F476843
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 377 | 699 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300035114|Ga0373939_0205096|Ga0373939_0205096_49_666 |
| Length | 205 |
| Sequence | MRRSTSDSDVVRCARDTHFKSARIRRSLAGAMTLAVRPAMPADIPAITRIYAHAVVHGTASFELEAPDEAEMARRMHDLKSKDFPYLAAERDGALAGYAYAALYRARRAYRFTVEDSVYVAPDGQRRGVGRALLKALIEACEARGFRQMIAVIGDSQRQQASIGLHAVLGFRHVGVFQDVGFKHGRWVDTLLMQRALGKGETAEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 11 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 179 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 187 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 188 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 221 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 227 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 228 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 229 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 230 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 231 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 232 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 233 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 234 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 235 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 330 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 334 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 354 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 356 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 357 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 358 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 361 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 362 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 369 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 370 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 373 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 377 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.61 |
| Metatranscriptomes | 0.56 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.87 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 73.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10007026 | 3300003215 | Bacteria | 5605 |
| 2 | rootH1_10007880 | 3300003316 | Bacteria | 5854 |
| 3 | rootH1_10015589 | 3300003316 | Bacteria | 1132 |
| 4 | rootL2_10001083 | 3300003322 | Bacteria | 1516 |
| 5 | rootL2_10066719 | 3300003322 | Bacteria | 2548 |
| 6 | rootH1_10017493 | 3300003323 | Bacteria | 1266 |
| 7 | rootH1_10070345 | 3300003323 | Bacteria | 1214 |
| 8 | rootH1_10077402 | 3300003323 | Bacteria | 3164 |
| 9 | Ga0006562J51391_1182578 | 3300003578 | Bacteria | 1597 |
| 10 | Ga0006562J51391_1182579 | 3300003578 | Bacteria | 1720 |
| 11 | Ga0055526_1006007 | 3300003771 | Bacteria | 6741 |
| 12 | Ga0055530_10007731 | 3300003791 | Bacteria | 4464 |
| 13 | Ga0065165_1003633 | 3300005262 | Bacteria | 10560 |
| 14 | Ga0070658_10175324 | 3300005327 | Bacteria | 1803 |
| 15 | Ga0070676_10005424 | 3300005328 | Bacteria | 6795 |
| 16 | Ga0070676_10014860 | 3300005328 | Bacteria | 4285 |
| 17 | Ga0070676_10233418 | 3300005328 | Bacteria | 1220 |
| 18 | Ga0070690_100025986 | 3300005330 | Bacteria | 3608 |
| 19 | Ga0070670_100034202 | 3300005331 | Bacteria | 4374 |
| 20 | Ga0070670_100154253 | 3300005331 | Bacteria | 1988 |
| 21 | Ga0070670_100189689 | 3300005331 | Bacteria | 1785 |
| 22 | Ga0070670_100201949 | 3300005331 | Bacteria | 1727 |
| 23 | Ga0070670_100203912 | 3300005331 | Bacteria | 1719 |
| 24 | Ga0070670_100310154 | 3300005331 | Bacteria | 1381 |
| 25 | Ga0070670_100546112 | 3300005331 | Bacteria | 1033 |
| 26 | Ga0070677_10010433 | 3300005333 | Bacteria | 3178 |
| 27 | Ga0068869_100068206 | 3300005334 | Bacteria | 2626 |
| 28 | Ga0068869_100072168 | 3300005334 | Bacteria | 2558 |
| 29 | Ga0070666_10031672 | 3300005335 | Bacteria | 3491 |
| 30 | Ga0070666_10648026 | 3300005335 | Bacteria | 773 |
| 31 | Ga0070680_100063571 | 3300005336 | Bacteria | 3023 |
| 32 | Ga0068868_100015848 | 3300005338 | Bacteria | 5584 |
| 33 | Ga0068868_100020753 | 3300005338 | Bacteria | 4942 |
| 34 | Ga0068868_100248955 | 3300005338 | Bacteria | 1495 |
| 35 | Ga0070661_100216549 | 3300005344 | Bacteria | 1467 |
| 36 | Ga0070661_100243120 | 3300005344 | Bacteria | 1387 |
| 37 | Ga0070661_100773009 | 3300005344 | Bacteria | 786 |
| 38 | Ga0070668_100029372 | 3300005347 | Bacteria | 4176 |
| 39 | Ga0070669_100094865 | 3300005353 | Bacteria | 2242 |
| 40 | Ga0070675_100052953 | 3300005354 | Bacteria | 3338 |
| 41 | Ga0070675_100157873 | 3300005354 | Bacteria | 1948 |
| 42 | Ga0070675_100255222 | 3300005354 | Bacteria | 1535 |
| 43 | Ga0070675_100304644 | 3300005354 | Bacteria | 1404 |
| 44 | Ga0070671_100017107 | 3300005355 | Bacteria | 5867 |
| 45 | Ga0070671_100138375 | 3300005355 | Bacteria | 2054 |
| 46 | Ga0070671_100631594 | 3300005355 | Bacteria | 927 |
| 47 | Ga0070671_100716595 | 3300005355 | Bacteria | 868 |
| 48 | Ga0070671_100859344 | 3300005355 | Bacteria | 791 |
| 49 | Ga0070674_100029218 | 3300005356 | Bacteria | 3628 |
| 50 | Ga0070674_100064420 | 3300005356 | Bacteria | 2568 |
| 51 | Ga0070674_100190740 | 3300005356 | Bacteria | 1577 |
| 52 | Ga0070674_101443897 | 3300005356 | Bacteria | 617 |
| 53 | Ga0070673_100005315 | 3300005364 | Bacteria | 8225 |
| 54 | Ga0070673_100267450 | 3300005364 | Bacteria | 1495 |
| 55 | Ga0070673_100354152 | 3300005364 | Bacteria | 1303 |
| 56 | Ga0070673_100609382 | 3300005364 | Unclassified | 996 |
| 57 | Ga0070673_100775346 | 3300005364 | Bacteria | 884 |
| 58 | Ga0070688_100234632 | 3300005365 | Bacteria | 1299 |
| 59 | Ga0070667_100004388 | 3300005367 | Bacteria | 11903 |
| 60 | Ga0070667_100169376 | 3300005367 | Bacteria | 1927 |
| 61 | Ga0070667_100276275 | 3300005367 | Bacteria | 1507 |
| 62 | Ga0070667_101175278 | 3300005367 | Bacteria | 718 |
| 63 | Ga0070667_101231522 | 3300005367 | Bacteria | 701 |
| 64 | Ga0070700_100405888 | 3300005441 | Bacteria | 1026 |
| 65 | Ga0070663_100054597 | 3300005455 | Bacteria | 2856 |
| 66 | Ga0070663_100106355 | 3300005455 | Bacteria | 2101 |
| 67 | Ga0070663_100795743 | 3300005455 | Bacteria | 810 |
| 68 | Ga0070678_100034651 | 3300005456 | Bacteria | 3518 |
| 69 | Ga0070678_100078197 | 3300005456 | Bacteria | 2498 |
| 70 | Ga0070678_100134691 | 3300005456 | Bacteria | 1968 |
| 71 | Ga0070678_100375739 | 3300005456 | Bacteria | 1228 |
| 72 | Ga0070678_101076557 | 3300005456 | Bacteria | 742 |
| 73 | Ga0070662_100022743 | 3300005457 | Bacteria | 4296 |
| 74 | Ga0070662_100023184 | 3300005457 | Bacteria | 4261 |
| 75 | Ga0070662_100073830 | 3300005457 | Bacteria | 2521 |
| 76 | Ga0068867_100007828 | 3300005459 | Bacteria | 7553 |
| 77 | Ga0068867_100095372 | 3300005459 | Bacteria | 2263 |
| 78 | Ga0068867_100635945 | 3300005459 | Bacteria | 934 |
| 79 | Ga0070679_100021313 | 3300005530 | Bacteria | 6325 |
| 80 | Ga0070684_100174632 | 3300005535 | Bacteria | 1952 |
| 81 | Ga0070684_100690595 | 3300005535 | Bacteria | 951 |
| 82 | Ga0070672_100039130 | 3300005543 | Bacteria | 3630 |
| 83 | Ga0070672_100064493 | 3300005543 | Bacteria | 2894 |
| 84 | Ga0070672_100086170 | 3300005543 | Bacteria | 2525 |
| 85 | Ga0070672_100108581 | 3300005543 | Bacteria | 2259 |
| 86 | Ga0070672_100110940 | 3300005543 | Bacteria | 2235 |
| 87 | Ga0070672_100845456 | 3300005543 | Bacteria | 807 |
| 88 | Ga0070686_100119616 | 3300005544 | Bacteria | 1806 |
| 89 | Ga0070693_100648521 | 3300005547 | Bacteria | 767 |
| 90 | Ga0070665_100063002 | 3300005548 | Bacteria | 3718 |
| 91 | Ga0068855_100282473 | 3300005563 | Bacteria | 1843 |
| 92 | Ga0068855_101314445 | 3300005563 | Bacteria | 748 |
| 93 | Ga0070664_100060332 | 3300005564 | Bacteria | 3229 |
| 94 | Ga0070664_100382778 | 3300005564 | Bacteria | 1284 |
| 95 | Ga0070664_100751193 | 3300005564 | Bacteria | 910 |
| 96 | Ga0068857_100081284 | 3300005577 | Bacteria | 2894 |
| 97 | Ga0068857_100557525 | 3300005577 | Bacteria | 1080 |
| 98 | Ga0068857_101110459 | 3300005577 | Bacteria | 764 |
| 99 | Ga0068854_100029855 | 3300005578 | Bacteria | 3778 |
| 100 | Ga0068854_100115079 | 3300005578 | Bacteria | 2034 |
| 101 | Ga0068854_100350207 | 3300005578 | Bacteria | 1209 |
| 102 | Ga0068854_100622988 | 3300005578 | Bacteria | 923 |
| 103 | Ga0068852_100055501 | 3300005616 | Bacteria | 3420 |
| 104 | Ga0068852_100858564 | 3300005616 | Bacteria | 923 |
| 105 | Ga0068852_100979678 | 3300005616 | Bacteria | 864 |
| 106 | Ga0068852_101010263 | 3300005616 | Bacteria | 850 |
| 107 | Ga0068859_100135444 | 3300005617 | Bacteria | 2536 |
| 108 | Ga0068864_100046435 | 3300005618 | Bacteria | 3726 |
| 109 | Ga0068864_100048657 | 3300005618 | Bacteria | 3645 |
| 110 | Ga0068864_100157469 | 3300005618 | Bacteria | 2062 |
| 111 | Ga0068864_100793040 | 3300005618 | Bacteria | 930 |
| 112 | Ga0068864_100807020 | 3300005618 | Bacteria | 922 |
| 113 | Ga0068864_100896548 | 3300005618 | Bacteria | 875 |
| 114 | Ga0068866_10095345 | 3300005718 | Bacteria | 1629 |
| 115 | Ga0068866_10366802 | 3300005718 | Bacteria | 920 |
| 116 | Ga0068861_100301307 | 3300005719 | Bacteria | 1388 |
| 117 | Ga0068861_100499223 | 3300005719 | Unclassified | 1100 |
| 118 | Ga0068851_10189295 | 3300005834 | Bacteria | 1143 |
| 119 | Ga0068870_10039677 | 3300005840 | Bacteria | 2437 |
| 120 | Ga0068863_100053520 | 3300005841 | Bacteria | 3826 |
| 121 | Ga0068863_100315660 | 3300005841 | Bacteria | 1517 |
| 122 | Ga0068858_100003791 | 3300005842 | Bacteria | 14951 |
| 123 | Ga0068860_100004033 | 3300005843 | Bacteria | 15080 |
| 124 | Ga0068862_100005370 | 3300005844 | Bacteria | 10728 |
| 125 | Ga0068862_100746325 | 3300005844 | Bacteria | 952 |
| 126 | Ga0075365_10006162 | 3300006038 | Bacteria | 6566 |
| 127 | Ga0075365_10162891 | 3300006038 | Bacteria | 1555 |
| 128 | Ga0075368_10007583 | 3300006042 | Bacteria | 3830 |
| 129 | Ga0075368_10020604 | 3300006042 | Bacteria | 2499 |
| 130 | Ga0075368_10041721 | 3300006042 | Bacteria | 1803 |
| 131 | Ga0075368_10049413 | 3300006042 | Bacteria | 1669 |
| 132 | Ga0075363_100006792 | 3300006048 | Bacteria | 5227 |
| 133 | Ga0075363_100026281 | 3300006048 | Bacteria | 2977 |
| 134 | Ga0075363_100027648 | 3300006048 | Bacteria | 2910 |
| 135 | Ga0075363_100075353 | 3300006048 | Bacteria | 1838 |
| 136 | Ga0075364_10016731 | 3300006051 | Bacteria | 4567 |
| 137 | Ga0075364_10029373 | 3300006051 | Bacteria | 3525 |
| 138 | Ga0070715_10396644 | 3300006163 | Bacteria | 766 |
| 139 | Ga0075362_10015745 | 3300006177 | Bacteria | 3081 |
| 140 | Ga0075362_10024040 | 3300006177 | Bacteria | 2582 |
| 141 | Ga0075362_10133552 | 3300006177 | Bacteria | 1182 |
| 142 | Ga0075362_10159420 | 3300006177 | Bacteria | 1086 |
| 143 | Ga0075367_10001597 | 3300006178 | Bacteria | 9830 |
| 144 | Ga0075367_10005029 | 3300006178 | Bacteria | 6519 |
| 145 | Ga0075367_10225898 | 3300006178 | Bacteria | 1172 |
| 146 | Ga0075369_10027826 | 3300006186 | Bacteria | 2365 |
| 147 | Ga0075366_10000433 | 3300006195 | Bacteria | 19528 |
| 148 | Ga0075366_10024666 | 3300006195 | Bacteria | 3507 |
| 149 | Ga0075366_10045787 | 3300006195 | Bacteria | 2592 |
| 150 | Ga0075366_10104698 | 3300006195 | Bacteria | 1700 |
| 151 | Ga0075366_10129758 | 3300006195 | Bacteria | 1521 |
| 152 | Ga0075366_10225733 | 3300006195 | Bacteria | 1141 |
| 153 | Ga0075366_10237157 | 3300006195 | Bacteria | 1112 |
| 154 | Ga0097621_100170721 | 3300006237 | Bacteria | 1874 |
| 155 | Ga0097621_100195851 | 3300006237 | Bacteria | 1752 |
| 156 | Ga0097621_100334608 | 3300006237 | Bacteria | 1343 |
| 157 | Ga0097621_101335742 | 3300006237 | Unclassified | 678 |
| 158 | Ga0075370_10000538 | 3300006353 | Bacteria | 14505 |
| 159 | Ga0075370_10000846 | 3300006353 | Bacteria | 12403 |
| 160 | Ga0075370_10004004 | 3300006353 | Bacteria | 7081 |
| 161 | Ga0075370_10007825 | 3300006353 | Bacteria | 5465 |
| 162 | Ga0075370_10106550 | 3300006353 | Bacteria | 1625 |
| 163 | Ga0075370_10188157 | 3300006353 | Bacteria | 1216 |
| 164 | Ga0075370_10359469 | 3300006353 | Bacteria | 870 |
| 165 | Ga0068871_100037260 | 3300006358 | Bacteria | 3877 |
| 166 | Ga0068871_100137485 | 3300006358 | Bacteria | 2076 |
| 167 | Ga0075430_100000276 | 3300006846 | Bacteria | 36027 |
| 168 | Ga0075430_100138515 | 3300006846 | Bacteria | 2027 |
