nmdc:mga0k408_117393_c1 nmdc:mga0k408_117393_c1_944_1486 180
688 3300050496 nmdc:mga07m45_349666_c1 nmdc:mga07m45_349666_c1_284_826 180
689 3300050496 nmdc:mga07m45_678_c2 nmdc:mga07m45_678_c2_9699_10241 180
690 3300053086 Ga0500578_0001649 Ga0500578_0001649_4469_5011 180
691 3300053086 Ga0500578_0031796 Ga0500578_0031796_2405_2947 180
692 3300053090 Ga0500646_0035588 Ga0500646_0035588_784_1326 180
693 3300053092 Ga0500583_0076367 Ga0500583_0076367_320_862 180
694 3300053093 Ga0500651_0030527 Ga0500651_0030527_101_643 180
695 3300053093 Ga0500651_0074794 Ga0500651_0074794_1530_2072 180
696 3300053098 Ga0500650_0065133 Ga0500650_0065133_569_1111 180
697 3300053098 Ga0500650_0227918 Ga0500650_0227918_206_748 180
698 3300053117 Ga0500593_122548 Ga0500593_122548_134_676 180
699 3300053130 Ga0500642_0024727 Ga0500642_0024727_1249_1791 180
700 3300053131 Ga0500652_000263 Ga0500652_000263_15257_15799 180
701 3300053131 Ga0500652_026551 Ga0500652_026551_615_1157 180
702 3300053133 Ga0500655_025944 Ga0500655_025944_246_788 180
703 3300053137 Ga0500561_0040562 Ga0500561_0040562_443_985 180
704 3300053139 Ga0500568_0144076 Ga0500568_0144076_249_791 180
705 3300053142 Ga0500577_0155974 Ga0500577_0155974_234_776 180
706 3300053154 Ga0500619_031869 Ga0500619_031869_450_992 180
707 3300053156 Ga0500622_0001292 Ga0500622_0001292_10239_10781 180
708 3300053177 Ga0500636_0176962 Ga0500636_0176962_36_578 180
709 3300053724 Ga0500570_119664 Ga0500570_119664_484_1026 180
710 3300053730 Ga0500645_062633 Ga0500645_062633_430_972 180
711 3300060353 Ga0501082_0605194 Ga0501082_0605194_62_604 180
712 3300061719 Ga0466962_0005417 Ga0466962_0005417_2774_3343 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

36

192

0.92

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

44

171

0.79

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

50

186

0.79

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

82

173

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9919 5 179
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.982 5 168
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.978 7 168
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9767 4 169
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9761 5 168
ID Description Score Start End Superfamily
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9908 5 179 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.98 7 169 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9741 7 169 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9677 5 169 3.40.630.30
3dr6B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9569 7 178 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A840SCR5-F1-model_v4 Phosphinothricin acetyltransferase (EC 2.3.1.183) 0.9991 7 177 GO:0016747
AF-A0A2I7N9P4-F1-model_v4 GNAT family N-acetyltransferase 0.9967 7 167 GO:0016747
AF-A0A521LYP4-F1-model_v4 N-acetyltransferase family protein 0.9966 7 177 GO:0016747
AF-A0A0D7KBM3-F1-model_v4 GCN5 family acetyltransferase 0.9964 5 177 GO:0016747
AF-A0A370FGI5-F1-model_v4 Phosphinothricin acetyltransferase 0.996 5 177 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map