| 169 | Ga0075431_100034277 | 3300006847 | Bacteria | 5230 |
| 170 | Ga0075429_100682159 | 3300006880 | Bacteria | 900 |
| 171 | Ga0068865_100222079 | 3300006881 | Bacteria | 1477 |
| 172 | Ga0097620_100135435 | 3300006931 | Bacteria | 2536 |
| 173 | Ga0105240_10037356 | 3300009093 | Bacteria | 6242 |
| 174 | Ga0105240_10406149 | 3300009093 | Bacteria | 1533 |
| 175 | Ga0105245_10052074 | 3300009098 | Bacteria | 3671 |
| 176 | Ga0105245_10053820 | 3300009098 | Bacteria | 3614 |
| 177 | Ga0105245_10257453 | 3300009098 | Bacteria | 1697 |
| 178 | Ga0105247_10556682 | 3300009101 | Bacteria | 844 |
| 179 | Ga0105243_10033813 | 3300009148 | Bacteria | 3954 |
| 180 | Ga0105243_10059454 | 3300009148 | Bacteria | 3051 |
| 181 | Ga0105242_10274465 | 3300009176 | Bacteria | 1528 |
| 182 | Ga0105248_10209361 | 3300009177 | Bacteria | 2197 |
| 183 | Ga0105248_10368514 | 3300009177 | Bacteria | 1617 |
| 184 | Ga0105237_10001352 | 3300009545 | Bacteria | 32488 |
| 185 | Ga0105237_10012662 | 3300009545 | Bacteria | 8878 |
| 186 | Ga0105238_10269669 | 3300009551 | Bacteria | 1682 |
| 187 | Ga0105238_11749555 | 3300009551 | Bacteria | 653 |
| 188 | Ga0105249_10044015 | 3300009553 | Bacteria | 4060 |
| 189 | Ga0105239_10003766 | 3300010375 | Bacteria | 18446 |
| 190 | Ga0105239_10037984 | 3300010375 | Bacteria | 5277 |
| 191 | Ga0105246_10691283 | 3300011119 | Bacteria | 893 |
| 192 | Ga0157373_10038721 | 3300013100 | Bacteria | 3416 |
| 193 | Ga0157371_10207035 | 3300013102 | Bacteria | 1407 |
| 194 | Ga0157370_10022640 | 3300013104 | Bacteria | 6252 |
| 195 | Ga0157370_10742816 | 3300013104 | Bacteria | 894 |
| 196 | Ga0157369_10065353 | 3300013105 | Bacteria | 3915 |
| 197 | Ga0157374_10285055 | 3300013296 | Bacteria | 1631 |
| 198 | Ga0157374_10385984 | 3300013296 | Bacteria | 1395 |
| 199 | Ga0157374_10496992 | 3300013296 | Bacteria | 1224 |
| 200 | Ga0157378_10056830 | 3300013297 | Bacteria | 3487 |
| 201 | Ga0157378_10375476 | 3300013297 | Bacteria | 1395 |
| 202 | Ga0163162_10022860 | 3300013306 | Bacteria | 6165 |
| 203 | Ga0163162_11235551 | 3300013306 | Bacteria | 848 |
| 204 | Ga0163162_11561259 | 3300013306 | Bacteria | 752 |
| 205 | Ga0157372_10167119 | 3300013307 | Bacteria | 2544 |
| 206 | Ga0157375_10012775 | 3300013308 | Bacteria | 7455 |
| 207 | Ga0157375_10055359 | 3300013308 | Bacteria | 3911 |
| 208 | Ga0157375_10184225 | 3300013308 | Bacteria | 2240 |
| 209 | Ga0163163_10435639 | 3300014325 | Bacteria | 1370 |
| 210 | Ga0163163_11680361 | 3300014325 | Bacteria | 696 |
| 211 | Ga0157380_10021608 | 3300014326 | Bacteria | 4829 |
| 212 | Ga0157380_10134265 | 3300014326 | Bacteria | 2116 |
| 213 | Ga0157380_10334123 | 3300014326 | Bacteria | 1410 |
| 214 | Ga0157377_10518514 | 3300014745 | Bacteria | 836 |
| 215 | Ga0157379_10048970 | 3300014968 | Bacteria | 3772 |
| 216 | Ga0157379_10085784 | 3300014968 | Bacteria | 2823 |
| 217 | Ga0157379_10282749 | 3300014968 | Bacteria | 1510 |
| 218 | Ga0157379_10879047 | 3300014968 | Unclassified | 849 |
| 219 | Ga0157379_11031976 | 3300014968 | Bacteria | 785 |
| 220 | Ga0157376_10182194 | 3300014969 | Bacteria | 1921 |
| 221 | Ga0182005_1054393 | 3300015265 | Bacteria | 1090 |
| 222 | Ga0163161_11081601 | 3300017792 | Bacteria | 688 |
| 223 | Ga0213872_10000140 | 3300021361 | Bacteria | 65308 |
| 224 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 225 | Ga0209565_1015028 | 3300025263 | Bacteria | 1758 |
| 226 | Ga0209673_1004671 | 3300025273 | Bacteria | 7229 |
| 227 | Ga0209673_1008939 | 3300025273 | Bacteria | 4401 |
| 228 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 229 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 230 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 231 | Ga0209050_1000198 | 3300025298 | Bacteria | 134820 |
| 232 | Ga0209256_1040921 | 3300025299 | Bacteria | 1180 |
| 233 | Ga0209051_1013755 | 3300025303 | Bacteria | 3825 |
| 234 | Ga0209257_1035421 | 3300025304 | Bacteria | 1545 |
| 235 | Ga0207697_10022812 | 3300025315 | Bacteria | 2563 |
| 236 | Ga0207656_10118317 | 3300025321 | Bacteria | 1231 |
| 237 | Ga0207682_10008329 | 3300025893 | Bacteria | 4101 |
| 238 | Ga0207682_10015553 | 3300025893 | Bacteria | 2963 |
| 239 | Ga0207642_10017450 | 3300025899 | Bacteria | 2731 |
| 240 | Ga0207642_10283320 | 3300025899 | Bacteria | 954 |
| 241 | Ga0207688_10056594 | 3300025901 | Bacteria | 2203 |
| 242 | Ga0207680_10032671 | 3300025903 | Bacteria | 2960 |
| 243 | Ga0207680_10042631 | 3300025903 | Bacteria | 2656 |
| 244 | Ga0207680_10509812 | 3300025903 | Bacteria | 857 |
| 245 | Ga0207645_10006118 | 3300025907 | Bacteria | 8648 |
| 246 | Ga0207645_10020411 | 3300025907 | Bacteria | 4337 |
| 247 | Ga0207643_10060987 | 3300025908 | Bacteria | 2154 |
| 248 | Ga0207643_10524779 | 3300025908 | Bacteria | 758 |
| 249 | Ga0207695_10388199 | 3300025913 | Bacteria | 1281 |
| 250 | Ga0207695_10970046 | 3300025913 | Bacteria | 730 |
| 251 | Ga0207671_10009654 | 3300025914 | Bacteria | 8043 |
| 252 | Ga0207671_10090935 | 3300025914 | Bacteria | 2299 |
| 253 | Ga0207660_10021246 | 3300025917 | Bacteria | 4364 |
| 254 | Ga0207657_10236997 | 3300025919 | Bacteria | 1458 |
| 255 | Ga0207649_10450271 | 3300025920 | Bacteria | 971 |
| 256 | Ga0207652_10008328 | 3300025921 | Bacteria | 8336 |
| 257 | Ga0207681_10002043 | 3300025923 | Bacteria | 12940 |
| 258 | Ga0207681_10138395 | 3300025923 | Bacteria | 1810 |
| 259 | Ga0207694_10312576 | 3300025924 | Bacteria | 1295 |
| 260 | Ga0207694_10345605 | 3300025924 | Bacteria | 1231 |
| 261 | Ga0207650_10001150 | 3300025925 | Bacteria | 19435 |
| 262 | Ga0207650_10052371 | 3300025925 | Bacteria | 3023 |
| 263 | Ga0207650_10167315 | 3300025925 | Bacteria | 1745 |
| 264 | Ga0207650_10286159 | 3300025925 | Bacteria | 1343 |
| 265 | Ga0207659_10021737 | 3300025926 | Bacteria | 4265 |
| 266 | Ga0207659_10041200 | 3300025926 | Bacteria | 3234 |
| 267 | Ga0207659_10562337 | 3300025926 | Bacteria | 970 |
| 268 | Ga0207687_10024955 | 3300025927 | Bacteria | 3998 |
| 269 | Ga0207687_10164178 | 3300025927 | Bacteria | 1707 |
| 270 | Ga0207687_10608446 | 3300025927 | Bacteria | 921 |
| 271 | Ga0207644_10005994 | 3300025931 | Bacteria | 7920 |
| 272 | Ga0207644_10132144 | 3300025931 | Bacteria | 1912 |
| 273 | Ga0207644_10132941 | 3300025931 | Bacteria | 1907 |
| 274 | Ga0207644_10321717 | 3300025931 | Bacteria | 1251 |
| 275 | Ga0207644_10556920 | 3300025931 | Bacteria | 949 |
| 276 | Ga0207644_10958669 | 3300025931 | Bacteria | 717 |
| 277 | Ga0207690_10477561 | 3300025932 | Bacteria | 1006 |
| 278 | Ga0207690_10572212 | 3300025932 | Bacteria | 920 |
| 279 | Ga0207706_10008308 | 3300025933 | Bacteria | 9570 |
| 280 | Ga0207706_10033661 | 3300025933 | Bacteria | 4560 |
| 281 | Ga0207706_10051513 | 3300025933 | Bacteria | 3635 |
| 282 | Ga0207686_10409046 | 3300025934 | Bacteria | 1035 |
| 283 | Ga0207686_11087071 | 3300025934 | Unclassified | 652 |
| 284 | Ga0207709_10021965 | 3300025935 | Bacteria | 3616 |
| 285 | Ga0207709_10456811 | 3300025935 | Bacteria | 988 |
| 286 | Ga0207670_10197720 | 3300025936 | Bacteria | 1525 |
| 287 | Ga0207669_10123252 | 3300025937 | Bacteria | 1764 |
| 288 | Ga0207669_10138851 | 3300025937 | Bacteria | 1683 |
| 289 | Ga0207669_10326427 | 3300025937 | Bacteria | 1176 |
| 290 | Ga0207704_10008974 | 3300025938 | Bacteria | 4805 |
| 291 | Ga0207691_10060049 | 3300025940 | Bacteria | 3456 |
| 292 | Ga0207691_10268024 | 3300025940 | Bacteria | 1471 |
| 293 | Ga0207691_10342612 | 3300025940 | Bacteria | 1279 |
| 294 | Ga0207691_10501637 | 3300025940 | Bacteria | 1031 |
| 295 | Ga0207711_10063030 | 3300025941 | Bacteria | 3199 |
| 296 | Ga0207711_10726230 | 3300025941 | Bacteria | 926 |
| 297 | Ga0207689_10015180 | 3300025942 | Bacteria | 6524 |
| 298 | Ga0207689_10016368 | 3300025942 | Bacteria | 6280 |
| 299 | Ga0207661_10245559 | 3300025944 | Bacteria | 1590 |
| 300 | Ga0207679_10395117 | 3300025945 | Bacteria | 1215 |
| 301 | Ga0207651_10042268 | 3300025960 | Bacteria | 3032 |
| 302 | Ga0207651_10335609 | 3300025960 | Bacteria | 1268 |
| 303 | Ga0207651_10353012 | 3300025960 | Bacteria | 1239 |
| 304 | Ga0207651_10401972 | 3300025960 | Bacteria | 1165 |
| 305 | Ga0207651_10571754 | 3300025960 | Bacteria | 985 |
| 306 | Ga0207651_10970971 | 3300025960 | Bacteria | 758 |
| 307 | Ga0207651_11290003 | 3300025960 | Unclassified | 656 |
| 308 | Ga0207712_10043014 | 3300025961 | Bacteria | 3114 |
| 309 | Ga0207668_10003052 | 3300025972 | Bacteria | 9816 |
| 310 | Ga0207640_10071608 | 3300025981 | Bacteria | 2335 |
| 311 | Ga0207640_10074430 | 3300025981 | Bacteria | 2299 |
| 312 | Ga0207640_10165065 | 3300025981 | Bacteria | 1643 |
| 313 | Ga0207658_10002236 | 3300025986 | Bacteria | 14366 |
| 314 | Ga0207658_10010815 | 3300025986 | Bacteria | 6208 |
| 315 | Ga0207677_10020077 | 3300026023 | Bacteria | 4049 |
| 316 | Ga0207677_10051400 | 3300026023 | Bacteria | 2794 |
| 317 | Ga0207677_10197248 | 3300026023 | Bacteria | 1597 |
| 318 | Ga0207703_10001541 | 3300026035 | Bacteria | 20913 |
| 319 | Ga0207678_10076508 | 3300026067 | Bacteria | 2867 |
| 320 | Ga0207678_10084333 | 3300026067 | Bacteria | 2717 |
| 321 | Ga0207678_10631026 | 3300026067 | Bacteria | 941 |
| 322 | Ga0207708_10036858 | 3300026075 | Bacteria | 3724 |
| 323 | Ga0207702_10171048 | 3300026078 | Bacteria | 1992 |
| 324 | Ga0207702_11297420 | 3300026078 | Bacteria | 722 |
| 325 | Ga0207641_10000655 | 3300026088 | Bacteria | 37743 |
| 326 | Ga0207641_10037046 | 3300026088 | Bacteria | 4072 |
| 327 | Ga0207641_10244785 | 3300026088 | Bacteria | 1672 |
| 328 | Ga0207641_10423148 | 3300026088 | Bacteria | 1283 |
| 329 | Ga0207648_10006616 | 3300026089 | Bacteria | 11512 |
| 330 | Ga0207648_10010374 | 3300026089 | Bacteria | 8833 |
| 331 | Ga0207648_10091482 | 3300026089 | Bacteria | 2659 |
| 332 | Ga0207676_10060635 | 3300026095 | Bacteria | 2993 |
| 333 | Ga0207676_10271087 | 3300026095 | Bacteria | 1537 |
| 334 | Ga0207676_10321090 | 3300026095 | Bacteria | 1421 |
| 335 | Ga0207676_10514698 | 3300026095 | Bacteria | 1138 |
| 336 | Ga0207676_10913847 | 3300026095 | Bacteria | 861 |
| 337 | Ga0207674_10036354 | 3300026116 | Bacteria | 5133 |
| 338 | Ga0207674_10916080 | 3300026116 | Bacteria | 845 |
| 339 | Ga0207674_11246651 | 3300026116 | Bacteria | 713 |
| 340 | Ga0207675_100095530 | 3300026118 | Bacteria | 2797 |
| 341 | Ga0207675_101036988 | 3300026118 | Bacteria | 839 |
| 342 | Ga0207683_10053290 | 3300026121 | Bacteria | 3546 |
| 343 | Ga0207683_10113189 | 3300026121 | Bacteria | 2430 |
| 344 | Ga0207683_10158397 | 3300026121 | Bacteria | 2046 |
| 345 | Ga0207683_10187000 | 3300026121 | Bacteria | 1879 |
| 346 | Ga0207683_11290885 | 3300026121 | Bacteria | 676 |
| 347 | Ga0207698_10052815 | 3300026142 | Bacteria | 3116 |
| 348 | Ga0207698_10114183 | 3300026142 | Bacteria | 2271 |
| 349 | Ga0207698_10897436 | 3300026142 | Bacteria | 893 |
| 350 | Ga0207698_10932246 | 3300026142 | Bacteria | 877 |
| 351 | Ga0209813_10003088 | 3300027866 | Bacteria | 3870 |
| 352 | Ga0209813_10008646 | 3300027866 | Bacteria | 2580 |
| 353 | Ga0268266_10004915 | 3300028379 | Bacteria | 12666 |
| 354 | Ga0268266_10347242 | 3300028379 | Bacteria | 1394 |
| 355 | Ga0268266_10425655 | 3300028379 | Bacteria | 1259 |
| 356 | Ga0268266_10629787 | 3300028379 | Bacteria | 1031 |
| 357 | Ga0268265_10003715 | 3300028380 | Bacteria | 10856 |
| 358 | Ga0268264_10002170 | 3300028381 | Bacteria | 17490 |
| 359 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 360 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 361 | Ga0307515_10001484 | 3300028794 | Bacteria | 52674 |
| 362 | Ga0307515_10078173 | 3300028794 | Bacteria | 4356 |
| 363 | Ga0307515_10139043 | 3300028794 | Bacteria | 2617 |
| 364 | Ga0307515_10200216 | 3300028794 | Bacteria | 1875 |
| 365 | Ga0307512_10078927 | 3300030522 | Bacteria | 2381 |
| 366 | Ga0307513_10034000 | 3300031456 | Bacteria | 5725 |
| 367 | Ga0307513_10145072 | 3300031456 | Bacteria | 2293 |
| 368 | Ga0307513_10166466 | 3300031456 | Bacteria | 2088 |
| 369 | Ga0307509_10000181 | 3300031507 | Bacteria | 98346 |
| 370 | Ga0307509_10007667 | 3300031507 | Bacteria | 14026 |
| 371 | Ga0307509_10030721 | 3300031507 | Bacteria | 5939 |
| 372 | Ga0307509_10034467 | 3300031507 | Bacteria | 5562 |
| 373 | Ga0307509_10059624 | 3300031507 | Bacteria | 4038 |
| 374 | Ga0307509_10127494 | 3300031507 | Bacteria | 2508 |
| 375 | Ga0307509_10623570 | 3300031507 | Bacteria | 749 |
| 376 | Ga0307408_100000038 | 3300031548 | Bacteria | 183170 |
| 377 | Ga0307408_100691637 | 3300031548 | Bacteria | 916 |
| 378 | Ga0307408_101041864 | 3300031548 | Bacteria | 756 |
| 379 | Ga0307408_101543763 | 3300031548 | Bacteria | 629 |
| 380 | Ga0307508_10000738 | 3300031616 | Bacteria | 38723 |
| 381 | Ga0307508_10051814 | 3300031616 | Bacteria | 3647 |
| 382 | Ga0307508_10058240 | 3300031616 | Bacteria | 3418 |
| 383 | Ga0307514_10000395 | 3300031649 | Bacteria | 99171 |
| 384 | Ga0307516_10000359 | 3300031730 | Bacteria | 59207 |
| 385 | Ga0307516_10000360 | 3300031730 | Bacteria | 59179 |
| 386 | Ga0307516_10297671 | 3300031730 | Bacteria | 1290 |
| 387 | Ga0307516_10473758 | 3300031730 | Bacteria | 907 |
| 388 | Ga0307518_10479676 | 3300031838 | Bacteria | 651 |
| 389 | Ga0307410_10202966 | 3300031852 | Bacteria | 1515 |
| 390 | Ga0307409_100519124 | 3300031995 | Bacteria | 1163 |
| 391 | Ga0307416_100098684 | 3300032002 | Bacteria | 2534 |
| 392 | Ga0307416_100162336 | 3300032002 | Bacteria | 2067 |
| 393 | Ga0307416_100222125 | 3300032002 | Bacteria | 1813 |
| 394 | Ga0307416_100406162 | 3300032002 | Bacteria | 1401 |
| 395 | Ga0307414_10219966 | 3300032004 | Bacteria | 1558 |
| 396 | Ga0307411_10000214 | 3300032005 | Bacteria | 18630 |
| 397 | Ga0307411_10513124 | 3300032005 | Bacteria | 1016 |
| 398 | Ga0307411_10820882 | 3300032005 | Bacteria | 820 |
| 399 | Ga0307415_100666264 | 3300032126 | Bacteria | 935 |
| 400 | Ga0307507_10033844 | 3300033179 | Bacteria | 5296 |
| 401 | Ga0307510_10006134 | 3300033180 | Bacteria | 14325 |
| 402 | Ga0307510_10032780 | 3300033180 | Bacteria | 5848 |
| 403 | Ga0307510_10229391 | 3300033180 | Bacteria | 1360 |
| 404 | Ga0307510_10372770 | 3300033180 | Bacteria | 874 |
| 405 | Ga0373959_0011717 | 3300034820 | Bacteria | 1553 |
| 406 | Ga0373928_0013749 | 3300035084 | Bacteria | 1628 |
| 407 | Ga0373940_0074835 | 3300035088 | Bacteria | 992 |
| 408 | Ga0373949_0117633 | 3300035090 | Bacteria | 743 |
| 409 | Ga0373951_0006045 | 3300035091 | Bacteria | 2786 |
| 410 | Ga0373932_0079085 | 3300035112 | Bacteria | 1035 |
| 411 | Ga0373939_0000092 | 3300035114 | Bacteria | 28418 |
| 412 | Ga0373939_0205096 | 3300035114 | Bacteria | 747 |
| 413 | Ga0373945_0043125 | 3300035116 | Bacteria | 1636 |
| 414 | Ga0373954_0055761 | 3300035118 | Bacteria | 1859 |
| 415 | Ga0373957_0073248 | 3300035120 | Bacteria | 1343 |
| 416 | Ga0373943_0105569 | 3300035170 | Bacteria | 1479 |
| 417 | Ga0373946_0264695 | 3300035171 | Bacteria | 842 |
| 418 | Ga0373946_0292972 | 3300035171 | Bacteria | 803 |
| 419 | Ga0373924_0092603 | 3300035410 | Bacteria | 1294 |
| 420 | Ga0373931_0000403 | 3300035691 | Bacteria | 17660 |
| 421 | Ga0373931_0069406 | 3300035691 | Bacteria | 1920 |
| 422 | Ga0373935_0118199 | 3300035692 | Bacteria | 1768 |
| 423 | Ga0373927_0059536 | 3300035695 | Bacteria | 2470 |
| 424 | Ga0373933_0246301 | 3300035724 | Bacteria | 1150 |
| 425 | Ga0373947_0186530 | 3300035725 | Bacteria | 1352 |
| 426 | Ga0373947_0596344 | 3300035725 | Bacteria | 753 |
| 427 | Ga0373947_0800336 | 3300035725 | Bacteria | 643 |
| 428 | Ga0373937_0048281 | 3300036401 | Bacteria | 3896 |
| 429 | Ga0373937_0220034 | 3300036401 | Bacteria | 1787 |
| 430 | Ga0373925_0201079 | 3300037068 | Bacteria | 1584 |
| 431 | Ga0373925_0350666 | 3300037068 | Bacteria | 1198 |
| 432 | Ga0373925_0945811 | 3300037068 | Bacteria | 710 |
| 433 | Ga0395899_0489779 | 3300037312 | Bacteria | 799 |
| 434 | Ga0395900_0131850 | 3300037418 | Bacteria | 2561 |
| 435 | Ga0395905_0007537 | 3300037471 | Bacteria | 10820 |
| 436 | Ga0395905_0024849 | 3300037471 | Bacteria | 5653 |
| 437 | Ga0395905_0085909 | 3300037471 | Bacteria | 2948 |
| 438 | Ga0395905_0131557 | 3300037471 | Bacteria | 2353 |
| 439 | Ga0436365_1527322 | 3300039437 | Bacteria | 3108 |
| 440 | Ga0436365_1746291 | 3300039437 | Bacteria | 1550 |
| 441 | Ga0436361_0033949 | 3300039447 | Bacteria | 5118 |
| 442 | Ga0436361_0749433 | 3300039447 | Bacteria | 31549 |
| 443 | Ga0439461_0075895 | 3300041410 | Bacteria | 786 |
| 444 | Ga0439465_0048728 | 3300041413 | Bacteria | 1383 |
| 445 | Ga0451789_0961199 | 3300041443 | Bacteria | 3212 |
| 446 | Ga0451793_1185119 | 3300041452 | Bacteria | 2085 |
| 447 | Ga0451800_0946979 | 3300041459 | Bacteria | 1832 |
| 448 | Ga0451802_1454478 | 3300041460 | Bacteria | 1512 |
| 449 | Ga0451804_0697290 | 3300041463 | Bacteria | 814 |
| 450 | Ga0451839_0267159 | 3300041496 | Bacteria | 902 |
| 451 | Ga0451839_0314440 | 3300041496 | Bacteria | 749 |
| 452 | Ga0451849_0782838 | 3300041505 | Bacteria | 1216 |
| 453 | Ga0451849_1333857 | 3300041505 | Bacteria | 745 |
| 454 | Ga0451843_1276605 | 3300041509 | Bacteria | 769 |
| 455 | Ga0451853_3167327 | 3300041512 | Bacteria | 2483 |
| 456 | Ga0439431_0002967 | 3300041997 | Bacteria | 3725 |
| 457 | Ga0439445_0039050 | 3300042004 | Bacteria | 1257 |
| 458 | Ga0450912_003383 | 3300042116 | Bacteria | 1132 |
| 459 | Ga0450888_001013 | 3300042126 | Bacteria | 2654 |
| 460 | Ga0450888_005684 | 3300042126 | Bacteria | 1337 |
| 461 | Ga0450890_000737 | 3300042127 | Bacteria | 4756 |
| 462 | Ga0450890_016996 | 3300042127 | Bacteria | 966 |
| 463 | Ga0450891_000527 | 3300042129 | Bacteria | 3990 |
| 464 | Ga0450892_001234 | 3300042130 | Bacteria | 2621 |
| 465 | Ga0450898_036966 | 3300042134 | Bacteria | 913 |
| 466 | Ga0450899_008846 | 3300042135 | Bacteria | 1105 |
| 467 | Ga0450902_002503 | 3300042137 | Bacteria | 2611 |
| 468 | Ga0450903_007340 | 3300042138 | Bacteria | 1815 |
| 469 | Ga0450889_000335 | 3300042144 | Bacteria | 5261 |
| 470 | Ga0439446_0168573 | 3300042156 | Bacteria | 727 |
| 471 | Ga0439446_0179155 | 3300042156 | Bacteria | 708 |
| 472 | Ga0439434_0120828 | 3300042435 | Bacteria | 854 |
| 473 | Ga0451577_0004100 | 3300042876 | Bacteria | 15627 |
| 474 | Ga0451577_0811344 | 3300042876 | Bacteria | 845 |
| 475 | Ga0466969_0000640 | 3300044656 | Bacteria | 18904 |
| 476 | Ga0466969_0017146 | 3300044656 | Bacteria | 3785 |
| 477 | Ga0466969_0026791 | 3300044656 | Bacteria | 2955 |
| 478 | Ga0466972_0115940 | 3300044658 | Bacteria | 1264 |
| 479 | Ga0466965_0020695 | 3300044683 | Bacteria | 3165 |
| 480 | Ga0466965_0052368 | 3300044683 | Bacteria | 2027 |
| 481 | Ga0466966_0001617 | 3300044684 | Bacteria | 14507 |
| 482 | Ga0466966_0002104 | 3300044684 | Bacteria | 12935 |
| 483 | Ga0466966_0014227 | 3300044684 | Bacteria | 5268 |
| 484 | Ga0466961_0004564 | 3300044693 | Bacteria | 8686 |
| 485 | Ga0466961_0042894 | 3300044693 | Bacteria | 2898 |
| 486 | Ga0466961_0053983 | 3300044693 | Bacteria | 2563 |
| 487 | Ga0466963_0006052 | 3300044694 | Bacteria | 7129 |
| 488 | Ga0466963_0422087 | 3300044694 | Bacteria | 940 |
| 489 | Ga0466964_0003715 | 3300044706 | Bacteria | 5592 |
| 490 | Ga0466964_0007328 | 3300044706 | Bacteria | 4124 |
| 491 | Ga0453684_0008512 | 3300044712 | Bacteria | 18337 |
| 492 | Ga0453684_0028231 | 3300044712 | Bacteria | 8018 |
| 493 | Ga0453684_0042087 | 3300044712 | Bacteria | 6164 |
| 494 | Ga0453684_1724022 | 3300044712 | Bacteria | 639 |
| 495 | Ga0466971_0004691 | 3300044719 | Bacteria | 5907 |
| 496 | Ga0466971_0004888 | 3300044719 | Bacteria | 5794 |
| 497 | Ga0466971_0104848 | 3300044719 | Bacteria | 1301 |
| 498 | Ga0466968_0063314 | 3300044735 | Bacteria | 1598 |
| 499 | Ga0466970_0019609 | 3300044765 | Bacteria | 3507 |
| 500 | Ga0466970_0038027 | 3300044765 | Bacteria | 2552 |
| 501 | Ga0466957_0002193 | 3300044842 | Bacteria | 10465 |
| 502 | Ga0466957_0040992 | 3300044842 | Bacteria | 2799 |
| 503 | Ga0466957_0154003 | 3300044842 | Bacteria | 1488 |
| 504 | Ga0466959_0001105 | 3300045049 | Bacteria | 16198 |
| 505 | Ga0466959_0001324 | 3300045049 | Bacteria | 15052 |
| 506 | Ga0466959_0005794 | 3300045049 | Bacteria | 8508 |
| 507 | Ga0451576_0004811 | 3300045051 | Bacteria | 17299 |
| 508 | Ga0451576_0041466 | 3300045051 | Bacteria | 4866 |
| 509 | Ga0451576_0316796 | 3300045051 | Bacteria | 1632 |
| 510 | Ga0466958_0073357 | 3300045836 | Bacteria | 2096 |
| 511 | Ga0466958_0188840 | 3300045836 | Bacteria | 1309 |
| 512 | Ga0466967_0035175 | 3300045976 | Bacteria | 4260 |
| 513 | Ga0466967_0057621 | 3300045976 | Bacteria | 3430 |
| 514 | Ga0466967_0997075 | 3300045976 | Bacteria | 834 |
| 515 | Ga0495617_028456 | 3300046452 | Bacteria | 1878 |
| 516 | Ga0495617_063430 | 3300046452 | Bacteria | 1220 |
| 517 | Ga0495627_000064 | 3300046453 | Bacteria | 132648 |
| 518 | Ga0495592_0000234 | 3300046454 | Bacteria | 47791 |
| 519 | Ga0495590_0063523 | 3300046457 | Bacteria | 1292 |
| 520 | Ga0495591_007342 | 3300046458 | Bacteria | 4701 |
| 521 | Ga0495629_0210294 | 3300046459 | Bacteria | 1344 |
| 522 | Ga0495638_0024870 | 3300046460 | Bacteria | 3898 |
| 523 | Ga0495638_0228235 | 3300046460 | Bacteria | 1037 |
| 524 | Ga0495650_0022520 | 3300046471 | Bacteria | 3019 |
| 525 | Ga0495580_0279121 | 3300046472 | Bacteria | 1140 |
| 526 | Ga0495605_0161223 | 3300046474 | Bacteria | 995 |
| 527 | Ga0495584_0011483 | 3300046491 | Bacteria | 4537 |
| 528 | Ga0495585_0157347 | 3300046492 | Bacteria | 1181 |
| 529 | Ga0495596_0013038 | 3300046500 | Bacteria | 3540 |
| 530 | Ga0495607_0014048 | 3300046501 | Bacteria | 5226 |
| 531 | Ga0495630_0049651 | 3300046517 | Bacteria | 3140 |
| 532 | Ga0495631_0000188 | 3300046518 | Bacteria | 42112 |
| 533 | Ga0495631_0069679 | 3300046518 | Bacteria | 1521 |
| 534 | Ga0495632_0002230 | 3300046519 | Bacteria | 14956 |
| 535 | Ga0495632_0059359 | 3300046519 | Bacteria | 1861 |
| 536 | Ga0495632_0145766 | 3300046519 | Bacteria | 1096 |
| 537 | Ga0495632_0182342 | 3300046519 | Bacteria | 961 |
| 538 | Ga0495637_0000027 | 3300046520 | Bacteria | 146241 |
| 539 | Ga0495648_0018920 | 3300046524 | Bacteria | 4859 |
| 540 | Ga0495648_0121022 | 3300046524 | Bacteria | 1407 |
| 541 | Ga0495642_0025588 | 3300046528 | Bacteria | 2340 |
| 542 | Ga0495654_0004383 | 3300046530 | Bacteria | 8397 |
| 543 | Ga0495654_0033670 | 3300046530 | Bacteria | 2591 |
| 544 | Ga0495586_0083944 | 3300046535 | Bacteria | 1753 |
| 545 | Ga0495587_0501596 | 3300046536 | Bacteria | 671 |
| 546 | Ga0495598_0005228 | 3300046537 | Bacteria | 2863 |
| 547 | Ga0495645_0305689 | 3300046543 | Bacteria | 1037 |
| 548 | Ga0495645_0348092 | 3300046543 | Bacteria | 955 |
| 549 | Ga0495668_0066838 | 3300046616 | Bacteria | 1978 |
| 550 | Ga0495668_0111330 | 3300046616 | Bacteria | 1497 |
| 551 | Ga0495668_0168760 | 3300046616 | Bacteria | 1199 |
| 552 | Ga0495611_0000387 | 3300046648 | Bacteria | 27957 |
| 553 | Ga0495611_0085217 | 3300046648 | Bacteria | 1457 |
| 554 | Ga0495625_0109410 | 3300046660 | Bacteria | 1890 |
| 555 | Ga0495625_0167567 | 3300046660 | Bacteria | 1468 |
| 556 | Ga0495625_0267362 | 3300046660 | Bacteria | 1105 |
| 557 | Ga0495635_0177890 | 3300046663 | Bacteria | 1446 |
| 558 | Ga0495661_0000119 | 3300046665 | Bacteria | 94133 |
| 559 | Ga0495646_0302222 | 3300046680 | Bacteria | 846 |
| 560 | Ga0495647_0016908 | 3300046681 | Bacteria | 2575 |
| 561 | Ga0495658_0054733 | 3300046683 | Bacteria | 2271 |
| 562 | Ga0495658_0275941 | 3300046683 | Unclassified | 1060 |
| 563 | Ga0495624_0422115 | 3300046690 | Bacteria | 800 |
| 564 | Ga0495671_0004098 | 3300046692 | Bacteria | 8790 |
| 565 | Ga0495671_0351677 | 3300046692 | Bacteria | 707 |
| 566 | Ga0495671_0443020 | 3300046692 | Bacteria | 621 |
| 567 | Ga0495649_0033682 | 3300046694 | Bacteria | 2819 |
| 568 | Ga0495600_0218774 | 3300046809 | Bacteria | 1219 |
| 569 | Ga0495660_0009019 | 3300046810 | Bacteria | 5827 |
| 570 | Ga0495636_0206736 | 3300047318 | Bacteria | 898 |
| 571 | Ga0495672_0001209 | 3300047320 | Bacteria | 26035 |
| 572 | Ga0495672_0303791 | 3300047320 | Bacteria | 755 |
| 573 | Ga0495683_0067765 | 3300047323 | Bacteria | 1757 |
| 574 | Ga0495687_067083 | 3300047443 | Bacteria | 1453 |
| 575 | Ga0495679_003634 | 3300047446 | Bacteria | 7369 |
| 576 | Ga0495673_0000619 | 3300047469 | Bacteria | 35084 |
| 577 | Ga0495673_0015333 | 3300047469 | Bacteria | 3950 |
| 578 | Ga0495673_0104030 | 3300047469 | Bacteria | 1144 |
| 579 | Ga0495681_0018390 | 3300047470 | Bacteria | 3852 |
| 580 | Ga0495681_0020867 | 3300047470 | Bacteria | 3543 |
| 581 | Ga0495684_0131409 | 3300047471 | Bacteria | 1880 |
| 582 | Ga0495686_0002472 | 3300047472 | Bacteria | 17402 |
| 583 | Ga0495686_0017940 | 3300047472 | Bacteria | 4758 |
| 584 | Ga0495593_0045829 | 3300047673 | Bacteria | 2332 |
| 585 | Ga0495615_0109221 | 3300048090 | Bacteria | 790 |
| 586 | Ga0495626_0024170 | 3300048091 | Bacteria | 2982 |
| 587 | Ga0496102_0005822 | 3300048905 | Bacteria | 10484 |
| 588 | Ga0496104_0324693 | 3300048907 | Bacteria | 1452 |
| 589 | Ga0496106_0164194 | 3300048909 | Bacteria | 1757 |
| 590 | Ga0496108_0174344 | 3300048911 | Bacteria | 1861 |
| 591 | Ga0496108_0386617 | 3300048911 | Bacteria | 1222 |
| 592 | Ga0496109_1002921 | 3300048912 | Bacteria | 772 |
| 593 | Ga0496110_0563763 | 3300048913 | Bacteria | 1035 |
| 594 | Ga0496113_0169424 | 3300048916 | Bacteria | 1729 |
| 595 | Ga0496114_0085754 | 3300048917 | Bacteria | 2668 |
| 596 | Ga0496114_0809535 | 3300048917 | Bacteria | 816 |
| 597 | Ga0496124_0001949 | 3300048927 | Bacteria | 28205 |
| 598 | Ga0501309_000375 | 3300049129 | Bacteria | 3443 |
| 599 | Ga0501310_000289 | 3300049130 | Bacteria | 4621 |
| 600 | Ga0495678_003717 | 3300049459 | Bacteria | 9229 |
| 601 | Ga0501296_015210 | 3300049519 | Bacteria | 948 |
| 602 | Ga0501031_0023849 | 3300049568 | Bacteria | 3989 |
| 603 | Ga0501033_0614811 | 3300049570 | Bacteria | 744 |
| 604 | Ga0501034_0192270 | 3300049571 | Bacteria | 2002 |
| 605 | Ga0501037_0588831 | 3300049573 | Bacteria | 748 |
| 606 | Ga0501038_0074082 | 3300049574 | Bacteria | 2881 |
| 607 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 608 | Ga0501043_0040718 | 3300049579 | Bacteria | 3652 |
| 609 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 610 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 611 | Ga0501047_0772724 | 3300049581 | Bacteria | 776 |
| 612 | Ga0501048_0004056 | 3300049582 | Bacteria | 11148 |
| 613 | Ga0501070_0651930 | 3300049586 | Bacteria | 836 |
| 614 | Ga0501073_0258670 | 3300049589 | Bacteria | 1201 |
| 615 | Ga0501222_002799 | 3300049662 | Bacteria | 2415 |
| 616 | Ga0501235_006024 | 3300049669 | Bacteria | 2639 |
| 617 | Ga0501229_001801 | 3300049706 | Bacteria | 2510 |
| 618 | Ga0501083_0020387 | 3300049744 | Bacteria | 4612 |
| 619 | Ga0501083_0234072 | 3300049744 | Bacteria | 1196 |
| 620 | Ga0501265_007658 | 3300049762 | Bacteria | 1275 |
| 621 | Ga0501272_013324 | 3300049769 | Bacteria | 941 |
| 622 | Ga0501044_0422711 | 3300049823 | Bacteria | 1242 |
| 623 | Ga0501045_0064557 | 3300049824 | Bacteria | 2687 |
| 624 | nmdc:mga03683_119957_c1 | 3300050489 | Bacteria | 1169 |
| 625 | nmdc:mga03683_19275_c1 | 3300050489 | Bacteria | 2603 |
| 626 | nmdc:mga03n38_346253_c1 | 3300050490 | Bacteria | 808 |
| 627 | nmdc:mga03n38_7556_c1 | 3300050490 | Bacteria | 3851 |
| 628 | nmdc:mga03n38_82306_c1 | 3300050490 | Bacteria | 1515 |
| 629 | nmdc:mga00v17_28164_c1 | 3300050491 | Bacteria | 3289 |
| 630 | nmdc:mga0yw44_13938_c1 | 3300050492 | Bacteria | 4250 |
| 631 | nmdc:mga0yw44_460892_c1 | 3300050492 | Bacteria | 861 |
| 632 | nmdc:mga0k408_110234_c1 | 3300050493 | Bacteria | 1627 |
| 633 | nmdc:mga0k408_1103_c1 | 3300050493 | Bacteria | 14781 |
| 634 | nmdc:mga0k408_117393_c1 | 3300050493 | Bacteria | 1575 |
| 635 | nmdc:mga0k408_192315_c1 | 3300050493 | Bacteria | 1218 |
| 636 | nmdc:mga0k408_203424_c1 | 3300050493 | Bacteria | 1182 |
| 637 | nmdc:mga0k408_250777_c1 | 3300050493 | Bacteria | 1057 |
| 638 | nmdc:mga0k408_416660_c1 | 3300050493 | Bacteria | 799 |
| 639 | nmdc:mga0k408_53151_c2 | 3300050493 | Bacteria | 2023 |
| 640 | nmdc:mga0k408_5513_c1 | 3300050493 | Bacteria | 6735 |
| 641 | nmdc:mga0k408_57336_c1 | 3300050493 | Bacteria | 2261 |
| 642 | nmdc:mga06z11_123202_c1 | 3300050494 | Bacteria | 1448 |
| 643 | nmdc:mga06z11_38598_c1 | 3300050494 | Bacteria | 2373 |
| 644 | nmdc:mga06z11_862_c1 | 3300050494 | Bacteria | 11061 |
| 645 | nmdc:mga04h51_3500_c1 | 3300050495 | Bacteria | 3819 |
| 646 | nmdc:mga04h51_9485_c1 | 3300050495 | Bacteria | 2641 |
| 647 | nmdc:mga07m45_17593_c1 | 3300050496 | Bacteria | 3843 |
| 648 | nmdc:mga07m45_25358_c1 | 3300050496 | Bacteria | 3252 |
| 649 | nmdc:mga07m45_349666_c1 | 3300050496 | Bacteria | 859 |
| 650 | nmdc:mga07m45_3671_c1 | 3300050496 | Bacteria | 7418 |
| 651 | nmdc:mga07m45_42_c1 | 3300050496 | Bacteria | 58731 |
| 652 | nmdc:mga07m45_53357_c1 | 3300050496 | Bacteria | 2284 |
| 653 | nmdc:mga07m45_6482_c1 | 3300050496 | Bacteria | 5919 |
| 654 | nmdc:mga07m45_678_c2 | 3300050496 | Bacteria | 13120 |
| 655 | nmdc:mga07m45_74121_c1 | 3300050496 | Bacteria | 1939 |
| 656 | nmdc:mga07m45_74737_c1 | 3300050496 | Bacteria | 1931 |
| 657 | nmdc:mga07m45_9426_c1 | 3300050496 | Bacteria | 5066 |
| 658 | nmdc:mga09592_691080_c1 | 3300050508 | Bacteria | 869 |
| 659 | nmdc:mga0qj67_18_c1 | 3300050509 | Bacteria | 120268 |
| 660 | nmdc:mga0qj67_256481_c1 | 3300050509 | Bacteria | 1419 |
| 661 | nmdc:mga06r32_968087_c1 | 3300050510 | Bacteria | 805 |
| 662 | nmdc:mga08y16_437046_c1 | 3300050511 | Bacteria | 1336 |
| 663 | nmdc:mga0sz30_8809_c1 | 3300050516 | Bacteria | 3823 |
| 664 | Ga0495601_0042029 | 3300053077 | Bacteria | 2867 |
| 665 | Ga0495595_0194234 | 3300053084 | Bacteria | 1009 |
| 666 | Ga0495619_0012300 | 3300053085 | Bacteria | 5386 |
| 667 | Ga0495619_0161263 | 3300053085 | Bacteria | 1549 |
| 668 | Ga0500578_0001649 | 3300053086 | Bacteria | 21508 |
| 669 | Ga0500578_0031796 | 3300053086 | Bacteria | 3392 |
| 670 | Ga0500644_0000852 | 3300053088 | Bacteria | 10154 |
| 671 | Ga0500646_0035588 | 3300053090 | Bacteria | 1384 |
| 672 | Ga0500583_0076367 | 3300053092 | Bacteria | 1611 |
| 673 | Ga0500583_0314632 | 3300053092 | Bacteria | 764 |
| 674 | Ga0500651_0030527 | 3300053093 | Bacteria | 3390 |
| 675 | Ga0500651_0074794 | 3300053093 | Bacteria | 2105 |
| 676 | Ga0500650_0065133 | 3300053098 | Bacteria | 1702 |
| 677 | Ga0500650_0227918 | 3300053098 | Bacteria | 841 |
| 678 | Ga0500593_122548 | 3300053117 | Bacteria | 1051 |
| 679 | Ga0500642_0024727 | 3300053130 | Bacteria | 2430 |
| 680 | Ga0500652_000263 | 3300053131 | Bacteria | 19634 |
| 681 | Ga0500652_026551 | 3300053131 | Bacteria | 2231 |
| 682 | Ga0500655_025944 | 3300053133 | Bacteria | 1113 |
| 683 | Ga0500658_0005271 | 3300053134 | Bacteria | 4810 |
| 684 | Ga0500561_0040562 | 3300053137 | Bacteria | 1227 |
| 685 | Ga0500568_0087511 | 3300053139 | Bacteria | 1177 |
| 686 | Ga0500568_0144076 | 3300053139 | Bacteria | 882 |
| 687 | Ga0500577_0155974 | 3300053142 | Bacteria | 970 |
| 688 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 689 | Ga0500619_031869 | 3300053154 | Bacteria | 1612 |
| 690 | Ga0500622_0001292 | 3300053156 | Bacteria | 20381 |
| 691 | Ga0500627_0012493 | 3300053158 | Bacteria | 3186 |
| 692 | Ga0500636_0176962 | 3300053177 | Bacteria | 1149 |
| 693 | Ga0500570_119664 | 3300053724 | Bacteria | 1038 |
| 694 | Ga0500645_062633 | 3300053730 | Bacteria | 1074 |
| 695 | Ga0501082_0210377 | 3300060353 | Bacteria | 1692 |
| 696 | Ga0501082_0605194 | 3300060353 | Bacteria | 959 |
| 697 | Ga0466962_0001856 | 3300061719 | Bacteria | 9932 |
| 698 | Ga0466962_0005417 | 3300061719 | Bacteria | 6135 |
| 699 | Ga0466962_0044851 | 3300061719 | Bacteria | 2114 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0085909 | Ga0395905_0085909_2372_2908 | 169 |
| 2 | 3300044656 | Ga0466969_0000640 | Ga0466969_0000640_16137_16673 | 169 |
| 3 | 3300044684 | Ga0466966_0002104 | Ga0466966_0002104_5927_6463 | 169 |
| 4 | 3300044693 | Ga0466961_0042894 | Ga0466961_0042894_1813_2349 | 169 |
| 5 | 3300044719 | Ga0466971_0004888 | Ga0466971_0004888_3563_4099 | 169 |
| 6 | 3300044765 | Ga0466970_0038027 | Ga0466970_0038027_1279_1815 | 169 |
| 7 | 3300044842 | Ga0466957_0040992 | Ga0466957_0040992_2166_2702 | 169 |
| 8 | 3300045049 | Ga0466959_0001324 | Ga0466959_0001324_12434_12970 | 169 |
| 9 | 3300061719 | Ga0466962_0001856 | Ga0466962_0001856_7595_8131 | 169 |
| 10 | 3300006846 | Ga0075430_100000276 | Ga0075430_10000027622 | 171 |
| 11 | 3300047320 | Ga0495672_0303791 | Ga0495672_0303791_229_744 | 171 |
| 12 | 3300050509 | nmdc:mga0qj67_18_c1 | nmdc:mga0qj67_18_c1_76077_76592 | 171 |
| 13 | iso_pu_bacteria | 8008485437 | 8008489359 | 171 |
| 14 | iso_pu_bacteria | 8025524527 | 8025529065 | 171 |
| 15 | 3300031995 | Ga0307409_100519124 | Ga0307409_1005191242 | 172 |
| 16 | 3300032005 | Ga0307411_10820882 | Ga0307411_108208822 | 172 |
| 17 | 3300050493 | nmdc:mga0k408_57336_c1 | nmdc:mga0k408_57336_c1_1111_1629 | 172 |
| 18 | 3300039437 | Ga0436365_1527322 | Ga0436365_1527322_440_961 | 173 |
| 19 | 3300041505 | Ga0451849_1333857 | Ga0451849_1333857_14_535 | 173 |
| 20 | 3300049570 | Ga0501033_0614811 | Ga0501033_0614811_96_620 | 173 |
| 21 | 3300049581 | Ga0501047_0772724 | Ga0501047_0772724_233_757 | 173 |
| 22 | 3300053088 | Ga0500644_0000852 | Ga0500644_0000852_1088_1624 | 173 |
| 23 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1400566_1401102 | 173 |
| 24 | iso_pu_bacteria | 2643221544 | 2643746873 | 173 |
| 25 | iso_pu_bacteria | 2643221646 | 2644259894 | 173 |
| 26 | iso_pu_bacteria | 2738541337 | 2739057555 | 173 |
| 27 | 3300005356 | Ga0070674_101443897 | Ga0070674_1014438971 | 174 |
| 28 | 3300006846 | Ga0075430_100138515 | Ga0075430_1001385153 | 174 |
| 29 | 3300006847 | Ga0075431_100034277 | Ga0075431_1000342773 | 174 |
| 30 | 3300006880 | Ga0075429_100682159 | Ga0075429_1006821592 | 174 |
| 31 | 3300009098 | Ga0105245_10257453 | Ga0105245_102574532 | 174 |
| 32 | 3300013306 | Ga0163162_11235551 | Ga0163162_112355512 | 174 |
| 33 | 3300037418 | Ga0395900_0131850 | Ga0395900_0131850_1601_2125 | 174 |
| 34 | 3300037471 | Ga0395905_0131557 | Ga0395905_0131557_1019_1543 | 174 |
| 35 | 3300044735 | Ga0466968_0063314 | Ga0466968_0063314_372_902 | 174 |
| 36 | 3300049744 | Ga0501083_0020387 | Ga0501083_0020387_1844_2368 | 174 |
| 37 | 3300050492 | nmdc:mga0yw44_460892_c1 | nmdc:mga0yw44_460892_c1_128_652 | 174 |
| 38 | 3300050493 | nmdc:mga0k408_53151_c2 | nmdc:mga0k408_53151_c2_120_644 | 174 |
| 39 | 3300050508 | nmdc:mga09592_691080_c1 | nmdc:mga09592_691080_c1_290_832 | 174 |
| 40 | 3300050509 | nmdc:mga0qj67_256481_c1 | nmdc:mga0qj67_256481_c1_508_1050 | 174 |
| 41 | 3300050510 | nmdc:mga06r32_968087_c1 | nmdc:mga06r32_968087_c1_16_558 | 174 |
| 42 | iso_pu_bacteria | 2928972540 | 2928975075 | 174 |
| 43 | 3300005327 | Ga0070658_10175324 | Ga0070658_101753243 | 175 |
| 44 | 3300005328 | Ga0070676_10014860 | Ga0070676_100148604 | 175 |
| 45 | 3300005330 | Ga0070690_100025986 | Ga0070690_1000259864 | 175 |
| 46 | 3300005331 | Ga0070670_100034202 | Ga0070670_1000342024 | 175 |
| 47 | 3300005331 | Ga0070670_100154253 | Ga0070670_1001542533 | 175 |
| 48 | 3300005331 | Ga0070670_100189689 | Ga0070670_1001896893 | 175 |
| 49 | 3300005331 | Ga0070670_100201949 | Ga0070670_1002019494 | 175 |
| 50 | 3300005331 | Ga0070670_100546112 | Ga0070670_1005461122 | 175 |
| 51 | 3300005333 | Ga0070677_10010433 | Ga0070677_100104334 | 175 |
| 52 | 3300005334 | Ga0068869_100068206 | Ga0068869_1000682064 | 175 |
| 53 | 3300005335 | Ga0070666_10031672 | Ga0070666_100316723 | 175 |
| 54 | 3300005335 | Ga0070666_10648026 | Ga0070666_106480261 | 175 |
| 55 | 3300005336 | Ga0070680_100063571 | Ga0070680_1000635714 | 175 |
| 56 | 3300005344 | Ga0070661_100216549 | Ga0070661_1002165493 | 175 |
| 57 | 3300005344 | Ga0070661_100243120 | Ga0070661_1002431202 | 175 |
| 58 | 3300005344 | Ga0070661_100773009 | Ga0070661_1007730091 | 175 |
| 59 | 3300005347 | Ga0070668_100029372 | Ga0070668_1000293722 | 175 |
| 60 | 3300005353 | Ga0070669_100094865 | Ga0070669_1000948652 | 175 |
| 61 | 3300005354 | Ga0070675_100157873 | Ga0070675_1001578731 | 175 |
| 62 | 3300005354 | Ga0070675_100255222 | Ga0070675_1002552223 | 175 |
| 63 | 3300005354 | Ga0070675_100304644 | Ga0070675_1003046441 | 175 |
| 64 | 3300005355 | Ga0070671_100017107 | Ga0070671_1000171075 | 175 |
| 65 | 3300005355 | Ga0070671_100716595 | Ga0070671_1007165951 | 175 |
| 66 | 3300005355 | Ga0070671_100859344 | Ga0070671_1008593441 | 175 |
| 67 | 3300005356 | Ga0070674_100029218 | Ga0070674_1000292181 | 175 |
| 68 | 3300005356 | Ga0070674_100064420 | Ga0070674_1000644204 | 175 |
| 69 | 3300005364 | Ga0070673_100267450 | Ga0070673_1002674503 | 175 |
| 70 | 3300005364 | Ga0070673_100354152 | Ga0070673_1003541522 | 175 |
| 71 | 3300005364 | Ga0070673_100609382 | Ga0070673_1006093822 | 175 |
| 72 | 3300005367 | Ga0070667_100004388 | Ga0070667_10000438817 | 175 |
| 73 | 3300005367 | Ga0070667_100169376 | Ga0070667_1001693764 | 175 |
| 74 | 3300005367 | Ga0070667_100276275 | Ga0070667_1002762753 | 175 |
| 75 | 3300005441 | Ga0070700_100405888 | Ga0070700_1004058881 | 175 |
| 76 | 3300005455 | Ga0070663_100106355 | Ga0070663_1001063554 | 175 |
| 77 | 3300005455 | Ga0070663_100795743 | Ga0070663_1007957431 | 175 |
| 78 | 3300005456 | Ga0070678_100078197 | Ga0070678_1000781973 | 175 |
| 79 | 3300005456 | Ga0070678_100134691 | Ga0070678_1001346913 | 175 |
| 80 | 3300005456 | Ga0070678_100375739 | Ga0070678_1003757392 | 175 |
| 81 | 3300005456 | Ga0070678_101076557 | Ga0070678_1010765571 | 175 |
| 82 | 3300005457 | Ga0070662_100023184 | Ga0070662_1000231844 | 175 |
| 83 | 3300005457 | Ga0070662_100073830 | Ga0070662_1000738304 | 175 |
| 84 | 3300005459 | Ga0068867_100095372 | Ga0068867_1000953722 | 175 |
| 85 | 3300005459 | Ga0068867_100635945 | Ga0068867_1006359452 | 175 |
| 86 | 3300005530 | Ga0070679_100021313 | Ga0070679_1000213134 | 175 |
| 87 | 3300005535 | Ga0070684_100174632 | Ga0070684_1001746323 | 175 |
| 88 | 3300005535 | Ga0070684_100690595 | Ga0070684_1006905952 | 175 |
| 89 | 3300005543 | Ga0070672_100039130 | Ga0070672_1000391303 | 175 |
| 90 | 3300005543 | Ga0070672_100064493 | Ga0070672_1000644932 | 175 |
| 91 | 3300005543 | Ga0070672_100108581 | Ga0070672_1001085813 | 175 |
| 92 | 3300005543 | Ga0070672_100110940 | Ga0070672_1001109402 | 175 |
| 93 | 3300005543 | Ga0070672_100845456 | Ga0070672_1008454562 | 175 |
| 94 | 3300005544 | Ga0070686_100119616 | Ga0070686_1001196163 | 175 |
| 95 | 3300005547 | Ga0070693_100648521 | Ga0070693_1006485211 | 175 |
| 96 | 3300005563 | Ga0068855_100282473 | Ga0068855_1002824732 | 175 |
| 97 | 3300005563 | Ga0068855_101314445 | Ga0068855_1013144452 | 175 |
| 98 | 3300005564 | Ga0070664_100060332 | Ga0070664_1000603324 | 175 |
| 99 | 3300005564 | Ga0070664_100382778 | Ga0070664_1003827782 | 175 |
| 100 | 3300005564 | Ga0070664_100751193 | Ga0070664_1007511932 | 175 |
| 101 | 3300005578 | Ga0068854_100350207 | Ga0068854_1003502072 | 175 |
| 102 | 3300005578 | Ga0068854_100622988 | Ga0068854_1006229882 | 175 |
| 103 | 3300005616 | Ga0068852_100858564 | Ga0068852_1008585642 | 175 |
| 104 | 3300005616 | Ga0068852_100979678 | Ga0068852_1009796782 | 175 |
| 105 | 3300005616 | Ga0068852_101010263 | Ga0068852_1010102632 | 175 |
| 106 | 3300005617 | Ga0068859_100135444 | Ga0068859_1001354443 | 175 |
| 107 | 3300005618 | Ga0068864_100046435 | Ga0068864_1000464352 | 175 |
| 108 | 3300005618 | Ga0068864_100157469 | Ga0068864_1001574692 | 175 |
| 109 | 3300005618 | Ga0068864_100793040 | Ga0068864_1007930402 | 175 |
| 110 | 3300005618 | Ga0068864_100807020 | Ga0068864_1008070202 | 175 |
| 111 | 3300005618 | Ga0068864_100896548 | Ga0068864_1008965481 | 175 |
| 112 | 3300005718 | Ga0068866_10095345 | Ga0068866_100953452 | 175 |
| 113 | 3300005718 | Ga0068866_10366802 | Ga0068866_103668022 | 175 |
| 114 | 3300005719 | Ga0068861_100301307 | Ga0068861_1003013073 | 175 |
| 115 | 3300005719 | Ga0068861_100499223 | Ga0068861_1004992231 | 175 |
| 116 | 3300005841 | Ga0068863_100053520 | Ga0068863_1000535203 | 175 |
| 117 | 3300005841 | Ga0068863_100315660 | Ga0068863_1003156603 | 175 |
| 118 | 3300005842 | Ga0068858_100003791 | Ga0068858_10000379118 | 175 |
| 119 | 3300005843 | Ga0068860_100004033 | Ga0068860_10000403317 | 175 |
| 120 | 3300005844 | Ga0068862_100005370 | Ga0068862_10000537010 | 175 |
| 121 | 3300006163 | Ga0070715_10396644 | Ga0070715_103966441 | 175 |
| 122 | 3300006237 | Ga0097621_100170721 | Ga0097621_1001707212 | 175 |
| 123 | 3300006237 | Ga0097621_101335742 | Ga0097621_1013357421 | 175 |
| 124 | 3300006358 | Ga0068871_100037260 | Ga0068871_1000372606 | 175 |
| 125 | 3300006358 | Ga0068871_100137485 | Ga0068871_1001374853 | 175 |
| 126 | 3300006881 | Ga0068865_100222079 | Ga0068865_1002220793 | 175 |
| 127 | 3300006931 | Ga0097620_100135435 | Ga0097620_1001354353 | 175 |
| 128 | 3300009176 | Ga0105242_10274465 | Ga0105242_102744652 | 175 |
| 129 | 3300009177 | Ga0105248_10209361 | Ga0105248_102093613 | 175 |
| 130 | 3300009177 | Ga0105248_10368514 | Ga0105248_103685143 | 175 |
| 131 | 3300009551 | Ga0105238_11749555 | Ga0105238_117495551 | 175 |
| 132 | 3300013100 | Ga0157373_10038721 | Ga0157373_100387213 | 175 |
| 133 | 3300013102 | Ga0157371_10207035 | Ga0157371_102070352 | 175 |
| 134 | 3300013104 | Ga0157370_10742816 | Ga0157370_107428162 | 175 |
| 135 | 3300013105 | Ga0157369_10065353 | Ga0157369_100653532 | 175 |
| 136 | 3300013296 | Ga0157374_10385984 | Ga0157374_103859842 | 175 |
| 137 | 3300013296 | Ga0157374_10496992 | Ga0157374_104969922 | 175 |
| 138 | 3300013297 | Ga0157378_10056830 | Ga0157378_100568303 | 175 |
| 139 | 3300013307 | Ga0157372_10167119 | Ga0157372_101671194 | 175 |
| 140 | 3300013308 | Ga0157375_10012775 | Ga0157375_100127753 | 175 |
| 141 | 3300013308 | Ga0157375_10184225 | Ga0157375_101842254 | 175 |
| 142 | 3300014325 | Ga0163163_10435639 | Ga0163163_104356392 | 175 |
| 143 | 3300014325 | Ga0163163_11680361 | Ga0163163_116803611 | 175 |
| 144 | 3300014326 | Ga0157380_10134265 | Ga0157380_101342652 | 175 |
| 145 | 3300014745 | Ga0157377_10518514 | Ga0157377_105185142 | 175 |
| 146 | 3300014968 | Ga0157379_10282749 | Ga0157379_102827492 | 175 |
| 147 | 3300014968 | Ga0157379_10879047 | Ga0157379_108790471 | 175 |
| 148 | 3300014968 | Ga0157379_11031976 | Ga0157379_110319762 | 175 |
| 149 | 3300015265 | Ga0182005_1054393 | Ga0182005_10543932 | 175 |
| 150 | 3300017792 | Ga0163161_11081601 | Ga0163161_110816011 | 175 |
| 151 | 3300025315 | Ga0207697_10022812 | Ga0207697_100228122 | 175 |
| 152 | 3300025893 | Ga0207682_10008329 | Ga0207682_100083294 | 175 |
| 153 | 3300025893 | Ga0207682_10015553 | Ga0207682_100155533 | 175 |
| 154 | 3300025899 | Ga0207642_10017450 | Ga0207642_100174504 | 175 |
| 155 | 3300025899 | Ga0207642_10283320 | Ga0207642_102833202 | 175 |
| 156 | 3300025901 | Ga0207688_10056594 | Ga0207688_100565943 | 175 |
| 157 | 3300025903 | Ga0207680_10032671 | Ga0207680_100326713 | 175 |
| 158 | 3300025903 | Ga0207680_10042631 | Ga0207680_100426312 | 175 |
| 159 | 3300025907 | Ga0207645_10020411 | Ga0207645_100204114 | 175 |
| 160 | 3300025908 | Ga0207643_10524779 | Ga0207643_105247792 | 175 |
| 161 | 3300025917 | Ga0207660_10021246 | Ga0207660_100212464 | 175 |
| 162 | 3300025919 | Ga0207657_10236997 | Ga0207657_102369972 | 175 |
| 163 | 3300025920 | Ga0207649_10450271 | Ga0207649_104502712 | 175 |
| 164 | 3300025921 | Ga0207652_10008328 | Ga0207652_100083284 | 175 |
| 165 | 3300025923 | Ga0207681_10002043 | Ga0207681_1000204313 | 175 |
| 166 | 3300025923 | Ga0207681_10138395 | Ga0207681_101383952 | 175 |
| 167 | 3300025924 | Ga0207694_10345605 | Ga0207694_103456052 | 175 |
| 168 | 3300025925 | Ga0207650_10001150 | Ga0207650_1000115017 | 175 |
| 169 | 3300025925 | Ga0207650_10052371 | Ga0207650_100523712 | 175 |
| 170 | 3300025925 | Ga0207650_10286159 | Ga0207650_102861592 | 175 |
| 171 | 3300025926 | Ga0207659_10021737 | Ga0207659_100217376 | 175 |
| 172 | 3300025926 | Ga0207659_10562337 | Ga0207659_105623372 | 175 |
| 173 | 3300025931 | Ga0207644_10005994 | Ga0207644_100059947 | 175 |
| 174 | 3300025931 | Ga0207644_10556920 | Ga0207644_105569202 | 175 |
| 175 | 3300025931 | Ga0207644_10958669 | Ga0207644_109586691 | 175 |
| 176 | 3300025932 | Ga0207690_10477561 | Ga0207690_104775612 | 175 |
| 177 | 3300025932 | Ga0207690_10572212 | Ga0207690_105722122 | 175 |
| 178 | 3300025933 | Ga0207706_10033661 | Ga0207706_100336614 | 175 |
| 179 | 3300025933 | Ga0207706_10051513 | Ga0207706_100515134 | 175 |
| 180 | 3300025934 | Ga0207686_10409046 | Ga0207686_104090462 | 175 |
| 181 | 3300025934 | Ga0207686_11087071 | Ga0207686_110870711 | 175 |
| 182 | 3300025935 | Ga0207709_10021965 | Ga0207709_100219652 | 175 |
| 183 | 3300025936 | Ga0207670_10197720 | Ga0207670_101977203 | 175 |
| 184 | 3300025937 | Ga0207669_10123252 | Ga0207669_101232524 | 175 |
| 185 | 3300025937 | Ga0207669_10138851 | Ga0207669_101388513 | 175 |
| 186 | 3300025937 | Ga0207669_10326427 | Ga0207669_103264272 | 175 |
| 187 | 3300025938 | Ga0207704_10008974 | Ga0207704_100089744 | 175 |
| 188 | 3300025940 | Ga0207691_10268024 | Ga0207691_102680243 | 175 |
| 189 | 3300025940 | Ga0207691_10342612 | Ga0207691_103426123 | 175 |
| 190 | 3300025940 | Ga0207691_10501637 | Ga0207691_105016372 | 175 |
| 191 | 3300025941 | Ga0207711_10063030 | Ga0207711_100630305 | 175 |
| 192 | 3300025941 | Ga0207711_10726230 | Ga0207711_107262302 | 175 |
| 193 | 3300025942 | Ga0207689_10016368 | Ga0207689_100163684 | 175 |
| 194 | 3300025944 | Ga0207661_10245559 | Ga0207661_102455592 | 175 |
| 195 | 3300025945 | Ga0207679_10395117 | Ga0207679_103951172 | 175 |
| 196 | 3300025960 | Ga0207651_10335609 | Ga0207651_103356093 | 175 |
| 197 | 3300025960 | Ga0207651_10401972 | Ga0207651_104019722 | 175 |
| 198 | 3300025960 | Ga0207651_10571754 | Ga0207651_105717542 | 175 |
| 199 | 3300025960 | Ga0207651_10970971 | Ga0207651_109709711 | 175 |
| 200 | 3300025960 | Ga0207651_11290003 | Ga0207651_112900031 | 175 |
| 201 | 3300025961 | Ga0207712_10043014 | Ga0207712_100430144 | 175 |
| 202 | 3300025972 | Ga0207668_10003052 | Ga0207668_100030527 | 175 |
| 203 | 3300025981 | Ga0207640_10071608 | Ga0207640_100716083 | 175 |
| 204 | 3300025981 | Ga0207640_10165065 | Ga0207640_101650652 | 175 |
| 205 | 3300025986 | Ga0207658_10010815 | Ga0207658_100108154 | 175 |
| 206 | 3300026023 | Ga0207677_10197248 | Ga0207677_101972482 | 175 |
| 207 | 3300026035 | Ga0207703_10001541 | Ga0207703_1000154118 | 175 |
| 208 | 3300026067 | Ga0207678_10076508 | Ga0207678_100765084 | 175 |
| 209 | 3300026067 | Ga0207678_10631026 | Ga0207678_106310262 | 175 |
| 210 | 3300026075 | Ga0207708_10036858 | Ga0207708_100368584 | 175 |
| 211 | 3300026078 | Ga0207702_10171048 | Ga0207702_101710483 | 175 |
| 212 | 3300026078 | Ga0207702_11297420 | Ga0207702_112974201 | 175 |
| 213 | 3300026088 | Ga0207641_10000655 | Ga0207641_1000065529 | 175 |
| 214 | 3300026088 | Ga0207641_10037046 | Ga0207641_100370464 | 175 |
| 215 | 3300026088 | Ga0207641_10244785 | Ga0207641_102447853 | 175 |
| 216 | 3300026089 | Ga0207648_10006616 | Ga0207648_100066162 | 175 |
| 217 | 3300026095 | Ga0207676_10060635 | Ga0207676_100606352 | 175 |
| 218 | 3300026095 | Ga0207676_10271087 | Ga0207676_102710871 | 175 |
| 219 | 3300026095 | Ga0207676_10321090 | Ga0207676_103210902 | 175 |
| 220 | 3300026095 | Ga0207676_10514698 | Ga0207676_105146983 | 175 |
| 221 | 3300026116 | Ga0207674_10916080 | Ga0207674_109160802 | 175 |
| 222 | 3300026116 | Ga0207674_11246651 | Ga0207674_112466511 | 175 |
| 223 | 3300026118 | Ga0207675_100095530 | Ga0207675_1000955304 | 175 |
| 224 | 3300026118 | Ga0207675_101036988 | Ga0207675_1010369882 | 175 |
| 225 | 3300026121 | Ga0207683_10113189 | Ga0207683_101131892 | 175 |
| 226 | 3300026121 | Ga0207683_10158397 | Ga0207683_101583973 | 175 |
| 227 | 3300026121 | Ga0207683_10187000 | Ga0207683_101870001 | 175 |
| 228 | 3300026121 | Ga0207683_11290885 | Ga0207683_112908851 | 175 |
| 229 | 3300026142 | Ga0207698_10114183 | Ga0207698_101141834 | 175 |
| 230 | 3300026142 | Ga0207698_10897436 | Ga0207698_108974362 | 175 |
| 231 | 3300026142 | Ga0207698_10932246 | Ga0207698_109322462 | 175 |
| 232 | 3300028379 | Ga0268266_10347242 | Ga0268266_103472423 | 175 |
| 233 | 3300028380 | Ga0268265_10003715 | Ga0268265_1000371510 | 175 |
| 234 | 3300028381 | Ga0268264_10002170 | Ga0268264_1000217013 | 175 |
| 235 | 3300031616 | Ga0307508_10058240 | Ga0307508_100582402 | 175 |
| 236 | 3300031730 | Ga0307516_10297671 | Ga0307516_102976712 | 175 |
| 237 | 3300035116 | Ga0373945_0043125 | Ga0373945_0043125_200_727 | 175 |
| 238 | 3300035118 | Ga0373954_0055761 | Ga0373954_0055761_336_863 | 175 |
| 239 | 3300035120 | Ga0373957_0073248 | Ga0373957_0073248_85_612 | 175 |
| 240 | 3300035171 | Ga0373946_0264695 | Ga0373946_0264695_13_540 | 175 |
| 241 | 3300035410 | Ga0373924_0092603 | Ga0373924_0092603_206_733 | 175 |
| 242 | 3300035692 | Ga0373935_0118199 | Ga0373935_0118199_998_1525 | 175 |
| 243 | 3300035724 | Ga0373933_0246301 | Ga0373933_0246301_603_1130 | 175 |
| 244 | 3300035725 | Ga0373947_0596344 | Ga0373947_0596344_24_551 | 175 |
| 245 | 3300035725 | Ga0373947_0800336 | Ga0373947_0800336_53_580 | 175 |
| 246 | 3300036401 | Ga0373937_0048281 | Ga0373937_0048281_2082_2609 | 175 |
| 247 | 3300036401 | Ga0373937_0220034 | Ga0373937_0220034_1173_1700 | 175 |
| 248 | 3300037068 | Ga0373925_0945811 | Ga0373925_0945811_153_680 | 175 |
| 249 | 3300039437 | Ga0436365_1746291 | Ga0436365_1746291_514_1041 | 175 |
| 250 | 3300041463 | Ga0451804_0697290 | Ga0451804_0697290_21_548 | 175 |
| 251 | 3300046459 | Ga0495629_0210294 | Ga0495629_0210294_540_1067 | 175 |
| 252 | 3300046472 | Ga0495580_0279121 | Ga0495580_0279121_345_872 | 175 |
| 253 | 3300046535 | Ga0495586_0083944 | Ga0495586_0083944_366_893 | 175 |
| 254 | 3300046536 | Ga0495587_0501596 | Ga0495587_0501596_87_614 | 175 |
| 255 | 3300046537 | Ga0495598_0005228 | Ga0495598_0005228_23_550 | 175 |
| 256 | 3300046543 | Ga0495645_0305689 | Ga0495645_0305689_158_685 | 175 |
| 257 | 3300046543 | Ga0495645_0348092 | Ga0495645_0348092_65_592 | 175 |
| 258 | 3300046663 | Ga0495635_0177890 | Ga0495635_0177890_396_923 | 175 |
| 259 | 3300046681 | Ga0495647_0016908 | Ga0495647_0016908_711_1238 | 175 |
| 260 | 3300046683 | Ga0495658_0054733 | Ga0495658_0054733_320_847 | 175 |
| 261 | 3300046809 | Ga0495600_0218774 | Ga0495600_0218774_156_683 | 175 |
| 262 | 3300047471 | Ga0495684_0131409 | Ga0495684_0131409_515_1042 | 175 |
| 263 | 3300047472 | Ga0495686_0002472 | Ga0495686_0002472_13660_14187 | 175 |
| 264 | 3300048090 | Ga0495615_0109221 | Ga0495615_0109221_253_780 | 175 |
| 265 | 3300048907 | Ga0496104_0324693 | Ga0496104_0324693_416_943 | 175 |
| 266 | 3300048911 | Ga0496108_0174344 | Ga0496108_0174344_530_1057 | 175 |
| 267 | 3300048911 | Ga0496108_0386617 | Ga0496108_0386617_254_781 | 175 |
| 268 | 3300048912 | Ga0496109_1002921 | Ga0496109_1002921_176_703 | 175 |
| 269 | 3300048913 | Ga0496110_0563763 | Ga0496110_0563763_141_668 | 175 |
| 270 | 3300048917 | Ga0496114_0085754 | Ga0496114_0085754_1475_2002 | 175 |
| 271 | 3300048917 | Ga0496114_0809535 | Ga0496114_0809535_224_751 | 175 |
| 272 | 3300049568 | Ga0501031_0023849 | Ga0501031_0023849_21_551 | 175 |
| 273 | 3300049571 | Ga0501034_0192270 | Ga0501034_0192270_475_1005 | 175 |
| 274 | 3300049573 | Ga0501037_0588831 | Ga0501037_0588831_53_583 | 175 |
| 275 | 3300049574 | Ga0501038_0074082 | Ga0501038_0074082_2324_2854 | 175 |
| 276 | 3300049579 | Ga0501043_0040718 | Ga0501043_0040718_2275_2805 | 175 |
| 277 | 3300049586 | Ga0501070_0651930 | Ga0501070_0651930_261_791 | 175 |
| 278 | 3300049823 | Ga0501044_0422711 | Ga0501044_0422711_584_1114 | 175 |
| 279 | 3300050511 | nmdc:mga08y16_437046_c1 | nmdc:mga08y16_437046_c1_261_788 | 175 |
| 280 | 3300053077 | Ga0495601_0042029 | Ga0495601_0042029_1324_1851 | 175 |
| 281 | 3300053084 | Ga0495595_0194234 | Ga0495595_0194234_331_858 | 175 |
| 282 | 3300053085 | Ga0495619_0012300 | Ga0495619_0012300_1107_1634 | 175 |
| 283 | 3300053085 | Ga0495619_0161263 | Ga0495619_0161263_977_1504 | 175 |
| 284 | 3300005844 | Ga0068862_100746325 | Ga0068862_1007463251 | 176 |
| 285 | 3300006038 | Ga0075365_10162891 | Ga0075365_101628912 | 176 |
| 286 | 3300006042 | Ga0075368_10049413 | Ga0075368_100494132 | 176 |
| 287 | 3300006048 | Ga0075363_100027648 | Ga0075363_1000276483 | 176 |
| 288 | 3300006051 | Ga0075364_10016731 | Ga0075364_100167312 | 176 |
| 289 | 3300006195 | Ga0075366_10024666 | Ga0075366_100246662 | 176 |
| 290 | 3300006353 | Ga0075370_10007825 | Ga0075370_100078256 | 176 |
| 291 | 3300028794 | Ga0307515_10078173 | Ga0307515_100781733 | 176 |
| 292 | 3300031456 | Ga0307513_10034000 | Ga0307513_100340008 | 176 |
| 293 | 3300032005 | Ga0307411_10513124 | Ga0307411_105131241 | 176 |
| 294 | 3300032126 | Ga0307415_100666264 | Ga0307415_1006662642 | 176 |
| 295 | 3300035114 | Ga0373939_0205096 | Ga0373939_0205096_49_666 | 176 |
| 296 | 3300046452 | Ga0495617_063430 | Ga0495617_063430_325_855 | 176 |
| 297 | 3300046453 | Ga0495627_000064 | Ga0495627_000064_112429_112983 | 176 |
| 298 | 3300046471 | Ga0495650_0022520 | Ga0495650_0022520_2080_2610 | 176 |
| 299 | 3300046518 | Ga0495631_0000188 | Ga0495631_0000188_6953_7507 | 176 |
| 300 | 3300046519 | Ga0495632_0059359 | Ga0495632_0059359_441_971 | 176 |
| 301 | 3300046530 | Ga0495654_0004383 | Ga0495654_0004383_3707_4261 | 176 |
| 302 | 3300046692 | Ga0495671_0004098 | Ga0495671_0004098_449_979 | 176 |
| 303 | 3300047320 | Ga0495672_0001209 | Ga0495672_0001209_19360_19914 | 176 |
| 304 | 3300050493 | nmdc:mga0k408_110234_c1 | nmdc:mga0k408_110234_c1_95_625 | 176 |
| 305 | 3300050494 | nmdc:mga06z11_38598_c1 | nmdc:mga06z11_38598_c1_842_1372 | 176 |
| 306 | 3300050496 | nmdc:mga07m45_53357_c1 | nmdc:mga07m45_53357_c1_1128_1658 | 176 |
| 307 | iso_pu_bacteria | 2585428057 | 2587725006 | 176 |
| 308 | iso_pu_bacteria | 2585428058 | 2587731632 | 176 |
| 309 | iso_pu_bacteria | 2588253510 | 2588292513 | 176 |
| 310 | iso_pu_bacteria | 2643221592 | 2643968112 | 176 |
| 311 | iso_pu_bacteria | 2643221625 | 2644142532 | 176 |
| 312 | iso_pu_bacteria | 2643221648 | 2644276969 | 176 |
| 313 | iso_pu_bacteria | 2643221654 | 2644304064 | 176 |
| 314 | 3300003316 | rootH1_10007880 | rootH1_100078804 | 177 |
| 315 | 3300003322 | rootL2_10001083 | rootL2_100010831 | 177 |
| 316 | 3300003322 | rootL2_10066719 | rootL2_100667192 | 177 |
| 317 | 3300003323 | rootH1_10017493 | rootH1_100174933 | 177 |
| 318 | 3300003323 | rootH1_10077402 | rootH1_100774025 | 177 |
| 319 | 3300005328 | Ga0070676_10233418 | Ga0070676_102334181 | 177 |
| 320 | 3300005355 | Ga0070671_100631594 | Ga0070671_1006315941 | 177 |
| 321 | 3300005356 | Ga0070674_100190740 | Ga0070674_1001907401 | 177 |
| 322 | 3300005364 | Ga0070673_100775346 | Ga0070673_1007753461 | 177 |
| 323 | 3300005367 | Ga0070667_101231522 | Ga0070667_1012315221 | 177 |
| 324 | 3300005455 | Ga0070663_100054597 | Ga0070663_1000545973 | 177 |
| 325 | 3300005457 | Ga0070662_100022743 | Ga0070662_1000227433 | 177 |
| 326 | 3300005577 | Ga0068857_100081284 | Ga0068857_1000812844 | 177 |
| 327 | 3300005577 | Ga0068857_100557525 | Ga0068857_1005575252 | 177 |
| 328 | 3300005577 | Ga0068857_101110459 | Ga0068857_1011104592 | 177 |
| 329 | 3300005578 | Ga0068854_100115079 | Ga0068854_1001150793 | 177 |
| 330 | 3300005616 | Ga0068852_100055501 | Ga0068852_1000555014 | 177 |
| 331 | 3300006038 | Ga0075365_10006162 | Ga0075365_100061626 | 177 |
| 332 | 3300006042 | Ga0075368_10007583 | Ga0075368_100075834 | 177 |
| 333 | 3300006042 | Ga0075368_10020604 | Ga0075368_100206042 | 177 |
| 334 | 3300006048 | Ga0075363_100006792 | Ga0075363_1000067927 | 177 |
| 335 | 3300006048 | Ga0075363_100026281 | Ga0075363_1000262812 | 177 |
| 336 | 3300006051 | Ga0075364_10029373 | Ga0075364_100293736 | 177 |
| 337 | 3300006177 | Ga0075362_10015745 | Ga0075362_100157453 | 177 |
| 338 | 3300006177 | Ga0075362_10024040 | Ga0075362_100240405 | 177 |
| 339 | 3300006177 | Ga0075362_10159420 | Ga0075362_101594202 | 177 |
| 340 | 3300006178 | Ga0075367_10001597 | Ga0075367_100015974 | 177 |
| 341 | 3300006178 | Ga0075367_10005029 | Ga0075367_100050297 | 177 |
| 342 | 3300006178 | Ga0075367_10225898 | Ga0075367_102258981 | 177 |
| 343 | 3300006186 | Ga0075369_10027826 | Ga0075369_100278263 | 177 |
| 344 | 3300006195 | Ga0075366_10000433 | Ga0075366_1000043323 | 177 |
| 345 | 3300006195 | Ga0075366_10045787 | Ga0075366_100457873 | 177 |
| 346 | 3300006195 | Ga0075366_10104698 | Ga0075366_101046982 | 177 |
| 347 | 3300006195 | Ga0075366_10237157 | Ga0075366_102371572 | 177 |
| 348 | 3300006353 | Ga0075370_10000538 | Ga0075370_1000053812 | 177 |
| 349 | 3300006353 | Ga0075370_10000846 | Ga0075370_1000084614 | 177 |
| 350 | 3300006353 | Ga0075370_10106550 | Ga0075370_101065503 | 177 |
| 351 | 3300006353 | Ga0075370_10359469 | Ga0075370_103594691 | 177 |
| 352 | 3300009093 | Ga0105240_10406149 | Ga0105240_104061492 | 177 |
| 353 | 3300009148 | Ga0105243_10033813 | Ga0105243_100338136 | 177 |
| 354 | 3300009148 | Ga0105243_10059454 | Ga0105243_100594541 | 177 |
| 355 | 3300009545 | Ga0105237_10012662 | Ga0105237_100126628 | 177 |
| 356 | 3300009553 | Ga0105249_10044015 | Ga0105249_100440155 | 177 |
| 357 | 3300010375 | Ga0105239_10037984 | Ga0105239_100379844 | 177 |
| 358 | 3300013297 | Ga0157378_10375476 | Ga0157378_103754762 | 177 |
| 359 | 3300013306 | Ga0163162_10022860 | Ga0163162_100228603 | 177 |
| 360 | 3300013308 | Ga0157375_10055359 | Ga0157375_100553593 | 177 |
| 361 | 3300014326 | Ga0157380_10021608 | Ga0157380_100216082 | 177 |
| 362 | 3300014968 | Ga0157379_10048970 | Ga0157379_100489703 | 177 |
| 363 | 3300014969 | Ga0157376_10182194 | Ga0157376_101821943 | 177 |
| 364 | 3300021361 | Ga0213872_10000140 | Ga0213872_1000014028 | 177 |
| 365 | 3300025903 | Ga0207680_10509812 | Ga0207680_105098121 | 177 |
| 366 | 3300025913 | Ga0207695_10388199 | Ga0207695_103881992 | 177 |
| 367 | 3300025914 | Ga0207671_10090935 | Ga0207671_100909352 | 177 |
| 368 | 3300025931 | Ga0207644_10321717 | Ga0207644_103217172 | 177 |
| 369 | 3300025933 | Ga0207706_10008308 | Ga0207706_100083085 | 177 |
| 370 | 3300025935 | Ga0207709_10456811 | Ga0207709_104568111 | 177 |
| 371 | 3300025960 | Ga0207651_10353012 | Ga0207651_103530122 | 177 |
| 372 | 3300025981 | Ga0207640_10074430 | Ga0207640_100744303 | 177 |
| 373 | 3300026067 | Ga0207678_10084333 | Ga0207678_100843333 | 177 |
| 374 | 3300026116 | Ga0207674_10036354 | Ga0207674_100363546 | 177 |
| 375 | 3300026142 | Ga0207698_10052815 | Ga0207698_100528154 | 177 |
| 376 | 3300027866 | Ga0209813_10003088 | Ga0209813_100030882 | 177 |
| 377 | 3300027866 | Ga0209813_10008646 | Ga0209813_100086464 | 177 |
| 378 | 3300028794 | Ga0307515_10200216 | Ga0307515_102002162 | 177 |
| 379 | 3300031456 | Ga0307513_10166466 | Ga0307513_101664663 | 177 |
| 380 | 3300031548 | Ga0307408_100000038 | Ga0307408_10000003899 | 177 |
| 381 | 3300031548 | Ga0307408_100691637 | Ga0307408_1006916371 | 177 |
| 382 | 3300032002 | Ga0307416_100098684 | Ga0307416_1000986844 | 177 |
| 383 | 3300032004 | Ga0307414_10219966 | Ga0307414_102199663 | 177 |
| 384 | 3300032005 | Ga0307411_10000214 | Ga0307411_1000021417 | 177 |
| 385 | 3300034820 | Ga0373959_0011717 | Ga0373959_0011717_830_1372 | 177 |
| 386 | 3300035090 | Ga0373949_0117633 | Ga0373949_0117633_12_557 | 177 |
| 387 | 3300035091 | Ga0373951_0006045 | Ga0373951_0006045_531_1076 | 177 |
| 388 | 3300035114 | Ga0373939_0000092 | Ga0373939_0000092_16129_16674 | 177 |
| 389 | 3300035691 | Ga0373931_0000403 | Ga0373931_0000403_8542_9087 | 177 |
| 390 | 3300037471 | Ga0395905_0007537 | Ga0395905_0007537_4088_4636 | 177 |
| 391 | 3300039447 | Ga0436361_0033949 | Ga0436361_0033949_829_1389 | 177 |
| 392 | 3300039447 | Ga0436361_0749433 | Ga0436361_0749433_25353_25922 | 177 |
| 393 | 3300042004 | Ga0439445_0039050 | Ga0439445_0039050_195_743 | 177 |
| 394 | 3300042116 | Ga0450912_003383 | Ga0450912_003383_378_926 | 177 |
| 395 | 3300042126 | Ga0450888_001013 | Ga0450888_001013_1264_1812 | 177 |
| 396 | 3300042127 | Ga0450890_000737 | Ga0450890_000737_1605_2153 | 177 |
| 397 | 3300042127 | Ga0450890_016996 | Ga0450890_016996_312_860 | 177 |
| 398 | 3300042129 | Ga0450891_000527 | Ga0450891_000527_1390_1938 | 177 |
| 399 | 3300042130 | Ga0450892_001234 | Ga0450892_001234_439_987 | 177 |
| 400 | 3300042137 | Ga0450902_002503 | Ga0450902_002503_729_1277 | 177 |
| 401 | 3300042138 | Ga0450903_007340 | Ga0450903_007340_446_994 | 177 |
| 402 | 3300042144 | Ga0450889_000335 | Ga0450889_000335_3371_3919 | 177 |
| 403 | 3300045051 | Ga0451576_0041466 | Ga0451576_0041466_3818_4363 | 177 |
| 404 | 3300046452 | Ga0495617_028456 | Ga0495617_028456_372_905 | 177 |
| 405 | 3300046457 | Ga0495590_0063523 | Ga0495590_0063523_192_725 | 177 |
| 406 | 3300046458 | Ga0495591_007342 | Ga0495591_007342_2502_3035 | 177 |
| 407 | 3300046474 | Ga0495605_0161223 | Ga0495605_0161223_133_666 | 177 |
| 408 | 3300046491 | Ga0495584_0011483 | Ga0495584_0011483_1519_2052 | 177 |
| 409 | 3300046492 | Ga0495585_0157347 | Ga0495585_0157347_455_988 | 177 |
| 410 | 3300046500 | Ga0495596_0013038 | Ga0495596_0013038_1058_1591 | 177 |
| 411 | 3300046501 | Ga0495607_0014048 | Ga0495607_0014048_1075_1608 | 177 |
| 412 | 3300046518 | Ga0495631_0069679 | Ga0495631_0069679_361_894 | 177 |
| 413 | 3300046519 | Ga0495632_0182342 | Ga0495632_0182342_171_704 | 177 |
| 414 | 3300046520 | Ga0495637_0000027 | Ga0495637_0000027_117442_117975 | 177 |
| 415 | 3300046524 | Ga0495648_0018920 | Ga0495648_0018920_1783_2316 | 177 |
| 416 | 3300046528 | Ga0495642_0025588 | Ga0495642_0025588_819_1352 | 177 |
| 417 | 3300046530 | Ga0495654_0033670 | Ga0495654_0033670_944_1477 | 177 |
| 418 | 3300046616 | Ga0495668_0111330 | Ga0495668_0111330_167_700 | 177 |
| 419 | 3300046648 | Ga0495611_0000387 | Ga0495611_0000387_25434_25967 | 177 |
| 420 | 3300046648 | Ga0495611_0085217 | Ga0495611_0085217_185_718 | 177 |
| 421 | 3300046660 | Ga0495625_0109410 | Ga0495625_0109410_1284_1817 | 177 |
| 422 | 3300046665 | Ga0495661_0000119 | Ga0495661_0000119_10286_10819 | 177 |
| 423 | 3300046692 | Ga0495671_0351677 | Ga0495671_0351677_23_556 | 177 |
| 424 | 3300046694 | Ga0495649_0033682 | Ga0495649_0033682_1539_2072 | 177 |
| 425 | 3300046810 | Ga0495660_0009019 | Ga0495660_0009019_1925_2458 | 177 |
| 426 | 3300047318 | Ga0495636_0206736 | Ga0495636_0206736_207_740 | 177 |
| 427 | 3300047323 | Ga0495683_0067765 | Ga0495683_0067765_447_980 | 177 |
| 428 | 3300047443 | Ga0495687_067083 | Ga0495687_067083_259_792 | 177 |
| 429 | 3300047446 | Ga0495679_003634 | Ga0495679_003634_4443_4976 | 177 |
| 430 | 3300047469 | Ga0495673_0015333 | Ga0495673_0015333_208_741 | 177 |
| 431 | 3300047470 | Ga0495681_0018390 | Ga0495681_0018390_2876_3409 | 177 |
| 432 | 3300047472 | Ga0495686_0017940 | Ga0495686_0017940_3160_3693 | 177 |
| 433 | 3300048091 | Ga0495626_0024170 | Ga0495626_0024170_2061_2594 | 177 |
| 434 | 3300048927 | Ga0496124_0001949 | Ga0496124_0001949_12743_13276 | 177 |
| 435 | 3300049129 | Ga0501309_000375 | Ga0501309_000375_460_1008 | 177 |
| 436 | 3300049130 | Ga0501310_000289 | Ga0501310_000289_2709_3257 | 177 |
| 437 | 3300049459 | Ga0495678_003717 | Ga0495678_003717_6225_6758 | 177 |
| 438 | 3300049519 | Ga0501296_015210 | Ga0501296_015210_18_566 | 177 |
| 439 | 3300049589 | Ga0501073_0258670 | Ga0501073_0258670_222_764 | 177 |
| 440 | 3300049662 | Ga0501222_002799 | Ga0501222_002799_754_1302 | 177 |
| 441 | 3300049669 | Ga0501235_006024 | Ga0501235_006024_966_1514 | 177 |
| 442 | 3300049706 | Ga0501229_001801 | Ga0501229_001801_1630_2178 | 177 |
| 443 | 3300049762 | Ga0501265_007658 | Ga0501265_007658_129_662 | 177 |
| 444 | 3300049769 | Ga0501272_013324 | Ga0501272_013324_16_564 | 177 |
| 445 | 3300050489 | nmdc:mga03683_119957_c1 | nmdc:mga03683_119957_c1_533_1066 | 177 |
| 446 | 3300050489 | nmdc:mga03683_19275_c1 | nmdc:mga03683_19275_c1_1148_1681 | 177 |
| 447 | 3300050490 | nmdc:mga03n38_346253_c1 | nmdc:mga03n38_346253_c1_114_650 | 177 |
| 448 | 3300050490 | nmdc:mga03n38_7556_c1 | nmdc:mga03n38_7556_c1_1818_2351 | 177 |
| 449 | 3300050490 | nmdc:mga03n38_82306_c1 | nmdc:mga03n38_82306_c1_947_1483 | 177 |
| 450 | 3300050491 | nmdc:mga00v17_28164_c1 | nmdc:mga00v17_28164_c1_786_1322 | 177 |
| 451 | 3300050492 | nmdc:mga0yw44_13938_c1 | nmdc:mga0yw44_13938_c1_2481_3014 | 177 |
| 452 | 3300050493 | nmdc:mga0k408_1103_c1 | nmdc:mga0k408_1103_c1_9289_9822 | 177 |
| 453 | 3300050493 | nmdc:mga0k408_192315_c1 | nmdc:mga0k408_192315_c1_472_1008 | 177 |
| 454 | 3300050493 | nmdc:mga0k408_203424_c1 | nmdc:mga0k408_203424_c1_152_685 | 177 |
| 455 | 3300050493 | nmdc:mga0k408_250777_c1 | nmdc:mga0k408_250777_c1_253_792 | 177 |
| 456 | 3300050493 | nmdc:mga0k408_416660_c1 | nmdc:mga0k408_416660_c1_73_609 | 177 |
| 457 | 3300050493 | nmdc:mga0k408_5513_c1 | nmdc:mga0k408_5513_c1_4292_4828 | 177 |
| 458 | 3300050494 | nmdc:mga06z11_123202_c1 | nmdc:mga06z11_123202_c1_816_1352 | 177 |
| 459 | 3300050494 | nmdc:mga06z11_862_c1 | nmdc:mga06z11_862_c1_1867_2400 | 177 |
| 460 | 3300050495 | nmdc:mga04h51_3500_c1 | nmdc:mga04h51_3500_c1_614_1150 | 177 |
| 461 | 3300050495 | nmdc:mga04h51_9485_c1 | nmdc:mga04h51_9485_c1_2035_2568 | 177 |
| 462 | 3300050496 | nmdc:mga07m45_17593_c1 | nmdc:mga07m45_17593_c1_144_677 | 177 |
| 463 | 3300050496 | nmdc:mga07m45_25358_c1 | nmdc:mga07m45_25358_c1_1759_2292 | 177 |
| 464 | 3300050496 | nmdc:mga07m45_3671_c1 | nmdc:mga07m45_3671_c1_4655_5200 | 177 |
| 465 | 3300050496 | nmdc:mga07m45_42_c1 | nmdc:mga07m45_42_c1_22044_22580 | 177 |
| 466 | 3300050496 | nmdc:mga07m45_6482_c1 | nmdc:mga07m45_6482_c1_4597_5133 | 177 |
| 467 | 3300050496 | nmdc:mga07m45_74121_c1 | nmdc:mga07m45_74121_c1_724_1260 | 177 |
| 468 | 3300050496 | nmdc:mga07m45_74737_c1 | nmdc:mga07m45_74737_c1_963_1499 | 177 |
| 469 | 3300050496 | nmdc:mga07m45_9426_c1 | nmdc:mga07m45_9426_c1_4069_4605 | 177 |
| 470 | 3300050516 | nmdc:mga0sz30_8809_c1 | nmdc:mga0sz30_8809_c1_1938_2471 | 177 |
| 471 | 3300053092 | Ga0500583_0314632 | Ga0500583_0314632_202_735 | 177 |
| 472 | 3300053134 | Ga0500658_0005271 | Ga0500658_0005271_689_1222 | 177 |
| 473 | 3300003578 | Ga0006562J51391_1182578 | Ga0006562J51391_11825782 | 178 |
| 474 | 3300003578 | Ga0006562J51391_1182579 | Ga0006562J51391_11825793 | 178 |
| 475 | 3300006177 | Ga0075362_10133552 | Ga0075362_101335522 | 178 |
| 476 | 3300013104 | Ga0157370_10022640 | Ga0157370_100226403 | 178 |
| 477 | 3300014326 | Ga0157380_10334123 | Ga0157380_103341232 | 178 |
| 478 | 3300028794 | Ga0307515_10000020 | Ga0307515_1000002011 | 178 |
| 479 | 3300028794 | Ga0307515_10000525 | Ga0307515_1000052546 | 178 |
| 480 | 3300028794 | Ga0307515_10001484 | Ga0307515_1000148459 | 178 |
| 481 | 3300031730 | Ga0307516_10000359 | Ga0307516_1000035922 | 178 |
| 482 | 3300032002 | Ga0307416_100222125 | Ga0307416_1002221253 | 178 |
| 483 | 3300035170 | Ga0373943_0105569 | Ga0373943_0105569_631_1167 | 178 |
| 484 | 3300035695 | Ga0373927_0059536 | Ga0373927_0059536_822_1358 | 178 |
| 485 | 3300035725 | Ga0373947_0186530 | Ga0373947_0186530_596_1132 | 178 |
| 486 | 3300037068 | Ga0373925_0201079 | Ga0373925_0201079_836_1372 | 178 |
| 487 | 3300037312 | Ga0395899_0489779 | Ga0395899_0489779_73_609 | 178 |
| 488 | 3300037471 | Ga0395905_0024849 | Ga0395905_0024849_3421_3966 | 178 |
| 489 | 3300041410 | Ga0439461_0075895 | Ga0439461_0075895_221_757 | 178 |
| 490 | 3300041413 | Ga0439465_0048728 | Ga0439465_0048728_162_701 | 178 |
| 491 | 3300041997 | Ga0439431_0002967 | Ga0439431_0002967_2524_3063 | 178 |
| 492 | 3300042126 | Ga0450888_005684 | Ga0450888_005684_635_1174 | 178 |
| 493 | 3300042134 | Ga0450898_036966 | Ga0450898_036966_221_760 | 178 |
| 494 | 3300042135 | Ga0450899_008846 | Ga0450899_008846_489_1061 | 178 |
| 495 | 3300042156 | Ga0439446_0168573 | Ga0439446_0168573_70_609 | 178 |
| 496 | 3300042435 | Ga0439434_0120828 | Ga0439434_0120828_83_622 | 178 |
| 497 | 3300042876 | Ga0451577_0004100 | Ga0451577_0004100_11590_12135 | 178 |
| 498 | 3300044656 | Ga0466969_0017146 | Ga0466969_0017146_1433_1969 | 178 |
| 499 | 3300044683 | Ga0466965_0052368 | Ga0466965_0052368_665_1201 | 178 |
| 500 | 3300044684 | Ga0466966_0014227 | Ga0466966_0014227_1391_1927 | 178 |
| 501 | 3300044693 | Ga0466961_0053983 | Ga0466961_0053983_1152_1688 | 178 |
| 502 | 3300044694 | Ga0466963_0422087 | Ga0466963_0422087_18_554 | 178 |
| 503 | 3300044706 | Ga0466964_0007328 | Ga0466964_0007328_1604_2140 | 178 |
| 504 | 3300044712 | Ga0453684_0042087 | Ga0453684_0042087_1644_2216 | 178 |
| 505 | 3300044712 | Ga0453684_1724022 | Ga0453684_1724022_67_612 | 178 |
| 506 | 3300044719 | Ga0466971_0104848 | Ga0466971_0104848_748_1284 | 178 |
| 507 | 3300044765 | Ga0466970_0019609 | Ga0466970_0019609_1683_2219 | 178 |
| 508 | 3300044842 | Ga0466957_0154003 | Ga0466957_0154003_118_654 | 178 |
| 509 | 3300045049 | Ga0466959_0005794 | Ga0466959_0005794_4428_4964 | 178 |
| 510 | 3300045051 | Ga0451576_0316796 | Ga0451576_0316796_557_1129 | 178 |
| 511 | 3300045836 | Ga0466958_0073357 | Ga0466958_0073357_1391_1927 | 178 |
| 512 | 3300045836 | Ga0466958_0188840 | Ga0466958_0188840_263_799 | 178 |
| 513 | 3300045976 | Ga0466967_0057621 | Ga0466967_0057621_2877_3413 | 178 |
| 514 | 3300045976 | Ga0466967_0997075 | Ga0466967_0997075_94_642 | 178 |
| 515 | 3300046683 | Ga0495658_0275941 | Ga0495658_0275941_295_831 | 178 |
| 516 | 3300048905 | Ga0496102_0005822 | Ga0496102_0005822_3324_3860 | 178 |
| 517 | 3300048916 | Ga0496113_0169424 | Ga0496113_0169424_711_1256 | 178 |
| 518 | 3300053139 | Ga0500568_0087511 | Ga0500568_0087511_535_1107 | 178 |
| 519 | 3300053158 | Ga0500627_0012493 | Ga0500627_0012493_273_818 | 178 |
| 520 | 3300060353 | Ga0501082_0210377 | Ga0501082_0210377_363_914 | 178 |
| 521 | 3300061719 | Ga0466962_0044851 | Ga0466962_0044851_616_1152 | 178 |
| 522 | 3300003316 | rootH1_10015589 | rootH1_100155892 | 179 |
| 523 | 3300047469 | Ga0495673_0000619 | Ga0495673_0000619_29675_30274 | 179 |
| 524 | 3300003215 | JGI25153J46596_10007026 | JGI25153J46596_100070268 | 180 |
| 525 | 3300003323 | rootH1_10070345 | rootH1_100703452 | 180 |
| 526 | 3300003771 | Ga0055526_1006007 | Ga0055526_10060074 | 180 |
| 527 | 3300003791 | Ga0055530_10007731 | Ga0055530_100077314 | 180 |
| 528 | 3300005262 | Ga0065165_1003633 | Ga0065165_10036338 | 180 |
| 529 | 3300005328 | Ga0070676_10005424 | Ga0070676_100054248 | 180 |
| 530 | 3300005331 | Ga0070670_100203912 | Ga0070670_1002039123 | 180 |
| 531 | 3300005331 | Ga0070670_100310154 | Ga0070670_1003101543 | 180 |
| 532 | 3300005334 | Ga0068869_100072168 | Ga0068869_1000721684 | 180 |
| 533 | 3300005338 | Ga0068868_100015848 | Ga0068868_1000158485 | 180 |
| 534 | 3300005338 | Ga0068868_100020753 | Ga0068868_1000207536 | 180 |
| 535 | 3300005338 | Ga0068868_100248955 | Ga0068868_1002489552 | 180 |
| 536 | 3300005354 | Ga0070675_100052953 | Ga0070675_1000529534 | 180 |
| 537 | 3300005355 | Ga0070671_100138375 | Ga0070671_1001383753 | 180 |
| 538 | 3300005364 | Ga0070673_100005315 | Ga0070673_1000053158 | 180 |
| 539 | 3300005365 | Ga0070688_100234632 | Ga0070688_1002346322 | 180 |
| 540 | 3300005367 | Ga0070667_101175278 | Ga0070667_1011752782 | 180 |
| 541 | 3300005456 | Ga0070678_100034651 | Ga0070678_1000346512 | 180 |
| 542 | 3300005459 | Ga0068867_100007828 | Ga0068867_1000078287 | 180 |
| 543 | 3300005543 | Ga0070672_100086170 | Ga0070672_1000861704 | 180 |
| 544 | 3300005548 | Ga0070665_100063002 | Ga0070665_1000630024 | 180 |
| 545 | 3300005578 | Ga0068854_100029855 | Ga0068854_1000298553 | 180 |
| 546 | 3300005618 | Ga0068864_100048657 | Ga0068864_1000486572 | 180 |
| 547 | 3300005834 | Ga0068851_10189295 | Ga0068851_101892951 | 180 |
| 548 | 3300005840 | Ga0068870_10039677 | Ga0068870_100396772 | 180 |
| 549 | 3300006042 | Ga0075368_10041721 | Ga0075368_100417213 | 180 |
| 550 | 3300006048 | Ga0075363_100075353 | Ga0075363_1000753532 | 180 |
| 551 | 3300006195 | Ga0075366_10129758 | Ga0075366_101297583 | 180 |
| 552 | 3300006195 | Ga0075366_10225733 | Ga0075366_102257332 | 180 |
| 553 | 3300006237 | Ga0097621_100195851 | Ga0097621_1001958513 | 180 |
| 554 | 3300006237 | Ga0097621_100334608 | Ga0097621_1003346083 | 180 |
| 555 | 3300006353 | Ga0075370_10004004 | Ga0075370_100040044 | 180 |
| 556 | 3300006353 | Ga0075370_10188157 | Ga0075370_101881572 | 180 |
| 557 | 3300009093 | Ga0105240_10037356 | Ga0105240_100373567 | 180 |
| 558 | 3300009098 | Ga0105245_10052074 | Ga0105245_100520743 | 180 |
| 559 | 3300009098 | Ga0105245_10053820 | Ga0105245_100538203 | 180 |
| 560 | 3300009101 | Ga0105247_10556682 | Ga0105247_105566822 | 180 |
| 561 | 3300009545 | Ga0105237_10001352 | Ga0105237_1000135226 | 180 |
| 562 | 3300009551 | Ga0105238_10269669 | Ga0105238_102696693 | 180 |
| 563 | 3300010375 | Ga0105239_10003766 | Ga0105239_100037668 | 180 |
| 564 | 3300011119 | Ga0105246_10691283 | Ga0105246_106912832 | 180 |
| 565 | 3300013296 | Ga0157374_10285055 | Ga0157374_102850553 | 180 |
| 566 | 3300013306 | Ga0163162_11561259 | Ga0163162_115612591 | 180 |
| 567 | 3300014968 | Ga0157379_10085784 | Ga0157379_100857844 | 180 |
| 568 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027216 | 180 |
| 569 | 3300025263 | Ga0209565_1015028 | Ga0209565_10150284 | 180 |
| 570 | 3300025273 | Ga0209673_1004671 | Ga0209673_10046713 | 180 |
| 571 | 3300025273 | Ga0209673_1008939 | Ga0209673_10089394 | 180 |
| 572 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014565 | 180 |
| 573 | 3300025297 | Ga0209758_1000193 | Ga0209758_10001932 | 180 |
| 574 | 3300025297 | Ga0209758_1000208 | Ga0209758_1000208120 | 180 |
| 575 | 3300025298 | Ga0209050_1000198 | Ga0209050_1000198105 | 180 |
| 576 | 3300025299 | Ga0209256_1040921 | Ga0209256_10409213 | 180 |
| 577 | 3300025303 | Ga0209051_1013755 | Ga0209051_10137553 | 180 |
| 578 | 3300025304 | Ga0209257_1035421 | Ga0209257_10354213 | 180 |
| 579 | 3300025321 | Ga0207656_10118317 | Ga0207656_101183172 | 180 |
| 580 | 3300025907 | Ga0207645_10006118 | Ga0207645_100061188 | 180 |
| 581 | 3300025908 | Ga0207643_10060987 | Ga0207643_100609873 | 180 |
| 582 | 3300025913 | Ga0207695_10970046 | Ga0207695_109700462 | 180 |
| 583 | 3300025914 | Ga0207671_10009654 | Ga0207671_100096543 | 180 |
| 584 | 3300025924 | Ga0207694_10312576 | Ga0207694_103125762 | 180 |
| 585 | 3300025925 | Ga0207650_10167315 | Ga0207650_101673152 | 180 |
| 586 | 3300025926 | Ga0207659_10041200 | Ga0207659_100412004 | 180 |
| 587 | 3300025927 | Ga0207687_10024955 | Ga0207687_100249552 | 180 |
| 588 | 3300025927 | Ga0207687_10164178 | Ga0207687_101641783 | 180 |
| 589 | 3300025927 | Ga0207687_10608446 | Ga0207687_106084462 | 180 |
| 590 | 3300025931 | Ga0207644_10132144 | Ga0207644_101321443 | 180 |
| 591 | 3300025931 | Ga0207644_10132941 | Ga0207644_101329413 | 180 |
| 592 | 3300025940 | Ga0207691_10060049 | Ga0207691_100600495 | 180 |
| 593 | 3300025942 | Ga0207689_10015180 | Ga0207689_100151801 | 180 |
| 594 | 3300025960 | Ga0207651_10042268 | Ga0207651_100422682 | 180 |
| 595 | 3300025986 | Ga0207658_10002236 | Ga0207658_1000223616 | 180 |
| 596 | 3300026023 | Ga0207677_10020077 | Ga0207677_100200774 | 180 |
| 597 | 3300026023 | Ga0207677_10051400 | Ga0207677_100514004 | 180 |
| 598 | 3300026088 | Ga0207641_10423148 | Ga0207641_104231481 | 180 |
| 599 | 3300026089 | Ga0207648_10010374 | Ga0207648_100103745 | 180 |
| 600 | 3300026089 | Ga0207648_10091482 | Ga0207648_100914823 | 180 |
| 601 | 3300026095 | Ga0207676_10913847 | Ga0207676_109138472 | 180 |
| 602 | 3300026121 | Ga0207683_10053290 | Ga0207683_100532907 | 180 |
| 603 | 3300028379 | Ga0268266_10004915 | Ga0268266_1000491515 | 180 |
| 604 | 3300028379 | Ga0268266_10425655 | Ga0268266_104256552 | 180 |
| 605 | 3300028379 | Ga0268266_10629787 | Ga0268266_106297872 | 180 |
| 606 | 3300028794 | Ga0307515_10139043 | Ga0307515_101390434 | 180 |
| 607 | 3300030522 | Ga0307512_10078927 | Ga0307512_100789273 | 180 |
| 608 | 3300031456 | Ga0307513_10145072 | Ga0307513_101450724 | 180 |
| 609 | 3300031507 | Ga0307509_10000181 | Ga0307509_1000018169 | 180 |
| 610 | 3300031507 | Ga0307509_10007667 | Ga0307509_1000766711 | 180 |
| 611 | 3300031507 | Ga0307509_10030721 | Ga0307509_100307217 | 180 |
| 612 | 3300031507 | Ga0307509_10034467 | Ga0307509_100344678 | 180 |
| 613 | 3300031507 | Ga0307509_10059624 | Ga0307509_100596243 | 180 |
| 614 | 3300031507 | Ga0307509_10127494 | Ga0307509_101274943 | 180 |
| 615 | 3300031507 | Ga0307509_10623570 | Ga0307509_106235702 | 180 |
| 616 | 3300031548 | Ga0307408_101041864 | Ga0307408_1010418641 | 180 |
| 617 | 3300031548 | Ga0307408_101543763 | Ga0307408_1015437631 | 180 |
| 618 | 3300031616 | Ga0307508_10000738 | Ga0307508_1000073834 | 180 |
| 619 | 3300031616 | Ga0307508_10051814 | Ga0307508_100518143 | 180 |
| 620 | 3300031649 | Ga0307514_10000395 | Ga0307514_1000039541 | 180 |
| 621 | 3300031730 | Ga0307516_10000360 | Ga0307516_1000036053 | 180 |
| 622 | 3300031730 | Ga0307516_10473758 | Ga0307516_104737582 | 180 |
| 623 | 3300031838 | Ga0307518_10479676 | Ga0307518_104796761 | 180 |
| 624 | 3300031852 | Ga0307410_10202966 | Ga0307410_102029663 | 180 |
| 625 | 3300032002 | Ga0307416_100162336 | Ga0307416_1001623362 | 180 |
| 626 | 3300032002 | Ga0307416_100406162 | Ga0307416_1004061622 | 180 |
| 627 | 3300033179 | Ga0307507_10033844 | Ga0307507_100338443 | 180 |
| 628 | 3300033180 | Ga0307510_10006134 | Ga0307510_1000613410 | 180 |
| 629 | 3300033180 | Ga0307510_10032780 | Ga0307510_100327809 | 180 |
| 630 | 3300033180 | Ga0307510_10229391 | Ga0307510_102293911 | 180 |
| 631 | 3300033180 | Ga0307510_10372770 | Ga0307510_103727701 | 180 |
| 632 | 3300035084 | Ga0373928_0013749 | Ga0373928_0013749_42_584 | 180 |
| 633 | 3300035088 | Ga0373940_0074835 | Ga0373940_0074835_177_719 | 180 |
| 634 | 3300035112 | Ga0373932_0079085 | Ga0373932_0079085_308_850 | 180 |
| 635 | 3300035171 | Ga0373946_0292972 | Ga0373946_0292972_167_709 | 180 |
| 636 | 3300035691 | Ga0373931_0069406 | Ga0373931_0069406_872_1414 | 180 |
| 637 | 3300037068 | Ga0373925_0350666 | Ga0373925_0350666_371_913 | 180 |
| 638 | 3300041443 | Ga0451789_0961199 | Ga0451789_0961199_1949_2491 | 180 |
| 639 | 3300041452 | Ga0451793_1185119 | Ga0451793_1185119_746_1288 | 180 |
| 640 | 3300041459 | Ga0451800_0946979 | Ga0451800_0946979_283_825 | 180 |
| 641 | 3300041460 | Ga0451802_1454478 | Ga0451802_1454478_952_1494 | 180 |
| 642 | 3300041496 | Ga0451839_0267159 | Ga0451839_0267159_64_609 | 180 |
| 643 | 3300041496 | Ga0451839_0314440 | Ga0451839_0314440_156_698 | 180 |
| 644 | 3300041505 | Ga0451849_0782838 | Ga0451849_0782838_165_710 | 180 |
| 645 | 3300041509 | Ga0451843_1276605 | Ga0451843_1276605_12_554 | 180 |
| 646 | 3300041512 | Ga0451853_3167327 | Ga0451853_3167327_1681_2223 | 180 |
| 647 | 3300042156 | Ga0439446_0179155 | Ga0439446_0179155_40_582 | 180 |
| 648 | 3300042876 | Ga0451577_0811344 | Ga0451577_0811344_64_606 | 180 |
| 649 | 3300044656 | Ga0466969_0026791 | Ga0466969_0026791_406_975 | 180 |
| 650 | 3300044658 | Ga0466972_0115940 | Ga0466972_0115940_220_789 | 180 |
| 651 | 3300044683 | Ga0466965_0020695 | Ga0466965_0020695_1664_2233 | 180 |
| 652 | 3300044684 | Ga0466966_0001617 | Ga0466966_0001617_7959_8528 | 180 |
| 653 | 3300044693 | Ga0466961_0004564 | Ga0466961_0004564_4842_5411 | 180 |
| 654 | 3300044694 | Ga0466963_0006052 | Ga0466963_0006052_3044_3613 | 180 |
| 655 | 3300044706 | Ga0466964_0003715 | Ga0466964_0003715_3311_3880 | 180 |
| 656 | 3300044712 | Ga0453684_0008512 | Ga0453684_0008512_4942_5484 | 180 |
| 657 | 3300044712 | Ga0453684_0028231 | Ga0453684_0028231_2064_2606 | 180 |
| 658 | 3300044719 | Ga0466971_0004691 | Ga0466971_0004691_3289_3858 | 180 |
| 659 | 3300044842 | Ga0466957_0002193 | Ga0466957_0002193_1669_2238 | 180 |
| 660 | 3300045049 | Ga0466959_0001105 | Ga0466959_0001105_4713_5282 | 180 |
| 661 | 3300045051 | Ga0451576_0004811 | Ga0451576_0004811_13795_14337 | 180 |
| 662 | 3300045976 | Ga0466967_0035175 | Ga0466967_0035175_2050_2619 | 180 |
| 663 | 3300046454 | Ga0495592_0000234 | Ga0495592_0000234_17331_17873 | 180 |
| 664 | 3300046460 | Ga0495638_0024870 | Ga0495638_0024870_1772_2314 | 180 |
| 665 | 3300046460 | Ga0495638_0228235 | Ga0495638_0228235_54_596 | 180 |
| 666 | 3300046517 | Ga0495630_0049651 | Ga0495630_0049651_525_1067 | 180 |
| 667 | 3300046519 | Ga0495632_0002230 | Ga0495632_0002230_13216_13758 | 180 |
| 668 | 3300046519 | Ga0495632_0145766 | Ga0495632_0145766_540_1082 | 180 |
| 669 | 3300046524 | Ga0495648_0121022 | Ga0495648_0121022_444_986 | 180 |
| 670 | 3300046616 | Ga0495668_0066838 | Ga0495668_0066838_291_833 | 180 |
| 671 | 3300046616 | Ga0495668_0168760 | Ga0495668_0168760_47_589 | 180 |
| 672 | 3300046660 | Ga0495625_0167567 | Ga0495625_0167567_273_815 | 180 |
| 673 | 3300046660 | Ga0495625_0267362 | Ga0495625_0267362_218_760 | 180 |
| 674 | 3300046680 | Ga0495646_0302222 | Ga0495646_0302222_257_799 | 180 |
| 675 | 3300046690 | Ga0495624_0422115 | Ga0495624_0422115_134_676 | 180 |
| 676 | 3300046692 | Ga0495671_0443020 | Ga0495671_0443020_49_591 | 180 |
| 677 | 3300047469 | Ga0495673_0104030 | Ga0495673_0104030_304_846 | 180 |
| 678 | 3300047470 | Ga0495681_0020867 | Ga0495681_0020867_2077_2637 | 180 |
| 679 | 3300047673 | Ga0495593_0045829 | Ga0495593_0045829_879_1421 | 180 |
| 680 | 3300048909 | Ga0496106_0164194 | Ga0496106_0164194_359_901 | 180 |
| 681 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_30776_31318 | 180 |
| 682 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_97362_97904 | 180 |
| 683 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_89969_90511 | 180 |
| 684 | 3300049582 | Ga0501048_0004056 | Ga0501048_0004056_490_1032 | 180 |
| 685 | 3300049744 | Ga0501083_0234072 | Ga0501083_0234072_139_681 | 180 |
| 686 | 3300049824 | Ga0501045_0064557 | Ga0501045_0064557_1368_1910 | 180 |
| 687 | 3300050493 | nmdc:mga0k408_117393_c1 | nmdc:mga0k408_117393_c1_944_1486 | 180 |
| 688 | 3300050496 | nmdc:mga07m45_349666_c1 | nmdc:mga07m45_349666_c1_284_826 | 180 |
| 689 | 3300050496 | nmdc:mga07m45_678_c2 | nmdc:mga07m45_678_c2_9699_10241 | 180 |
| 690 | 3300053086 | Ga0500578_0001649 | Ga0500578_0001649_4469_5011 | 180 |
| 691 | 3300053086 | Ga0500578_0031796 | Ga0500578_0031796_2405_2947 | 180 |
| 692 | 3300053090 | Ga0500646_0035588 | Ga0500646_0035588_784_1326 | 180 |
| 693 | 3300053092 | Ga0500583_0076367 | Ga0500583_0076367_320_862 | 180 |
| 694 | 3300053093 | Ga0500651_0030527 | Ga0500651_0030527_101_643 | 180 |
| 695 | 3300053093 | Ga0500651_0074794 | Ga0500651_0074794_1530_2072 | 180 |
| 696 | 3300053098 | Ga0500650_0065133 | Ga0500650_0065133_569_1111 | 180 |
| 697 | 3300053098 | Ga0500650_0227918 | Ga0500650_0227918_206_748 | 180 |
| 698 | 3300053117 | Ga0500593_122548 | Ga0500593_122548_134_676 | 180 |
| 699 | 3300053130 | Ga0500642_0024727 | Ga0500642_0024727_1249_1791 | 180 |
| 700 | 3300053131 | Ga0500652_000263 | Ga0500652_000263_15257_15799 | 180 |
| 701 | 3300053131 | Ga0500652_026551 | Ga0500652_026551_615_1157 | 180 |
| 702 | 3300053133 | Ga0500655_025944 | Ga0500655_025944_246_788 | 180 |
| 703 | 3300053137 | Ga0500561_0040562 | Ga0500561_0040562_443_985 | 180 |
| 704 | 3300053139 | Ga0500568_0144076 | Ga0500568_0144076_249_791 | 180 |
| 705 | 3300053142 | Ga0500577_0155974 | Ga0500577_0155974_234_776 | 180 |
| 706 | 3300053154 | Ga0500619_031869 | Ga0500619_031869_450_992 | 180 |
| 707 | 3300053156 | Ga0500622_0001292 | Ga0500622_0001292_10239_10781 | 180 |
| 708 | 3300053177 | Ga0500636_0176962 | Ga0500636_0176962_36_578 | 180 |
| 709 | 3300053724 | Ga0500570_119664 | Ga0500570_119664_484_1026 | 180 |
| 710 | 3300053730 | Ga0500645_062633 | Ga0500645_062633_430_972 | 180 |
| 711 | 3300060353 | Ga0501082_0605194 | Ga0501082_0605194_62_604 | 180 |
| 712 | 3300061719 | Ga0466962_0005417 | Ga0466962_0005417_2774_3343 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dwn-assembly2.cif.gz_C | crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = | 0.9919 | 5 | 179 |
| 1yr0-assembly2.cif.gz_D | crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens | 0.982 | 5 | 168 |
| 4j3g-assembly2.cif.gz_C | crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis | 0.978 | 7 | 168 |
| 4mbu-assembly1.cif.gz_A | crystal structure of n-acetyltransferase from staphylococcus aureus mu50 | 0.9767 | 4 | 169 |
| 1yr0-assembly2.cif.gz_D | crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens | 0.9761 | 5 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dwmA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9908 | 5 | 179 | 3.40.630.30 |
| 4mbuB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.98 | 7 | 169 | 3.40.630.30 |
| 4mbuB00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9741 | 7 | 169 | 3.40.630.30 |
| 6m7gE00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9677 | 5 | 169 | 3.40.630.30 |
| 3dr6B00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9569 | 7 | 178 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840SCR5-F1-model_v4 | Phosphinothricin acetyltransferase (EC 2.3.1.183) | 0.9991 | 7 | 177 |
GO:0016747
|
| AF-A0A2I7N9P4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9967 | 7 | 167 |
GO:0016747
|
| AF-A0A521LYP4-F1-model_v4 | N-acetyltransferase family protein | 0.9966 | 7 | 177 |
GO:0016747
|
| AF-A0A0D7KBM3-F1-model_v4 | GCN5 family acetyltransferase | 0.9964 | 5 | 177 |
GO:0016747
|
| AF-A0A370FGI5-F1-model_v4 | Phosphinothricin acetyltransferase | 0.996 | 5 | 177 |
GO:0016747
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar