F476658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 306 | 709 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300031728|Ga0316578_10049224|Ga0316578_100492241 |
| Length | 114 |
| Sequence | MPDCLFCKIASGEIPSEIVYQDDQVTVFNDIKPAAPVHLLVIPNIHIPSVAAMEESDIDLFGRLFLAARKAAQQAGIDESGYRLIVNNGPDAHQEVFHVHMHILGGGEMQHPMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 195 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 196 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 198 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 199 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 200 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 201 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 202 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 206 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 207 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 208 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 209 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 256 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 258 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 288 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 0.14 |
| Rhizosphere | 99.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10028696 | 3300003203 | Bacteria | 2117 |
| 2 | Ga0065704_10570846 | 3300005289 | Bacteria | 623 |
| 3 | Ga0065704_10596573 | 3300005289 | Bacteria | 585 |
| 4 | Ga0065707_10027591 | 3300005295 | Bacteria | 1200 |
| 5 | Ga0065707_10105333 | 3300005295 | Bacteria | 2650 |
| 6 | Ga0065707_10329623 | 3300005295 | Bacteria | 936 |
| 7 | Ga0070676_10413024 | 3300005328 | Bacteria | 941 |
| 8 | Ga0070690_100483358 | 3300005330 | Bacteria | 924 |
| 9 | Ga0070690_100926445 | 3300005330 | Bacteria | 683 |
| 10 | Ga0070677_10039988 | 3300005333 | Bacteria | 1843 |
| 11 | Ga0068869_100081685 | 3300005334 | Bacteria | 2414 |
| 12 | Ga0068869_100263038 | 3300005334 | Bacteria | 1381 |
| 13 | Ga0068869_101257403 | 3300005334 | Bacteria | 652 |
| 14 | Ga0070680_100073644 | 3300005336 | Bacteria | 2809 |
| 15 | Ga0070680_100076659 | 3300005336 | Bacteria | 2753 |
| 16 | Ga0070680_100258591 | 3300005336 | Bacteria | 1472 |
| 17 | Ga0070680_100381635 | 3300005336 | Bacteria | 1200 |
| 18 | Ga0070680_101728537 | 3300005336 | Bacteria | 542 |
| 19 | Ga0068868_100125085 | 3300005338 | Bacteria | 2100 |
| 20 | Ga0070689_100044499 | 3300005340 | Bacteria | 3415 |
| 21 | Ga0070689_100088254 | 3300005340 | Bacteria | 2440 |
| 22 | Ga0070689_102137562 | 3300005340 | Bacteria | 513 |
| 23 | Ga0070691_10201129 | 3300005341 | Bacteria | 1047 |
| 24 | Ga0070691_10209997 | 3300005341 | Bacteria | 1027 |
| 25 | Ga0070691_10491621 | 3300005341 | Bacteria | 708 |
| 26 | Ga0070687_101344454 | 3300005343 | Bacteria | 532 |
| 27 | Ga0070692_10005338 | 3300005345 | Bacteria | 5466 |
| 28 | Ga0070692_10047687 | 3300005345 | Bacteria | 2218 |
| 29 | Ga0070668_100250279 | 3300005347 | Bacteria | 1471 |
| 30 | Ga0070669_101472297 | 3300005353 | Bacteria | 591 |
| 31 | Ga0070671_101294070 | 3300005355 | Bacteria | 643 |
| 32 | Ga0070674_100153370 | 3300005356 | Bacteria | 1740 |
| 33 | Ga0070674_100199714 | 3300005356 | Bacteria | 1543 |
| 34 | Ga0070673_100221540 | 3300005364 | Bacteria | 1637 |
| 35 | Ga0070673_101633537 | 3300005364 | Bacteria | 609 |
| 36 | Ga0070673_101899831 | 3300005364 | Bacteria | 564 |
| 37 | Ga0070688_100123219 | 3300005365 | Bacteria | 1739 |
| 38 | Ga0070688_100763208 | 3300005365 | Bacteria | 754 |
| 39 | Ga0070714_100807380 | 3300005435 | Bacteria | 909 |
| 40 | Ga0070713_100507851 | 3300005436 | Bacteria | 1138 |
| 41 | Ga0070710_10151581 | 3300005437 | Bacteria | 1430 |
| 42 | Ga0070701_10290299 | 3300005438 | Bacteria | 1002 |
| 43 | Ga0070701_10322260 | 3300005438 | Bacteria | 956 |
| 44 | Ga0070701_11034061 | 3300005438 | Bacteria | 575 |
| 45 | Ga0070711_100495849 | 3300005439 | Bacteria | 1006 |
| 46 | Ga0070705_100005218 | 3300005440 | Bacteria | 6311 |
| 47 | Ga0070705_100010397 | 3300005440 | Bacteria | 4657 |
| 48 | Ga0070705_100011800 | 3300005440 | Bacteria | 4422 |
| 49 | Ga0070705_100041177 | 3300005440 | Bacteria | 2632 |
| 50 | Ga0070705_100097312 | 3300005440 | Bacteria | 1849 |
| 51 | Ga0070705_100293911 | 3300005440 | Bacteria | 1161 |
| 52 | Ga0070705_100601447 | 3300005440 | Bacteria | 851 |
| 53 | Ga0070705_100678336 | 3300005440 | Bacteria | 807 |
| 54 | Ga0070705_101483474 | 3300005440 | Bacteria | 568 |
| 55 | Ga0070705_101550414 | 3300005440 | Bacteria | 556 |
| 56 | Ga0070700_100002243 | 3300005441 | Bacteria | 9838 |
| 57 | Ga0070700_100037745 | 3300005441 | Bacteria | 2940 |
| 58 | Ga0070700_100062202 | 3300005441 | Bacteria | 2358 |
| 59 | Ga0070700_100103395 | 3300005441 | Bacteria | 1881 |
| 60 | Ga0070700_100114186 | 3300005441 | Bacteria | 1800 |
| 61 | Ga0070700_100242150 | 3300005441 | Bacteria | 1289 |
| 62 | Ga0070694_100005289 | 3300005444 | Bacteria | 7806 |
| 63 | Ga0070694_100071167 | 3300005444 | Bacteria | 2397 |
| 64 | Ga0070694_100088018 | 3300005444 | Bacteria | 2174 |
| 65 | Ga0070694_100097506 | 3300005444 | Bacteria | 2074 |
| 66 | Ga0070694_100205992 | 3300005444 | Bacteria | 1468 |
| 67 | Ga0070694_100234559 | 3300005444 | Bacteria | 1382 |
| 68 | Ga0070694_100379531 | 3300005444 | Bacteria | 1102 |
| 69 | Ga0070694_100468519 | 3300005444 | Bacteria | 997 |
| 70 | Ga0070708_101797927 | 3300005445 | Bacteria | 569 |
| 71 | Ga0070662_100781646 | 3300005457 | Bacteria | 811 |
| 72 | Ga0070681_10000081 | 3300005458 | Bacteria | 71809 |
| 73 | Ga0068867_100041138 | 3300005459 | Bacteria | 3377 |
| 74 | Ga0068867_100544744 | 3300005459 | Bacteria | 1004 |
| 75 | Ga0070706_100428612 | 3300005467 | Bacteria | 1231 |
| 76 | Ga0070706_100583187 | 3300005467 | Bacteria | 1039 |
| 77 | Ga0070707_100070257 | 3300005468 | Bacteria | 3373 |
| 78 | Ga0070707_100390916 | 3300005468 | Bacteria | 1351 |
| 79 | Ga0070698_100004625 | 3300005471 | Bacteria | 15121 |
| 80 | Ga0070698_100038692 | 3300005471 | Bacteria | 4913 |
| 81 | Ga0070698_100214960 | 3300005471 | Bacteria | 1857 |
| 82 | Ga0070699_100188068 | 3300005518 | Bacteria | 1834 |
| 83 | Ga0070699_100328149 | 3300005518 | Bacteria | 1376 |
| 84 | Ga0070699_100807023 | 3300005518 | Bacteria | 859 |
| 85 | Ga0070699_101200854 | 3300005518 | Bacteria | 696 |
| 86 | Ga0070699_101753470 | 3300005518 | Bacteria | 568 |
| 87 | Ga0070679_100087834 | 3300005530 | Bacteria | 3097 |
| 88 | Ga0070679_100961419 | 3300005530 | Bacteria | 798 |
| 89 | Ga0070679_101332505 | 3300005530 | Bacteria | 664 |
| 90 | Ga0070697_100620813 | 3300005536 | Bacteria | 951 |
| 91 | Ga0070672_100049380 | 3300005543 | Bacteria | 3273 |
| 92 | Ga0070686_100096793 | 3300005544 | Bacteria | 1985 |
| 93 | Ga0070686_100295425 | 3300005544 | Bacteria | 1200 |
| 94 | Ga0070686_100300817 | 3300005544 | Bacteria | 1190 |
| 95 | Ga0070695_100001505 | 3300005545 | Bacteria | 12926 |
| 96 | Ga0070695_100026646 | 3300005545 | Bacteria | 3578 |
| 97 | Ga0070695_100031307 | 3300005545 | Bacteria | 3317 |
| 98 | Ga0070695_100141072 | 3300005545 | Bacteria | 1671 |
| 99 | Ga0070695_100485606 | 3300005545 | Bacteria | 953 |
| 100 | Ga0070695_100687629 | 3300005545 | Bacteria | 811 |
| 101 | Ga0070695_101272979 | 3300005545 | Bacteria | 607 |
| 102 | Ga0070696_100029015 | 3300005546 | Bacteria | 3777 |
| 103 | Ga0070696_100075059 | 3300005546 | Bacteria | 2385 |
| 104 | Ga0070696_100160365 | 3300005546 | Bacteria | 1657 |
| 105 | Ga0070696_100206865 | 3300005546 | Bacteria | 1467 |
| 106 | Ga0070696_100241887 | 3300005546 | Bacteria | 1362 |
| 107 | Ga0070696_100338142 | 3300005546 | Bacteria | 1163 |
| 108 | Ga0070696_100368546 | 3300005546 | Bacteria | 1116 |
| 109 | Ga0070696_100438461 | 3300005546 | Bacteria | 1029 |
| 110 | Ga0070696_100442244 | 3300005546 | Bacteria | 1024 |
| 111 | Ga0070696_101255112 | 3300005546 | Bacteria | 628 |
| 112 | Ga0070696_101501741 | 3300005546 | Bacteria | 577 |
| 113 | Ga0070693_100051202 | 3300005547 | Bacteria | 2364 |
| 114 | Ga0070693_100187688 | 3300005547 | Bacteria | 1335 |
| 115 | Ga0070693_100265882 | 3300005547 | Bacteria | 1143 |
| 116 | Ga0070704_100069852 | 3300005549 | Bacteria | 2546 |
| 117 | Ga0070704_100129221 | 3300005549 | Bacteria | 1955 |
| 118 | Ga0070704_100203790 | 3300005549 | Bacteria | 1599 |
| 119 | Ga0070704_100266307 | 3300005549 | Bacteria | 1414 |
| 120 | Ga0070704_101091672 | 3300005549 | Bacteria | 724 |
| 121 | Ga0070704_101106416 | 3300005549 | Bacteria | 720 |
| 122 | Ga0068855_100777780 | 3300005563 | Bacteria | 1019 |
| 123 | Ga0068857_100325486 | 3300005577 | Bacteria | 1420 |
| 124 | Ga0068854_100084875 | 3300005578 | Bacteria | 2344 |
| 125 | Ga0068856_100188274 | 3300005614 | Bacteria | 2077 |
| 126 | Ga0068856_101800911 | 3300005614 | Bacteria | 624 |
| 127 | Ga0070702_100045349 | 3300005615 | Bacteria | 2487 |
| 128 | Ga0070702_100089935 | 3300005615 | Bacteria | 1859 |
| 129 | Ga0070702_100167399 | 3300005615 | Bacteria | 1426 |
| 130 | Ga0070702_100273543 | 3300005615 | Bacteria | 1156 |
| 131 | Ga0068859_100054594 | 3300005617 | Bacteria | 4019 |
| 132 | Ga0068859_100188149 | 3300005617 | Bacteria | 2149 |
| 133 | Ga0068859_100299024 | 3300005617 | Bacteria | 1703 |
| 134 | Ga0068859_100801290 | 3300005617 | Bacteria | 1030 |
| 135 | Ga0068859_100948811 | 3300005617 | Bacteria | 944 |
| 136 | Ga0068864_100182993 | 3300005618 | Bacteria | 1917 |
| 137 | Ga0068864_101585004 | 3300005618 | Bacteria | 659 |
| 138 | Ga0068866_10347163 | 3300005718 | Bacteria | 942 |
| 139 | Ga0068861_100508371 | 3300005719 | Bacteria | 1090 |
| 140 | Ga0068861_100681305 | 3300005719 | Bacteria | 953 |
| 141 | Ga0068870_10426963 | 3300005840 | Bacteria | 868 |
| 142 | Ga0068863_101503799 | 3300005841 | Bacteria | 682 |
| 143 | Ga0068858_100023814 | 3300005842 | Bacteria | 5705 |
| 144 | Ga0068858_101782523 | 3300005842 | Unclassified | 608 |
| 145 | Ga0068860_100109367 | 3300005843 | Bacteria | 2642 |
| 146 | Ga0068860_100952298 | 3300005843 | Bacteria | 876 |
| 147 | Ga0068862_100211533 | 3300005844 | Bacteria | 1752 |
| 148 | Ga0068862_100257889 | 3300005844 | Bacteria | 1591 |
| 149 | Ga0068862_100398441 | 3300005844 | Bacteria | 1287 |
| 150 | Ga0068862_101441351 | 3300005844 | Bacteria | 693 |
| 151 | Ga0081538_10108255 | 3300005981 | Bacteria | 1373 |
| 152 | Ga0081539_10004782 | 3300005985 | Bacteria | 14603 |
| 153 | Ga0070715_10135105 | 3300006163 | Bacteria | 1191 |
| 154 | Ga0070716_100433289 | 3300006173 | Bacteria | 954 |
| 155 | Ga0070716_100436828 | 3300006173 | Bacteria | 950 |
| 156 | Ga0070716_100589231 | 3300006173 | Bacteria | 835 |
| 157 | Ga0070712_101528012 | 3300006175 | Bacteria | 584 |
| 158 | Ga0097621_100523859 | 3300006237 | Bacteria | 1076 |
| 159 | Ga0097621_101152387 | 3300006237 | Bacteria | 729 |
| 160 | Ga0097621_101620359 | 3300006237 | Bacteria | 615 |
| 161 | Ga0075428_100013956 | 3300006844 | Bacteria | 8945 |
| 162 | Ga0075428_100033964 | 3300006844 | Bacteria | 5627 |
| 163 | Ga0075428_100249469 | 3300006844 | Bacteria | 1913 |
| 164 | Ga0075428_100273746 | 3300006844 | Bacteria | 1816 |
| 165 | Ga0075430_100006977 | 3300006846 | Bacteria | 9521 |
| 166 | Ga0075430_100044517 | 3300006846 | Bacteria | 3752 |
| 167 | Ga0075430_100051971 | 3300006846 | Bacteria | 3451 |
| 168 | Ga0075430_100094969 | 3300006846 | Bacteria | 2492 |
| 169 | Ga0075430_100337202 | 3300006846 | Bacteria | 1246 |
| 170 | Ga0075430_100364272 | 3300006846 | Bacteria | 1193 |
| 171 | Ga0075430_101322881 | 3300006846 | Bacteria | 593 |
| 172 | Ga0075431_100020329 | 3300006847 | Bacteria | 6782 |
| 173 | Ga0075431_100110864 | 3300006847 | Bacteria | 2832 |
| 174 | Ga0075431_100126308 | 3300006847 | Bacteria | 2639 |
| 175 | Ga0075433_10000480 | 3300006852 | Bacteria | 26041 |
| 176 | Ga0075433_10020641 | 3300006852 | Bacteria | 5513 |
| 177 | Ga0075433_10286274 | 3300006852 | Bacteria | 1460 |
| 178 | Ga0075433_10383488 | 3300006852 | Bacteria | 1241 |
| 179 | Ga0075433_10467997 | 3300006852 | Bacteria | 1110 |
| 180 | Ga0075433_10598315 | 3300006852 | Bacteria | 968 |
| 181 | Ga0075433_10697675 | 3300006852 | Bacteria | 889 |
| 182 | Ga0075433_11414364 | 3300006852 | Bacteria | 602 |
| 183 | Ga0075434_100000079 | 3300006871 | Bacteria | 52051 |
| 184 | Ga0075434_100001287 | 3300006871 | Bacteria | 20920 |
| 185 | Ga0075434_100020461 | 3300006871 | Bacteria | 6420 |
| 186 | Ga0075434_100126328 | 3300006871 | Bacteria | 2574 |
| 187 | Ga0075434_100784007 | 3300006871 | Bacteria | 970 |
| 188 | Ga0075434_100863928 | 3300006871 | Bacteria | 920 |
| 189 | Ga0075434_101147703 | 3300006871 | Bacteria | 790 |
| 190 | Ga0075429_100000100 | 3300006880 | Bacteria | 47693 |
| 191 | Ga0075429_100367967 | 3300006880 | Bacteria | 1259 |
| 192 | Ga0075429_100407123 | 3300006880 | Bacteria | 1191 |
| 193 | Ga0075429_100518442 | 3300006880 | Bacteria | 1044 |
| 194 | Ga0068865_100208955 | 3300006881 | Bacteria | 1520 |
| 195 | Ga0068865_101397972 | 3300006881 | Bacteria | 625 |
| 196 | Ga0068865_101698018 | 3300006881 | Bacteria | 569 |
| 197 | Ga0075436_100000529 | 3300006914 | Bacteria | 24848 |
| 198 | Ga0075436_100000789 | 3300006914 | Bacteria | 21020 |
| 199 | Ga0075436_100061499 | 3300006914 | Bacteria | 2594 |
| 200 | Ga0075436_100106581 | 3300006914 | Bacteria | 1955 |
| 201 | Ga0075436_100150487 | 3300006914 | Bacteria | 1638 |
| 202 | Ga0097620_100054593 | 3300006931 | Bacteria | 4019 |
| 203 | Ga0097620_100188154 | 3300006931 | Bacteria | 2149 |
| 204 | Ga0097620_100299041 | 3300006931 | Bacteria | 1703 |
| 205 | Ga0097620_100801326 | 3300006931 | Bacteria | 1030 |
| 206 | Ga0097620_100948861 | 3300006931 | Bacteria | 944 |
| 207 | Ga0075435_100000655 | 3300007076 | Bacteria | 21307 |
| 208 | Ga0075435_100003904 | 3300007076 | Bacteria | 10179 |
| 209 | Ga0075435_100009301 | 3300007076 | Bacteria | 7103 |
| 210 | Ga0075435_100049195 | 3300007076 | Bacteria | 3389 |
| 211 | Ga0075435_102014928 | 3300007076 | Bacteria | 507 |
| 212 | Ga0099794_10007992 | 3300007265 | Bacteria | 4375 |
| 213 | Ga0099794_10022268 | 3300007265 | Bacteria | 2888 |
| 214 | Ga0099795_10283253 | 3300007788 | Bacteria | 724 |
| 215 | Ga0099795_10418362 | 3300007788 | Bacteria | 612 |
| 216 | Ga0105250_10077252 | 3300009092 | Bacteria | 1348 |
| 217 | Ga0105240_12356249 | 3300009093 | Unclassified | 551 |
| 218 | Ga0111539_10013498 | 3300009094 | Bacteria | 10209 |
| 219 | Ga0111539_10029705 | 3300009094 | Bacteria | 6654 |
| 220 | Ga0111539_10036478 | 3300009094 | Bacteria | 5944 |
| 221 | Ga0111539_10155934 | 3300009094 | Bacteria | 2672 |
| 222 | Ga0111539_10201316 | 3300009094 | Bacteria | 2322 |
| 223 | Ga0111539_10310723 | 3300009094 | Bacteria | 1834 |
| 224 | Ga0111539_10320185 | 3300009094 | Bacteria | 1805 |
| 225 | Ga0111539_11099843 | 3300009094 | Bacteria | 924 |
| 226 | Ga0111539_11661899 | 3300009094 | Bacteria | 741 |
| 227 | Ga0111539_11863665 | 3300009094 | Bacteria | 697 |
| 228 | Ga0111539_11935591 | 3300009094 | Bacteria | 684 |
| 229 | Ga0114129_10011817 | 3300009147 | Bacteria | 12420 |
| 230 | Ga0114129_10105488 | 3300009147 | Bacteria | 3894 |
| 231 | Ga0114129_10610148 | 3300009147 | Bacteria | 1413 |
| 232 | Ga0114129_11383659 | 3300009147 | Bacteria | 869 |
| 233 | Ga0114129_11614027 | 3300009147 | Bacteria | 794 |
| 234 | Ga0114129_11744730 | 3300009147 | Bacteria | 758 |
| 235 | Ga0105243_10181886 | 3300009148 | Bacteria | 1829 |
| 236 | Ga0105243_12286481 | 3300009148 | Bacteria | 578 |
| 237 | Ga0105243_12353746 | 3300009148 | Bacteria | 571 |
| 238 | Ga0105243_12664274 | 3300009148 | Bacteria | 540 |
| 239 | Ga0105248_10668234 | 3300009177 | Bacteria | 1172 |
| 240 | Ga0105248_12906309 | 3300009177 | Bacteria | 546 |
| 241 | Ga0105249_10096280 | 3300009553 | Bacteria | 2777 |
| 242 | Ga0105249_10102987 | 3300009553 | Bacteria | 2688 |
| 243 | Ga0099796_10075186 | 3300010159 | Bacteria | 1228 |
| 244 | Ga0105239_10172608 | 3300010375 | Bacteria | 2418 |
| 245 | Ga0105246_11618355 | 3300011119 | Bacteria | 613 |
| 246 | Ga0157378_11028577 | 3300013297 | Bacteria | 859 |
| 247 | Ga0163162_10169104 | 3300013306 | Bacteria | 2310 |
| 248 | Ga0157372_11064740 | 3300013307 | Bacteria | 936 |
| 249 | Ga0157372_11661021 | 3300013307 | Bacteria | 735 |
| 250 | Ga0157375_11533541 | 3300013308 | Bacteria | 787 |
| 251 | Ga0157375_12859398 | 3300013308 | Bacteria | 577 |
| 252 | Ga0157380_10122036 | 3300014326 | Bacteria | 2209 |
| 253 | Ga0157380_10328451 | 3300014326 | Bacteria | 1421 |
| 254 | Ga0157380_11248357 | 3300014326 | Bacteria | 788 |
| 255 | Ga0157377_10958053 | 3300014745 | Bacteria | 644 |
| 256 | Ga0157379_10109750 | 3300014968 | Bacteria | 2478 |
| 257 | Ga0207653_10305872 | 3300025885 | Bacteria | 617 |
| 258 | Ga0207653_10399583 | 3300025885 | Bacteria | 539 |
| 259 | Ga0207692_10040663 | 3300025898 | Bacteria | 2296 |
| 260 | Ga0207692_10240455 | 3300025898 | Bacteria | 1081 |
| 261 | Ga0207642_10057496 | 3300025899 | Bacteria | 1789 |
| 262 | Ga0207688_10179994 | 3300025901 | Bacteria | 1260 |
| 263 | Ga0207685_10294079 | 3300025905 | Bacteria | 801 |
| 264 | Ga0207699_11114596 | 3300025906 | Bacteria | 584 |
| 265 | Ga0207645_10079638 | 3300025907 | Bacteria | 2100 |
| 266 | Ga0207643_10234840 | 3300025908 | Bacteria | 1126 |
| 267 | Ga0207684_10189827 | 3300025910 | Bacteria | 1772 |
| 268 | Ga0207654_10740362 | 3300025911 | Bacteria | 708 |
| 269 | Ga0207707_10007590 | 3300025912 | Bacteria | 9451 |
| 270 | Ga0207707_10174695 | 3300025912 | Bacteria | 1877 |
| 271 | Ga0207663_11220927 | 3300025916 | Bacteria | 605 |
| 272 | Ga0207660_10135994 | 3300025917 | Bacteria | 1875 |
| 273 | Ga0207660_10484147 | 3300025917 | Bacteria | 1003 |
| 274 | Ga0207660_10584725 | 3300025917 | Bacteria | 909 |
| 275 | Ga0207662_10011539 | 3300025918 | Bacteria | 4905 |
| 276 | Ga0207662_10439632 | 3300025918 | Bacteria | 890 |
| 277 | Ga0207662_10765445 | 3300025918 | Bacteria | 679 |
| 278 | Ga0207652_10063323 | 3300025921 | Bacteria | 3198 |
| 279 | Ga0207652_10734118 | 3300025921 | Bacteria | 880 |
| 280 | Ga0207646_10034021 | 3300025922 | Bacteria | 4606 |
| 281 | Ga0207646_11315685 | 3300025922 | Bacteria | 631 |
| 282 | Ga0207681_10002005 | 3300025923 | Bacteria | 13073 |
| 283 | Ga0207681_10554103 | 3300025923 | Bacteria | 946 |
| 284 | Ga0207694_10966997 | 3300025924 | Bacteria | 720 |
| 285 | Ga0207659_10039287 | 3300025926 | Bacteria | 3299 |
| 286 | Ga0207700_10419794 | 3300025928 | Bacteria | 1175 |
| 287 | Ga0207664_10211487 | 3300025929 | Bacteria | 1678 |
| 288 | Ga0207706_10044590 | 3300025933 | Bacteria | 3930 |
| 289 | Ga0207709_10009164 | 3300025935 | Bacteria | 5452 |
| 290 | Ga0207709_10237095 | 3300025935 | Bacteria | 1325 |
| 291 | Ga0207709_10708040 | 3300025935 | Bacteria | 806 |
| 292 | Ga0207709_10985346 | 3300025935 | Bacteria | 688 |
| 293 | Ga0207670_10051873 | 3300025936 | Bacteria | 2757 |
| 294 | Ga0207670_10139389 | 3300025936 | Bacteria | 1787 |
| 295 | Ga0207670_10642978 | 3300025936 | Bacteria | 874 |
| 296 | Ga0207670_10695374 | 3300025936 | Bacteria | 841 |
| 297 | Ga0207670_10813710 | 3300025936 | Bacteria | 779 |
| 298 | Ga0207670_11198060 | 3300025936 | Bacteria | 643 |
| 299 | Ga0207669_10043573 | 3300025937 | Bacteria | 2629 |
| 300 | Ga0207704_10016097 | 3300025938 | Bacteria | 3833 |
| 301 | Ga0207665_10155307 | 3300025939 | Bacteria | 1642 |
| 302 | Ga0207665_10167973 | 3300025939 | Bacteria | 1582 |
| 303 | Ga0207665_10587247 | 3300025939 | Bacteria | 869 |
| 304 | Ga0207691_10152795 | 3300025940 | Bacteria | 2029 |
| 305 | Ga0207689_10080631 | 3300025942 | Bacteria | 2675 |
| 306 | Ga0207689_10109005 | 3300025942 | Bacteria | 2275 |
| 307 | Ga0207661_10072757 | 3300025944 | Bacteria | 2813 |
| 308 | Ga0207667_10645454 | 3300025949 | Bacteria | 1064 |
| 309 | Ga0207651_10042207 | 3300025960 | Bacteria | 3034 |
| 310 | Ga0207651_11667926 | 3300025960 | Bacteria | 574 |
| 311 | Ga0207712_10047143 | 3300025961 | Bacteria | 2990 |
| 312 | Ga0207712_10270191 | 3300025961 | Bacteria | 1383 |
| 313 | Ga0207712_10388852 | 3300025961 | Bacteria | 1169 |
| 314 | Ga0207668_10057398 | 3300025972 | Bacteria | 2715 |
| 315 | Ga0207640_10117957 | 3300025981 | Bacteria | 1895 |
| 316 | Ga0207677_10115093 | 3300026023 | Bacteria | 2011 |
| 317 | Ga0207703_10029223 | 3300026035 | Bacteria | 4348 |
| 318 | Ga0207703_11033217 | 3300026035 | Bacteria | 789 |
| 319 | Ga0207708_10079581 | 3300026075 | Bacteria | 2517 |
| 320 | Ga0207708_10093074 | 3300026075 | Bacteria | 2326 |
| 321 | Ga0207708_10097048 | 3300026075 | Bacteria | 2278 |
| 322 | Ga0207708_10257402 | 3300026075 | Bacteria | 1408 |
| 323 | Ga0207702_11432171 | 3300026078 | Bacteria | 685 |
| 324 | Ga0207641_10510824 | 3300026088 | Bacteria | 1168 |
| 325 | Ga0207641_10761805 | 3300026088 | Bacteria | 956 |
| 326 | Ga0207641_10882191 | 3300026088 | Bacteria | 888 |
| 327 | Ga0207648_10051799 | 3300026089 | Bacteria | 3588 |
| 328 | Ga0207648_11061352 | 3300026089 | Bacteria | 759 |
| 329 | Ga0207676_10219315 | 3300026095 | Bacteria | 1693 |
| 330 | Ga0207674_10099832 | 3300026116 | Bacteria | 2885 |
| 331 | Ga0207674_10217411 | 3300026116 | Bacteria | 1859 |
| 332 | Ga0207674_10752728 | 3300026116 | Bacteria | 940 |
| 333 | Ga0207675_100038588 | 3300026118 | Bacteria | 4457 |
| 334 | Ga0207675_100770057 | 3300026118 | Bacteria | 974 |
| 335 | Ga0209969_1004244 | 3300027360 | Bacteria | 2004 |
| 336 | Ga0209969_1033634 | 3300027360 | Bacteria | 787 |
| 337 | Ga0209967_1005391 | 3300027364 | Bacteria | 1715 |
| 338 | Ga0209967_1008205 | 3300027364 | Bacteria | 1434 |
| 339 | Ga0209981_1000836 | 3300027378 | Bacteria | 3889 |
| 340 | Ga0209981_1006379 | 3300027378 | Bacteria | 1577 |
| 341 | Ga0209981_1022610 | 3300027378 | Bacteria | 902 |
| 342 | Ga0209996_1020278 | 3300027395 | Bacteria | 931 |
| 343 | Ga0209996_1048160 | 3300027395 | Bacteria | 642 |
| 344 | Ga0210000_1002454 | 3300027462 | Bacteria | 2639 |
| 345 | Ga0210000_1003595 | 3300027462 | Bacteria | 2235 |
| 346 | Ga0210000_1019850 | 3300027462 | Bacteria | 1024 |
| 347 | Ga0210000_1061270 | 3300027462 | Bacteria | 609 |
| 348 | Ga0209995_1009323 | 3300027471 | Bacteria | 1587 |
| 349 | Ga0209968_1005969 | 3300027526 | Bacteria | 1833 |
| 350 | Ga0209999_1011623 | 3300027543 | Bacteria | 1594 |
| 351 | Ga0209999_1016133 | 3300027543 | Bacteria | 1359 |
| 352 | Ga0209999_1020350 | 3300027543 | Bacteria | 1219 |
| 353 | Ga0209982_1007530 | 3300027552 | Bacteria | 1591 |
| 354 | Ga0209970_1080269 | 3300027614 | Bacteria | 612 |
| 355 | Ga0209983_1022842 | 3300027665 | Bacteria | 1313 |
| 356 | Ga0209588_1070846 | 3300027671 | Bacteria | 1126 |
| 357 | Ga0209588_1093254 | 3300027671 | Bacteria | 970 |
| 358 | Ga0209971_1003692 | 3300027682 | Bacteria | 3629 |
| 359 | Ga0209966_1005356 | 3300027695 | Bacteria | 2201 |
| 360 | Ga0209966_1009473 | 3300027695 | Bacteria | 1740 |
| 361 | Ga0209966_1097057 | 3300027695 | Bacteria | 664 |
| 362 | Ga0209974_10023970 | 3300027876 | Bacteria | 2019 |
| 363 | Ga0207428_10025385 | 3300027907 | Bacteria | 4960 |
| 364 | Ga0207428_10040931 | 3300027907 | Bacteria | 3753 |
| 365 | Ga0207428_10131119 | 3300027907 | Bacteria | 1918 |
| 366 | Ga0207428_10253196 | 3300027907 | Bacteria | 1313 |
| 367 | Ga0207428_10840033 | 3300027907 | Bacteria | 651 |
| 368 | Ga0268265_10001159 | 3300028380 | Bacteria | 23174 |
| 369 | Ga0268265_10287607 | 3300028380 | Bacteria | 1474 |
| 370 | Ga0268265_10290618 | 3300028380 | Bacteria | 1467 |
| 371 | Ga0307408_100137592 | 3300031548 | Bacteria | 1913 |
| 372 | Ga0307408_100414914 | 3300031548 | Bacteria | 1159 |
| 373 | Ga0307408_100542108 | 3300031548 | Bacteria | 1025 |
| 374 | Ga0316578_10049224 | 3300031728 | Bacteria | 2462 |
| 375 | Ga0307405_10707397 | 3300031731 | Bacteria | 835 |
| 376 | Ga0316577_10091297 | 3300031733 | Bacteria | 1705 |
| 377 | Ga0307413_10276368 | 3300031824 | Bacteria | 1261 |
| 378 | Ga0307413_10288608 | 3300031824 | Bacteria | 1238 |
| 379 | Ga0307410_11263433 | 3300031852 | Bacteria | 645 |
| 380 | Ga0307406_10672945 | 3300031901 | Bacteria | 861 |
| 381 | Ga0307406_10770264 | 3300031901 | Bacteria | 810 |
| 382 | Ga0307407_10532386 | 3300031903 | Bacteria | 866 |
| 383 | Ga0307412_10328122 | 3300031911 | Bacteria | 1220 |
| 384 | Ga0307412_11312247 | 3300031911 | Bacteria | 652 |
| 385 | Ga0307409_100370250 | 3300031995 | Bacteria | 1358 |
| 386 | Ga0307416_100084117 | 3300032002 | Bacteria | 2702 |
| 387 | Ga0307416_101331134 | 3300032002 | Bacteria | 824 |
| 388 | Ga0307416_102261756 | 3300032002 | Bacteria | 644 |
| 389 | Ga0307416_102642827 | 3300032002 | Bacteria | 599 |
| 390 | Ga0307416_102759232 | 3300032002 | Unclassified | 587 |
| 391 | Ga0307416_103120348 | 3300032002 | Bacteria | 554 |
| 392 | Ga0307411_10031659 | 3300032005 | Bacteria | 3258 |
| 393 | Ga0307411_10046102 | 3300032005 | Bacteria | 2808 |
| 394 | Ga0307411_10538554 | 3300032005 | Bacteria | 994 |
| 395 | Ga0307415_101164953 | 3300032126 | Bacteria | 725 |
| 396 | Ga0373959_0039589 | 3300034820 | Bacteria | 984 |
| 397 | Ga0373938_0014497 | 3300034957 | Bacteria | 1514 |
| 398 | Ga0373938_0049865 | 3300034957 | Bacteria | 953 |
| 399 | Ga0373926_0029654 | 3300035083 | Bacteria | 1924 |
| 400 | Ga0373952_0060084 | 3300035092 | Bacteria | 927 |
| 401 | Ga0373932_0198017 | 3300035112 | Bacteria | 713 |
| 402 | Ga0373936_0054593 | 3300035113 | Bacteria | 1621 |
| 403 | Ga0373936_0117177 | 3300035113 | Bacteria | 1135 |
| 404 | Ga0373939_0055492 | 3300035114 | Bacteria | 1244 |
| 405 | Ga0373939_0098681 | 3300035114 | Bacteria | 999 |
| 406 | Ga0373953_0028337 | 3300035117 | Bacteria | 2159 |
| 407 | Ga0373953_0220347 | 3300035117 | Bacteria | 822 |
| 408 | Ga0373954_0001511 | 3300035118 | Bacteria | 9463 |
| 409 | Ga0373956_0165188 | 3300035119 | Bacteria | 1044 |
| 410 | Ga0373960_0053316 | 3300035121 | Bacteria | 1206 |
| 411 | Ga0373960_0115977 | 3300035121 | Bacteria | 884 |
| 412 | Ga0373960_0186225 | 3300035121 | Bacteria | 727 |
| 413 | Ga0373955_0003334 | 3300035172 | Bacteria | 7054 |
| 414 | Ga0373955_0127557 | 3300035172 | Bacteria | 1483 |
| 415 | Ga0373955_0548087 | 3300035172 | Bacteria | 707 |
| 416 | Ga0373942_0002391 | 3300035207 | Bacteria | 4561 |
| 417 | Ga0373961_0015462 | 3300035241 | Bacteria | 1952 |
| 418 | Ga0373961_0020738 | 3300035241 | Bacteria | 1741 |
| 419 | Ga0316574_0126274 | 3300035398 | Bacteria | 1644 |
| 420 | Ga0373924_0043921 | 3300035410 | Bacteria | 1836 |
| 421 | Ga0373924_0094759 | 3300035410 | Bacteria | 1280 |
| 422 | Ga0373931_0008167 | 3300035691 | Bacteria | 4959 |
| 423 | Ga0373931_0674708 | 3300035691 | Bacteria | 681 |
| 424 | Ga0373935_0572217 | 3300035692 | Bacteria | 825 |
| 425 | Ga0373933_0011855 | 3300035724 | Bacteria | 4814 |
| 426 | Ga0373933_0018495 | 3300035724 | Bacteria | 3919 |
| 427 | Ga0373933_0359974 | 3300035724 | Bacteria | 946 |
| 428 | Ga0373947_0058905 | 3300035725 | Bacteria | 2328 |
| 429 | Ga0373937_0001313 | 3300036401 | Bacteria | 20818 |
| 430 | Ga0373937_0019027 | 3300036401 | Bacteria | 6144 |
| 431 | Ga0373937_0033470 | 3300036401 | Bacteria | 4667 |
| 432 | Ga0373937_0117971 | 3300036401 | Bacteria | 2472 |
| 433 | Ga0316582_0081899 | 3300036647 | Bacteria | 2109 |
| 434 | Ga0316584_0030436 | 3300036712 | Bacteria | 3987 |
| 435 | Ga0373925_0059535 | 3300037068 | Bacteria | 2865 |
| 436 | Ga0436365_1920613 | 3300039437 | Bacteria | 1105 |
| 437 | Ga0436360_0526383 | 3300039438 | Bacteria | 1219 |
| 438 | Ga0439439_0058260 | 3300041406 | Bacteria | 1022 |
| 439 | Ga0439453_0035069 | 3300041408 | Bacteria | 965 |
| 440 | Ga0439461_0098261 | 3300041410 | Bacteria | 710 |
| 441 | Ga0451802_0106108 | 3300041460 | Bacteria | 514 |
| 442 | Ga0451839_0301690 | 3300041496 | Bacteria | 917 |
| 443 | Ga0439441_000219 | 3300042001 | Bacteria | 5405 |
| 444 | Ga0439441_148769 | 3300042001 | Bacteria | 551 |
| 445 | Ga0439443_016332 | 3300042003 | Bacteria | 1133 |
| 446 | Ga0439443_050491 | 3300042003 | Bacteria | 727 |
| 447 | Ga0439454_035451 | 3300042011 | Bacteria | 799 |
| 448 | Ga0439456_012653 | 3300042013 | Bacteria | 1750 |
| 449 | Ga0450923_094551 | 3300042125 | Bacteria | 684 |
| 450 | Ga0439446_0029196 | 3300042156 | Bacteria | 1591 |
| 451 | Ga0439446_0105136 | 3300042156 | Bacteria | 896 |
| 452 | Ga0439434_0000867 | 3300042435 | Bacteria | 8710 |
| 453 | Ga0439434_0073656 | 3300042435 | Bacteria | 1077 |
| 454 | Ga0439434_0274291 | 3300042435 | Bacteria | 580 |
| 455 | Ga0439435_0007268 | 3300042436 | Bacteria | 2526 |
| 456 | Ga0439444_0003897 | 3300042437 | Bacteria | 2135 |
| 457 | Ga0439459_0081256 | 3300042438 | Bacteria | 766 |
| 458 | Ga0439460_0058644 | 3300042461 | Bacteria | 1170 |
| 459 | Ga0450893_0068260 | 3300042532 | Bacteria | 688 |
| 460 | Ga0451577_0642743 | 3300042876 | Bacteria | 962 |
| 461 | Ga0451577_1385759 | 3300042876 | Bacteria | 624 |
| 462 | Ga0453683_0541986 | 3300044673 | Bacteria | 757 |
| 463 | Ga0453683_0930934 | 3300044673 | Bacteria | 575 |
| 464 | Ga0466963_0246298 | 3300044694 | Bacteria | 1254 |
| 465 | Ga0466960_0068503 | 3300044901 | Bacteria | 1761 |
| 466 | Ga0466960_0344018 | 3300044901 | Bacteria | 849 |
| 467 | Ga0451576_0106040 | 3300045051 | Bacteria | 2924 |
| 468 | Ga0451576_0136400 | 3300045051 | Bacteria | 2559 |
| 469 | Ga0451576_0226550 | 3300045051 | Bacteria | 1952 |
| 470 | Ga0451576_0226592 | 3300045051 | Bacteria | 1952 |
| 471 | Ga0451576_2413427 | 3300045051 | Bacteria | 538 |
| 472 | Ga0466958_0076169 | 3300045836 | Bacteria | 2059 |
| 473 | Ga0466967_0008116 | 3300045976 | Bacteria | 7660 |
| 474 | Ga0495592_0695869 | 3300046454 | Bacteria | 612 |
| 475 | Ga0495603_0238847 | 3300046455 | Bacteria | 1047 |
| 476 | Ga0495590_0354744 | 3300046457 | Bacteria | 558 |
| 477 | Ga0495629_0060679 | 3300046459 | Bacteria | 2643 |
| 478 | Ga0495651_0165640 | 3300046462 | Bacteria | 1579 |
| 479 | Ga0495662_0031220 | 3300046476 | Bacteria | 2573 |
| 480 | Ga0495662_0138463 | 3300046476 | Bacteria | 1198 |
| 481 | Ga0495584_0050854 | 3300046491 | Bacteria | 2087 |
| 482 | Ga0495584_0087837 | 3300046491 | Bacteria | 1567 |
| 483 | Ga0495584_0249144 | 3300046491 | Bacteria | 903 |
| 484 | Ga0495608_0000767 | 3300046511 | Bacteria | 22475 |
| 485 | Ga0495608_0310669 | 3300046511 | Bacteria | 975 |
| 486 | Ga0495618_0033918 | 3300046514 | Bacteria | 3200 |
| 487 | Ga0495628_0003354 | 3300046516 | Bacteria | 14318 |
| 488 | Ga0495628_0536684 | 3300046516 | Bacteria | 841 |
| 489 | Ga0495630_0020245 | 3300046517 | Bacteria | 4903 |
| 490 | Ga0495644_0096494 | 3300046523 | Bacteria | 1117 |
| 491 | Ga0495666_0005319 | 3300046526 | Bacteria | 6490 |
| 492 | Ga0495642_0091091 | 3300046528 | Bacteria | 1291 |
| 493 | Ga0495642_0108562 | 3300046528 | Bacteria | 1185 |
| 494 | Ga0495652_0595961 | 3300046529 | Bacteria | 754 |
| 495 | Ga0495640_0013075 | 3300046533 | Bacteria | 6321 |
| 496 | Ga0495640_0024651 | 3300046533 | Bacteria | 4374 |
| 497 | Ga0495586_0020862 | 3300046535 | Bacteria | 3490 |
| 498 | Ga0495587_0028889 | 3300046536 | Bacteria | 3369 |
| 499 | Ga0495609_0179220 | 3300046538 | Bacteria | 892 |
| 500 | Ga0495645_0028191 | 3300046543 | Bacteria | 4080 |
| 501 | Ga0495667_0014877 | 3300046559 | Bacteria | 5257 |
| 502 | Ga0495667_0120746 | 3300046559 | Bacteria | 1692 |
| 503 | Ga0495634_0004750 | 3300046642 | Bacteria | 10569 |
| 504 | Ga0495635_0075811 | 3300046663 | Bacteria | 2304 |
| 505 | Ga0495635_0098814 | 3300046663 | Bacteria | 1995 |
| 506 | Ga0495659_0149090 | 3300046664 | Bacteria | 938 |
| 507 | Ga0495659_0232069 | 3300046664 | Bacteria | 765 |
| 508 | Ga0495659_0274160 | 3300046664 | Bacteria | 708 |
| 509 | Ga0495657_0350814 | 3300046675 | Bacteria | 873 |
| 510 | Ga0495599_0094489 | 3300046678 | Bacteria | 1865 |
| 511 | Ga0495623_0097921 | 3300046679 | Bacteria | 1791 |
| 512 | Ga0495623_0402531 | 3300046679 | Bacteria | 736 |
| 513 | Ga0495646_0255191 | 3300046680 | Bacteria | 938 |
| 514 | Ga0495658_0033007 | 3300046683 | Bacteria | 2831 |
| 515 | Ga0495669_0016877 | 3300046684 | Bacteria | 3131 |
| 516 | Ga0495669_0081557 | 3300046684 | Bacteria | 1485 |
| 517 | Ga0495669_0168285 | 3300046684 | Bacteria | 1042 |
| 518 | Ga0495613_0027811 | 3300046689 | Bacteria | 4208 |
| 519 | Ga0495624_0051034 | 3300046690 | Bacteria | 2619 |
| 520 | Ga0495671_0604241 | 3300046692 | Bacteria | 522 |
| 521 | Ga0495600_0014090 | 3300046809 | Bacteria | 5036 |
| 522 | Ga0495600_0780057 | 3300046809 | Bacteria | 570 |
| 523 | Ga0495604_0003259 | 3300047317 | Bacteria | 12969 |
| 524 | Ga0495604_0115359 | 3300047317 | Bacteria | 1952 |
| 525 | Ga0495604_0165596 | 3300047317 | Bacteria | 1559 |
| 526 | Ga0495604_0858958 | 3300047317 | Bacteria | 569 |
| 527 | Ga0495636_0017357 | 3300047318 | Bacteria | 2881 |
| 528 | Ga0495674_0164174 | 3300047319 | Bacteria | 1857 |
| 529 | Ga0495680_0007743 | 3300047322 | Bacteria | 9811 |
| 530 | Ga0495680_0182929 | 3300047322 | Bacteria | 1511 |
| 531 | Ga0501290_028777 | 3300049513 | Bacteria | 789 |
| 532 | Ga0501290_056162 | 3300049513 | Bacteria | 624 |
| 533 | Ga0501291_051778 | 3300049514 | Bacteria | 750 |
| 534 | Ga0501291_155202 | 3300049514 | Bacteria | 520 |
| 535 | Ga0501296_024027 | 3300049519 | Bacteria | 793 |
| 536 | Ga0501299_017791 | 3300049522 | Bacteria | 1272 |
| 537 | Ga0501031_0071786 | 3300049568 | Bacteria | 2254 |
| 538 | Ga0501031_0259271 | 3300049568 | Bacteria | 1130 |
| 539 | Ga0501032_0117810 | 3300049569 | Bacteria | 1756 |
| 540 | Ga0501033_0038508 | 3300049570 | Bacteria | 3574 |
| 541 | Ga0501033_0248006 | 3300049570 | Bacteria | 1263 |
| 542 | Ga0501036_0098691 | 3300049572 | Bacteria | 2469 |
| 543 | Ga0501036_0399362 | 3300049572 | Bacteria | 1147 |
| 544 | Ga0501036_0706092 | 3300049572 | Bacteria | 833 |
| 545 | Ga0501037_0077355 | 3300049573 | Bacteria | 2414 |
| 546 | Ga0501037_0163388 | 3300049573 | Bacteria | 1587 |
| 547 | Ga0501037_0276465 | 3300049573 | Bacteria | 1171 |
| 548 | Ga0501037_0292492 | 3300049573 | Bacteria | 1133 |
| 549 | Ga0501038_0012391 | 3300049574 | Bacteria | 7793 |
| 550 | Ga0501039_0028433 | 3300049575 | Bacteria | 4304 |
| 551 | Ga0501039_0048062 | 3300049575 | Bacteria | 3298 |
| 552 | Ga0501039_0066519 | 3300049575 | Bacteria | 2798 |
| 553 | Ga0501039_0953095 | 3300049575 | Bacteria | 667 |
| 554 | Ga0501040_0004390 | 3300049576 | Bacteria | 9163 |
| 555 | Ga0501040_0309215 | 3300049576 | Bacteria | 1130 |
| 556 | Ga0501041_0026263 | 3300049577 | Bacteria | 3502 |
| 557 | Ga0501041_0028785 | 3300049577 | Bacteria | 3351 |
| 558 | Ga0501041_0168708 | 3300049577 | Bacteria | 1369 |
| 559 | Ga0501042_0003021 | 3300049578 | Bacteria | 10463 |
| 560 | Ga0501042_0342532 | 3300049578 | Bacteria | 1081 |
| 561 | Ga0501042_0371039 | 3300049578 | Bacteria | 1036 |
| 562 | Ga0501042_0847043 | 3300049578 | Bacteria | 666 |
| 563 | Ga0501043_0039549 | 3300049579 | Bacteria | 3706 |
| 564 | Ga0501043_1234851 | 3300049579 | Bacteria | 524 |
| 565 | Ga0501046_0003243 | 3300049580 | Bacteria | 14952 |
| 566 | Ga0501046_0025733 | 3300049580 | Bacteria | 4813 |
| 567 | Ga0501046_0194088 | 3300049580 | Bacteria | 1514 |
| 568 | Ga0501046_0315807 | 3300049580 | Bacteria | 1139 |
| 569 | Ga0501048_0007325 | 3300049582 | Bacteria | 8364 |
| 570 | Ga0501048_0095589 | 3300049582 | Bacteria | 2095 |
| 571 | Ga0501048_0255963 | 3300049582 | Bacteria | 1243 |
| 572 | Ga0501048_0294256 | 3300049582 | Bacteria | 1155 |
| 573 | Ga0501067_0284097 | 3300049583 | Bacteria | 921 |
| 574 | Ga0501067_0523826 | 3300049583 | Bacteria | 663 |
| 575 | Ga0501068_0002746 | 3300049584 | Bacteria | 9355 |
| 576 | Ga0501068_0081979 | 3300049584 | Bacteria | 1981 |
| 577 | Ga0501068_0181367 | 3300049584 | Bacteria | 1331 |
| 578 | Ga0501068_0325359 | 3300049584 | Bacteria | 986 |
| 579 | Ga0501069_0024556 | 3300049585 | Bacteria | 3288 |
| 580 | Ga0501069_0290424 | 3300049585 | Bacteria | 958 |
| 581 | Ga0501069_0538260 | 3300049585 | Bacteria | 698 |
| 582 | Ga0501070_0086060 | 3300049586 | Bacteria | 2602 |
| 583 | Ga0501070_0730260 | 3300049586 | Bacteria | 782 |
| 584 | Ga0501071_0005475 | 3300049587 | Bacteria | 8166 |
| 585 | Ga0501071_0018923 | 3300049587 | Bacteria | 4777 |
| 586 | Ga0501071_0029827 | 3300049587 | Bacteria | 3853 |
| 587 | Ga0501071_0237264 | 3300049587 | Bacteria | 1375 |
| 588 | Ga0501071_0252574 | 3300049587 | Bacteria | 1331 |
| 589 | Ga0501071_0352656 | 3300049587 | Bacteria | 1120 |
| 590 | Ga0501071_0387803 | 3300049587 | Bacteria | 1066 |
| 591 | Ga0501071_0775939 | 3300049587 | Bacteria | 739 |
| 592 | Ga0501072_0007949 | 3300049588 | Bacteria | 8052 |
| 593 | Ga0501072_0011492 | 3300049588 | Bacteria | 6768 |
| 594 | Ga0501072_0019791 | 3300049588 | Bacteria | 5208 |
| 595 | Ga0501072_0032348 | 3300049588 | Bacteria | 4097 |
| 596 | Ga0501072_0106058 | 3300049588 | Bacteria | 2235 |
| 597 | Ga0501072_0455327 | 3300049588 | Bacteria | 1013 |
| 598 | Ga0501072_0783434 | 3300049588 | Bacteria | 747 |
| 599 | Ga0501073_0081968 | 3300049589 | Bacteria | 2244 |
| 600 | Ga0501073_0567593 | 3300049589 | Bacteria | 784 |
| 601 | Ga0501073_0831295 | 3300049589 | Bacteria | 636 |
| 602 | Ga0501074_0022089 | 3300049590 | Bacteria | 4623 |
| 603 | Ga0501074_0060359 | 3300049590 | Bacteria | 2732 |
| 604 | Ga0501075_0002198 | 3300049591 | Bacteria | 12907 |
| 605 | Ga0501075_0004962 | 3300049591 | Bacteria | 9071 |
| 606 | Ga0501075_0158338 | 3300049591 | Bacteria | 1727 |
| 607 | Ga0501075_0885772 | 3300049591 | Bacteria | 679 |
| 608 | Ga0501075_1092638 | 3300049591 | Bacteria | 606 |
| 609 | Ga0501075_1111525 | 3300049591 | Bacteria | 600 |
| 610 | Ga0501076_0000429 | 3300049592 | Bacteria | 26487 |
| 611 | Ga0501076_0023753 | 3300049592 | Bacteria | 4729 |
| 612 | Ga0501076_0037359 | 3300049592 | Bacteria | 3808 |
| 613 | Ga0501076_0828663 | 3300049592 | Bacteria | 763 |
| 614 | Ga0501076_0948510 | 3300049592 | Bacteria | 709 |
| 615 | Ga0501076_1447674 | 3300049592 | Bacteria | 564 |
| 616 | Ga0501077_0022192 | 3300049593 | Bacteria | 4020 |
| 617 | Ga0501077_0223566 | 3300049593 | Bacteria | 1196 |
| 618 | Ga0501079_0021474 | 3300049741 | Bacteria | 4939 |
| 619 | Ga0501079_0041234 | 3300049741 | Bacteria | 3562 |
| 620 | Ga0501079_0095219 | 3300049741 | Bacteria | 2307 |
| 621 | Ga0501079_0438437 | 3300049741 | Bacteria | 1026 |
| 622 | Ga0501080_0000634 | 3300049742 | Bacteria | 27899 |
| 623 | Ga0501080_0018543 | 3300049742 | Bacteria | 6438 |
| 624 | Ga0501080_0034438 | 3300049742 | Bacteria | 4728 |
| 625 | Ga0501080_0257367 | 3300049742 | Bacteria | 1591 |
| 626 | Ga0501081_0007073 | 3300049743 | Bacteria | 7295 |
| 627 | Ga0501081_0025861 | 3300049743 | Bacteria | 3953 |
| 628 | Ga0501081_0300506 | 3300049743 | Bacteria | 1177 |
| 629 | Ga0501083_1150845 | 3300049744 | Bacteria | 505 |
| 630 | Ga0501273_029267 | 3300049770 | Bacteria | 778 |
| 631 | Ga0501283_040433 | 3300049779 | Bacteria | 806 |
| 632 | Ga0501035_0343165 | 3300049822 | Bacteria | 1251 |
| 633 | Ga0501044_0117696 | 3300049823 | Bacteria | 2661 |
| 634 | Ga0501045_0038739 | 3300049824 | Bacteria | 3467 |
| 635 | Ga0501045_0472590 | 3300049824 | Bacteria | 932 |
| 636 | Ga0501045_0866118 | 3300049824 | Bacteria | 664 |
| 637 | Ga0501045_1043912 | 3300049824 | Bacteria | 599 |
| 638 | nmdc:mga0k408_656765_c1 | 3300050493 | Bacteria | 616 |
| 639 | nmdc:mga05p37_1255_c1 | 3300050507 | Bacteria | 29442 |
| 640 | nmdc:mga05p37_326471_c1 | 3300050507 | Bacteria | 1814 |
| 641 | nmdc:mga05p37_46253_c1 | 3300050507 | Bacteria | 5351 |
| 642 | nmdc:mga05p37_543024_c1 | 3300050507 | Bacteria | 1325 |
| 643 | nmdc:mga05p37_557944_c1 | 3300050507 | Bacteria | 1302 |
| 644 | nmdc:mga05p37_896453_c1 | 3300050507 | Bacteria | 957 |
| 645 | nmdc:mga09592_109_c1 | 3300050508 | Bacteria | 51482 |
| 646 | nmdc:mga09592_120181_c1 | 3300050508 | Bacteria | 2256 |
| 647 | nmdc:mga09592_160785_c1 | 3300050508 | Bacteria | 1940 |
| 648 | nmdc:mga09592_51500_c1 | 3300050508 | Bacteria | 3474 |
| 649 | nmdc:mga0qj67_139878_c1 | 3300050509 | Bacteria | 1963 |
| 650 | nmdc:mga0qj67_187335_c1 | 3300050509 | Bacteria | 1681 |
| 651 | nmdc:mga0qj67_2200_c1 | 3300050509 | Bacteria | 13866 |
| 652 | nmdc:mga0qj67_38319_c1 | 3300050509 | Bacteria | 3760 |
| 653 | nmdc:mga0qj67_448253_c1 | 3300050509 | Bacteria | 1040 |
| 654 | nmdc:mga0qj67_631194_c1 | 3300050509 | Bacteria | 856 |
| 655 | nmdc:mga0qj67_6675_c1 | 3300050509 | Bacteria | 8476 |
| 656 | nmdc:mga0qj67_715935_c1 | 3300050509 | Bacteria | 796 |
| 657 | nmdc:mga06r32_151321_c1 | 3300050510 | Bacteria | 2299 |
| 658 | nmdc:mga06r32_296652_c1 | 3300050510 | Bacteria | 1603 |
| 659 | nmdc:mga06r32_328435_c1 | 3300050510 | Bacteria | 1515 |
| 660 | nmdc:mga06r32_392232_c1 | 3300050510 | Bacteria | 1371 |
| 661 | nmdc:mga06r32_7661_c1 | 3300050510 | Bacteria | 9710 |
| 662 | nmdc:mga08y16_10670_c1 | 3300050511 | Bacteria | 9643 |
| 663 | nmdc:mga08y16_124577_c1 | 3300050511 | Bacteria | 2681 |
| 664 | nmdc:mga08y16_1390157_c1 | 3300050511 | Bacteria | 665 |
| 665 | nmdc:mga08y16_1392374_c1 | 3300050511 | Bacteria | 665 |
| 666 | nmdc:mga08y16_205809_c1 | 3300050511 | Bacteria | 2039 |
| 667 | nmdc:mga08y16_58461_c1 | 3300050511 | Bacteria | 4029 |
| 668 | nmdc:mga08y16_624448_c1 | 3300050511 | Bacteria | 1084 |
| 669 | nmdc:mga08y16_660425_c1 | 3300050511 | Bacteria | 1049 |
| 670 | nmdc:mga08y16_73557_c1 | 3300050511 | Bacteria | 3562 |
| 671 | nmdc:mga08y16_805050_c1 | 3300050511 | Bacteria | 932 |
| 672 | nmdc:mga08y16_85617_c1 | 3300050511 | Bacteria | 3285 |
| 673 | nmdc:mga0n895_12039_c1 | 3300050512 | Bacteria | 7744 |
| 674 | nmdc:mga0n895_734_c1 | 3300050512 | Bacteria | 23141 |
| 675 | nmdc:mga0n895_741372_c1 | 3300050512 | Bacteria | 976 |
| 676 | nmdc:mga0n895_749808_c1 | 3300050512 | Bacteria | 969 |
| 677 | nmdc:mga0n895_787149_c1 | 3300050512 | Bacteria | 942 |
| 678 | nmdc:mga0n895_7924_c1 | 3300050512 | Bacteria | 9159 |
| 679 | nmdc:mga0rr50_135268_c1 | 3300050513 | Bacteria | 1978 |
| 680 | nmdc:mga0rr50_2416_c1 | 3300050513 | Bacteria | 10515 |
| 681 | nmdc:mga0rr50_3670_c1 | 3300050513 | Bacteria | 8893 |
| 682 | nmdc:mga0rr50_509898_c1 | 3300050513 | Bacteria | 1023 |
| 683 | nmdc:mga0rr50_647896_c1 | 3300050513 | Bacteria | 901 |
| 684 | nmdc:mga0rr50_92416_c1 | 3300050513 | Bacteria | 2359 |
| 685 | nmdc:mga08x19_1688_c1 | 3300050514 | Bacteria | 13577 |
| 686 | nmdc:mga08x19_193748_c1 | 3300050514 | Bacteria | 1391 |
| 687 | nmdc:mga08x19_258_c1 | 3300050514 | Bacteria | 28365 |
| 688 | nmdc:mga08x19_41543_c1 | 3300050514 | Bacteria | 2929 |
| 689 | nmdc:mga08x19_415502_c1 | 3300050514 | Bacteria | 945 |
| 690 | nmdc:mga08x19_71597_c1 | 3300050514 | Bacteria | 2261 |
| 691 | nmdc:mga0a205_1601770_c1 | 3300050515 | Bacteria | 500 |
| 692 | nmdc:mga0a205_169979_c1 | 3300050515 | Bacteria | 2076 |
| 693 | nmdc:mga0a205_174980_c1 | 3300050515 | Bacteria | 2042 |
| 694 | nmdc:mga0a205_20918_c1 | 3300050515 | Bacteria | 6183 |
| 695 | nmdc:mga0a205_783914_c1 | 3300050515 | Bacteria | 801 |
| 696 | nmdc:mga0a205_94583_c1 | 3300050515 | Bacteria | 2887 |
| 697 | Ga0495601_0031047 | 3300053077 | Bacteria | 3320 |
| 698 | Ga0501084_0005520 | 3300054114 | Bacteria | 10383 |
| 699 | Ga0501084_0015444 | 3300054114 | Bacteria | 6332 |
| 700 | Ga0501084_0108528 | 3300054114 | Bacteria | 2332 |
| 701 | Ga0501084_0254343 | 3300054114 | Bacteria | 1483 |
| 702 | Ga0590071_110935 | 3300059421 | Bacteria | 696 |
| 703 | Ga0590071_200354 | 3300059421 | Bacteria | 525 |
| 704 | Ga0501082_0029179 | 3300060353 | Bacteria | 4752 |
| 705 | Ga0501082_0078152 | 3300060353 | Bacteria | 2854 |
| 706 | Ga0501082_1587434 | 3300060353 | Bacteria | 571 |
| 707 | Ga0530510_0000245 | 3300061734 | Bacteria | 34065 |
| 708 | Ga0530510_0034283 | 3300061734 | Bacteria | 3655 |
| 709 | Ga0530510_0127461 | 3300061734 | Bacteria | 1871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049824 | Ga0501045_1043912 | Ga0501045_1043912_23_346 | 107 |
| 2 | 3300050493 | nmdc:mga0k408_656765_c1 | nmdc:mga0k408_656765_c1_274_600 | 107 |
| 3 | 3300050509 | nmdc:mga0qj67_187335_c1 | nmdc:mga0qj67_187335_c1_853_1179 | 107 |
| 4 | 3300049591 | Ga0501075_0885772 | Ga0501075_0885772_61_399 | 112 |
| 5 | 3300031728 | Ga0316578_10049224 | Ga0316578_100492241 | 113 |
| 6 | 3300031733 | Ga0316577_10091297 | Ga0316577_100912972 | 113 |
| 7 | 3300036647 | Ga0316582_0081899 | Ga0316582_0081899_348_692 | 113 |
| 8 | 3300036712 | Ga0316584_0030436 | Ga0316584_0030436_182_526 | 113 |
| 9 | 3300025960 | Ga0207651_11667926 | Ga0207651_116679262 | 115 |
| 10 | 3300005438 | Ga0070701_11034061 | Ga0070701_110340611 | 116 |
| 11 | 3300009148 | Ga0105243_12353746 | Ga0105243_123537461 | 116 |
| 12 | 3300035398 | Ga0316574_0126274 | Ga0316574_0126274_671_1036 | 116 |
| 13 | 3300039438 | Ga0436360_0526383 | Ga0436360_0526383_89_445 | 116 |
| 14 | 3300049824 | Ga0501045_0472590 | Ga0501045_0472590_396_749 | 116 |
| 15 | 3300027360 | Ga0209969_1033634 | Ga0209969_10336342 | 117 |
| 16 | 3300049573 | Ga0501037_0163388 | Ga0501037_0163388_993_1376 | 117 |
| 17 | 3300049584 | Ga0501068_0081979 | Ga0501068_0081979_580_939 | 117 |
| 18 | 3300003203 | JGI25406J46586_10028696 | JGI25406J46586_100286964 | 118 |
| 19 | 3300005289 | Ga0065704_10570846 | Ga0065704_105708461 | 118 |
| 20 | 3300005289 | Ga0065704_10596573 | Ga0065704_105965732 | 118 |
| 21 | 3300005295 | Ga0065707_10027591 | Ga0065707_100275912 | 118 |
| 22 | 3300005295 | Ga0065707_10105333 | Ga0065707_101053335 | 118 |
| 23 | 3300005295 | Ga0065707_10329623 | Ga0065707_103296233 | 118 |
| 24 | 3300005328 | Ga0070676_10413024 | Ga0070676_104130243 | 118 |
| 25 | 3300005330 | Ga0070690_100483358 | Ga0070690_1004833582 | 118 |
| 26 | 3300005330 | Ga0070690_100926445 | Ga0070690_1009264452 | 118 |
| 27 | 3300005333 | Ga0070677_10039988 | Ga0070677_100399881 | 118 |
| 28 | 3300005334 | Ga0068869_100081685 | Ga0068869_1000816854 | 118 |
| 29 | 3300005334 | Ga0068869_100263038 | Ga0068869_1002630382 | 118 |
| 30 | 3300005334 | Ga0068869_101257403 | Ga0068869_1012574032 | 118 |
| 31 | 3300005336 | Ga0070680_100073644 | Ga0070680_1000736444 | 118 |
| 32 | 3300005336 | Ga0070680_100076659 | Ga0070680_1000766595 | 118 |
| 33 | 3300005336 | Ga0070680_100258591 | Ga0070680_1002585913 | 118 |
| 34 | 3300005336 | Ga0070680_100381635 | Ga0070680_1003816352 | 118 |
| 35 | 3300005336 | Ga0070680_101728537 | Ga0070680_1017285372 | 118 |
| 36 | 3300005338 | Ga0068868_100125085 | Ga0068868_1001250853 | 118 |
| 37 | 3300005340 | Ga0070689_100044499 | Ga0070689_1000444992 | 118 |
| 38 | 3300005340 | Ga0070689_100088254 | Ga0070689_1000882544 | 118 |
| 39 | 3300005340 | Ga0070689_102137562 | Ga0070689_1021375621 | 118 |
| 40 | 3300005341 | Ga0070691_10201129 | Ga0070691_102011292 | 118 |
| 41 | 3300005341 | Ga0070691_10209997 | Ga0070691_102099972 | 118 |
| 42 | 3300005341 | Ga0070691_10491621 | Ga0070691_104916211 | 118 |
| 43 | 3300005343 | Ga0070687_101344454 | Ga0070687_1013444541 | 118 |
| 44 | 3300005345 | Ga0070692_10005338 | Ga0070692_100053384 | 118 |
| 45 | 3300005345 | Ga0070692_10047687 | Ga0070692_100476874 | 118 |
| 46 | 3300005347 | Ga0070668_100250279 | Ga0070668_1002502793 | 118 |
| 47 | 3300005353 | Ga0070669_101472297 | Ga0070669_1014722972 | 118 |
| 48 | 3300005355 | Ga0070671_101294070 | Ga0070671_1012940702 | 118 |
| 49 | 3300005356 | Ga0070674_100153370 | Ga0070674_1001533702 | 118 |
| 50 | 3300005356 | Ga0070674_100199714 | Ga0070674_1001997142 | 118 |
| 51 | 3300005364 | Ga0070673_100221540 | Ga0070673_1002215401 | 118 |
| 52 | 3300005364 | Ga0070673_101633537 | Ga0070673_1016335371 | 118 |
| 53 | 3300005364 | Ga0070673_101899831 | Ga0070673_1018998311 | 118 |
| 54 | 3300005365 | Ga0070688_100123219 | Ga0070688_1001232193 | 118 |
| 55 | 3300005365 | Ga0070688_100763208 | Ga0070688_1007632082 | 118 |
| 56 | 3300005435 | Ga0070714_100807380 | Ga0070714_1008073801 | 118 |
| 57 | 3300005436 | Ga0070713_100507851 | Ga0070713_1005078511 | 118 |
| 58 | 3300005437 | Ga0070710_10151581 | Ga0070710_101515812 | 118 |
| 59 | 3300005438 | Ga0070701_10290299 | Ga0070701_102902993 | 118 |
| 60 | 3300005438 | Ga0070701_10322260 | Ga0070701_103222602 | 118 |
| 61 | 3300005439 | Ga0070711_100495849 | Ga0070711_1004958492 | 118 |
| 62 | 3300005440 | Ga0070705_100005218 | Ga0070705_1000052185 | 118 |
| 63 | 3300005440 | Ga0070705_100010397 | Ga0070705_1000103977 | 118 |
| 64 | 3300005440 | Ga0070705_100011800 | Ga0070705_1000118005 | 118 |
| 65 | 3300005440 | Ga0070705_100041177 | Ga0070705_1000411774 | 118 |
| 66 | 3300005440 | Ga0070705_100097312 | Ga0070705_1000973124 | 118 |
| 67 | 3300005440 | Ga0070705_100293911 | Ga0070705_1002939113 | 118 |
| 68 | 3300005440 | Ga0070705_100601447 | Ga0070705_1006014472 | 118 |
| 69 | 3300005440 | Ga0070705_100678336 | Ga0070705_1006783361 | 118 |
| 70 | 3300005440 | Ga0070705_101483474 | Ga0070705_1014834741 | 118 |
| 71 | 3300005440 | Ga0070705_101550414 | Ga0070705_1015504142 | 118 |
| 72 | 3300005441 | Ga0070700_100002243 | Ga0070700_10000224312 | 118 |
| 73 | 3300005441 | Ga0070700_100037745 | Ga0070700_1000377454 | 118 |
| 74 | 3300005441 | Ga0070700_100062202 | Ga0070700_1000622024 | 118 |
| 75 | 3300005441 | Ga0070700_100103395 | Ga0070700_1001033954 | 118 |
| 76 | 3300005441 | Ga0070700_100114186 | Ga0070700_1001141864 | 118 |
| 77 | 3300005441 | Ga0070700_100242150 | Ga0070700_1002421502 | 118 |
| 78 | 3300005444 | Ga0070694_100005289 | Ga0070694_1000052897 | 118 |
| 79 | 3300005444 | Ga0070694_100071167 | Ga0070694_1000711675 | 118 |
| 80 | 3300005444 | Ga0070694_100088018 | Ga0070694_1000880184 | 118 |
| 81 | 3300005444 | Ga0070694_100097506 | Ga0070694_1000975064 | 118 |
| 82 | 3300005444 | Ga0070694_100205992 | Ga0070694_1002059923 | 118 |
| 83 | 3300005444 | Ga0070694_100234559 | Ga0070694_1002345593 | 118 |
| 84 | 3300005444 | Ga0070694_100379531 | Ga0070694_1003795312 | 118 |
| 85 | 3300005444 | Ga0070694_100468519 | Ga0070694_1004685193 | 118 |
| 86 | 3300005445 | Ga0070708_101797927 | Ga0070708_1017979272 | 118 |
| 87 | 3300005457 | Ga0070662_100781646 | Ga0070662_1007816462 | 118 |
| 88 | 3300005458 | Ga0070681_10000081 | Ga0070681_1000008149 | 118 |
| 89 | 3300005459 | Ga0068867_100041138 | Ga0068867_1000411384 | 118 |
| 90 | 3300005459 | Ga0068867_100544744 | Ga0068867_1005447443 | 118 |
| 91 | 3300005467 | Ga0070706_100428612 | Ga0070706_1004286123 | 118 |
| 92 | 3300005467 | Ga0070706_100583187 | Ga0070706_1005831871 | 118 |
| 93 | 3300005468 | Ga0070707_100070257 | Ga0070707_1000702572 | 118 |
| 94 | 3300005468 | Ga0070707_100390916 | Ga0070707_1003909162 | 118 |
| 95 | 3300005471 | Ga0070698_100004625 | Ga0070698_1000046252 | 118 |
| 96 | 3300005471 | Ga0070698_100038692 | Ga0070698_1000386921 | 118 |
| 97 | 3300005471 | Ga0070698_100214960 | Ga0070698_1002149604 | 118 |
| 98 | 3300005518 | Ga0070699_100188068 | Ga0070699_1001880682 | 118 |
| 99 | 3300005518 | Ga0070699_100328149 | Ga0070699_1003281492 | 118 |
| 100 | 3300005518 | Ga0070699_100807023 | Ga0070699_1008070232 | 118 |
| 101 | 3300005518 | Ga0070699_101200854 | Ga0070699_1012008542 | 118 |
| 102 | 3300005518 | Ga0070699_101753470 | Ga0070699_1017534701 | 118 |
| 103 | 3300005530 | Ga0070679_100087834 | Ga0070679_1000878345 | 118 |
| 104 | 3300005530 | Ga0070679_100961419 | Ga0070679_1009614192 | 118 |
| 105 | 3300005530 | Ga0070679_101332505 | Ga0070679_1013325052 | 118 |
| 106 | 3300005536 | Ga0070697_100620813 | Ga0070697_1006208132 | 118 |
| 107 | 3300005543 | Ga0070672_100049380 | Ga0070672_1000493804 | 118 |
| 108 | 3300005544 | Ga0070686_100096793 | Ga0070686_1000967934 | 118 |
| 109 | 3300005544 | Ga0070686_100295425 | Ga0070686_1002954253 | 118 |
| 110 | 3300005544 | Ga0070686_100300817 | Ga0070686_1003008173 | 118 |
| 111 | 3300005545 | Ga0070695_100001505 | Ga0070695_10000150515 | 118 |
| 112 | 3300005545 | Ga0070695_100026646 | Ga0070695_1000266464 | 118 |
| 113 | 3300005545 | Ga0070695_100031307 | Ga0070695_1000313071 | 118 |
| 114 | 3300005545 | Ga0070695_100141072 | Ga0070695_1001410724 | 118 |
| 115 | 3300005545 | Ga0070695_100485606 | Ga0070695_1004856062 | 118 |
| 116 | 3300005545 | Ga0070695_100687629 | Ga0070695_1006876292 | 118 |
| 117 | 3300005545 | Ga0070695_101272979 | Ga0070695_1012729791 | 118 |
| 118 | 3300005546 | Ga0070696_100029015 | Ga0070696_1000290155 | 118 |
| 119 | 3300005546 | Ga0070696_100075059 | Ga0070696_1000750592 | 118 |
| 120 | 3300005546 | Ga0070696_100160365 | Ga0070696_1001603654 | 118 |
| 121 | 3300005546 | Ga0070696_100206865 | Ga0070696_1002068651 | 118 |
| 122 | 3300005546 | Ga0070696_100241887 | Ga0070696_1002418871 | 118 |
| 123 | 3300005546 | Ga0070696_100338142 | Ga0070696_1003381422 | 118 |
| 124 | 3300005546 | Ga0070696_100368546 | Ga0070696_1003685462 | 118 |
| 125 | 3300005546 | Ga0070696_100438461 | Ga0070696_1004384612 | 118 |
| 126 | 3300005546 | Ga0070696_100442244 | Ga0070696_1004422441 | 118 |
| 127 | 3300005546 | Ga0070696_101255112 | Ga0070696_1012551122 | 118 |
| 128 | 3300005546 | Ga0070696_101501741 | Ga0070696_1015017412 | 118 |
| 129 | 3300005547 | Ga0070693_100051202 | Ga0070693_1000512024 | 118 |
| 130 | 3300005547 | Ga0070693_100187688 | Ga0070693_1001876882 | 118 |
| 131 | 3300005547 | Ga0070693_100265882 | Ga0070693_1002658822 | 118 |
| 132 | 3300005549 | Ga0070704_100069852 | Ga0070704_1000698524 | 118 |
| 133 | 3300005549 | Ga0070704_100129221 | Ga0070704_1001292214 | 118 |
| 134 | 3300005549 | Ga0070704_100203790 | Ga0070704_1002037904 | 118 |
| 135 | 3300005549 | Ga0070704_100266307 | Ga0070704_1002663071 | 118 |
| 136 | 3300005549 | Ga0070704_101091672 | Ga0070704_1010916722 | 118 |
| 137 | 3300005549 | Ga0070704_101106416 | Ga0070704_1011064162 | 118 |
| 138 | 3300005563 | Ga0068855_100777780 | Ga0068855_1007777802 | 118 |
| 139 | 3300005577 | Ga0068857_100325486 | Ga0068857_1003254864 | 118 |
| 140 | 3300005578 | Ga0068854_100084875 | Ga0068854_1000848752 | 118 |
| 141 | 3300005614 | Ga0068856_100188274 | Ga0068856_1001882744 | 118 |
| 142 | 3300005614 | Ga0068856_101800911 | Ga0068856_1018009112 | 118 |
| 143 | 3300005615 | Ga0070702_100045349 | Ga0070702_1000453493 | 118 |
| 144 | 3300005615 | Ga0070702_100089935 | Ga0070702_1000899354 | 118 |
| 145 | 3300005615 | Ga0070702_100167399 | Ga0070702_1001673992 | 118 |
| 146 | 3300005615 | Ga0070702_100273543 | Ga0070702_1002735432 | 118 |
| 147 | 3300005617 | Ga0068859_100054594 | Ga0068859_1000545947 | 118 |
| 148 | 3300005617 | Ga0068859_100188149 | Ga0068859_1001881494 | 118 |
| 149 | 3300005617 | Ga0068859_100299024 | Ga0068859_1002990243 | 118 |
| 150 | 3300005617 | Ga0068859_100801290 | Ga0068859_1008012901 | 118 |
| 151 | 3300005617 | Ga0068859_100948811 | Ga0068859_1009488112 | 118 |
| 152 | 3300005618 | Ga0068864_100182993 | Ga0068864_1001829932 | 118 |
| 153 | 3300005618 | Ga0068864_101585004 | Ga0068864_1015850042 | 118 |
| 154 | 3300005718 | Ga0068866_10347163 | Ga0068866_103471632 | 118 |
| 155 | 3300005719 | Ga0068861_100508371 | Ga0068861_1005083713 | 118 |
| 156 | 3300005719 | Ga0068861_100681305 | Ga0068861_1006813052 | 118 |
| 157 | 3300005840 | Ga0068870_10426963 | Ga0068870_104269632 | 118 |
| 158 | 3300005841 | Ga0068863_101503799 | Ga0068863_1015037992 | 118 |
| 159 | 3300005842 | Ga0068858_100023814 | Ga0068858_1000238149 | 118 |
| 160 | 3300005842 | Ga0068858_101782523 | Ga0068858_1017825232 | 118 |
| 161 | 3300005843 | Ga0068860_100109367 | Ga0068860_1001093674 | 118 |
| 162 | 3300005843 | Ga0068860_100952298 | Ga0068860_1009522983 | 118 |
| 163 | 3300005844 | Ga0068862_100211533 | Ga0068862_1002115334 | 118 |
| 164 | 3300005844 | Ga0068862_100257889 | Ga0068862_1002578894 | 118 |
| 165 | 3300005844 | Ga0068862_100398441 | Ga0068862_1003984413 | 118 |
| 166 | 3300005844 | Ga0068862_101441351 | Ga0068862_1014413512 | 118 |
| 167 | 3300005981 | Ga0081538_10108255 | Ga0081538_101082553 | 118 |
| 168 | 3300005985 | Ga0081539_10004782 | Ga0081539_1000478219 | 118 |
| 169 | 3300006163 | Ga0070715_10135105 | Ga0070715_101351053 | 118 |
| 170 | 3300006173 | Ga0070716_100433289 | Ga0070716_1004332893 | 118 |
| 171 | 3300006173 | Ga0070716_100436828 | Ga0070716_1004368283 | 118 |
| 172 | 3300006173 | Ga0070716_100589231 | Ga0070716_1005892312 | 118 |
| 173 | 3300006175 | Ga0070712_101528012 | Ga0070712_1015280121 | 118 |
| 174 | 3300006237 | Ga0097621_100523859 | Ga0097621_1005238592 | 118 |
| 175 | 3300006237 | Ga0097621_101152387 | Ga0097621_1011523872 | 118 |
| 176 | 3300006237 | Ga0097621_101620359 | Ga0097621_1016203592 | 118 |
| 177 | 3300006844 | Ga0075428_100013956 | Ga0075428_1000139564 | 118 |
| 178 | 3300006844 | Ga0075428_100033964 | Ga0075428_1000339649 | 118 |
| 179 | 3300006844 | Ga0075428_100249469 | Ga0075428_1002494693 | 118 |
| 180 | 3300006844 | Ga0075428_100273746 | Ga0075428_1002737462 | 118 |
| 181 | 3300006846 | Ga0075430_100006977 | Ga0075430_1000069777 | 118 |
| 182 | 3300006846 | Ga0075430_100044517 | Ga0075430_1000445173 | 118 |
| 183 | 3300006846 | Ga0075430_100051971 | Ga0075430_1000519714 | 118 |
| 184 | 3300006846 | Ga0075430_100094969 | Ga0075430_1000949696 | 118 |
| 185 | 3300006846 | Ga0075430_100337202 | Ga0075430_1003372023 | 118 |
| 186 | 3300006846 | Ga0075430_100364272 | Ga0075430_1003642723 | 118 |
| 187 | 3300006846 | Ga0075430_101322881 | Ga0075430_1013228812 | 118 |
| 188 | 3300006847 | Ga0075431_100020329 | Ga0075431_1000203296 | 118 |
| 189 | 3300006847 | Ga0075431_100110864 | Ga0075431_1001108644 | 118 |
| 190 | 3300006847 | Ga0075431_100126308 | Ga0075431_1001263085 | 118 |
| 191 | 3300006852 | Ga0075433_10000480 | Ga0075433_1000048028 | 118 |
| 192 | 3300006852 | Ga0075433_10020641 | Ga0075433_100206418 | 118 |
| 193 | 3300006852 | Ga0075433_10286274 | Ga0075433_102862743 | 118 |
| 194 | 3300006852 | Ga0075433_10383488 | Ga0075433_103834882 | 118 |
| 195 | 3300006852 | Ga0075433_10467997 | Ga0075433_104679972 | 118 |
| 196 | 3300006852 | Ga0075433_10598315 | Ga0075433_105983153 | 118 |
| 197 | 3300006852 | Ga0075433_10697675 | Ga0075433_106976752 | 118 |
| 198 | 3300006852 | Ga0075433_11414364 | Ga0075433_114143642 | 118 |
| 199 | 3300006871 | Ga0075434_100000079 | Ga0075434_10000007952 | 118 |
| 200 | 3300006871 | Ga0075434_100001287 | Ga0075434_10000128714 | 118 |
| 201 | 3300006871 | Ga0075434_100020461 | Ga0075434_1000204617 | 118 |
| 202 | 3300006871 | Ga0075434_100126328 | Ga0075434_1001263284 | 118 |
| 203 | 3300006871 | Ga0075434_100784007 | Ga0075434_1007840072 | 118 |
| 204 | 3300006871 | Ga0075434_100863928 | Ga0075434_1008639283 | 118 |
| 205 | 3300006871 | Ga0075434_101147703 | Ga0075434_1011477031 | 118 |
| 206 | 3300006880 | Ga0075429_100000100 | Ga0075429_10000010041 | 118 |
| 207 | 3300006880 | Ga0075429_100367967 | Ga0075429_1003679673 | 118 |
| 208 | 3300006880 | Ga0075429_100407123 | Ga0075429_1004071233 | 118 |
| 209 | 3300006880 | Ga0075429_100518442 | Ga0075429_1005184422 | 118 |
| 210 | 3300006881 | Ga0068865_100208955 | Ga0068865_1002089554 | 118 |
| 211 | 3300006881 | Ga0068865_101397972 | Ga0068865_1013979722 | 118 |
| 212 | 3300006881 | Ga0068865_101698018 | Ga0068865_1016980182 | 118 |
| 213 | 3300006914 | Ga0075436_100000529 | Ga0075436_1000005299 | 118 |
| 214 | 3300006914 | Ga0075436_100000789 | Ga0075436_1000007894 | 118 |
| 215 | 3300006914 | Ga0075436_100061499 | Ga0075436_1000614995 | 118 |
| 216 | 3300006914 | Ga0075436_100106581 | Ga0075436_1001065813 | 118 |
| 217 | 3300006914 | Ga0075436_100150487 | Ga0075436_1001504872 | 118 |
| 218 | 3300006931 | Ga0097620_100054593 | Ga0097620_1000545933 | 118 |
| 219 | 3300006931 | Ga0097620_100188154 | Ga0097620_1001881543 | 118 |
| 220 | 3300006931 | Ga0097620_100299041 | Ga0097620_1002990413 | 118 |
| 221 | 3300006931 | Ga0097620_100801326 | Ga0097620_1008013261 | 118 |
| 222 | 3300006931 | Ga0097620_100948861 | Ga0097620_1009488613 | 118 |
| 223 | 3300007076 | Ga0075435_100000655 | Ga0075435_10000065520 | 118 |
| 224 | 3300007076 | Ga0075435_100003904 | Ga0075435_1000039049 | 118 |
| 225 | 3300007076 | Ga0075435_100009301 | Ga0075435_1000093014 | 118 |
| 226 | 3300007076 | Ga0075435_100049195 | Ga0075435_1000491956 | 118 |
| 227 | 3300007076 | Ga0075435_102014928 | Ga0075435_1020149282 | 118 |
| 228 | 3300007265 | Ga0099794_10007992 | Ga0099794_100079923 | 118 |
| 229 | 3300007265 | Ga0099794_10022268 | Ga0099794_100222682 | 118 |
| 230 | 3300007788 | Ga0099795_10283253 | Ga0099795_102832532 | 118 |
| 231 | 3300007788 | Ga0099795_10418362 | Ga0099795_104183621 | 118 |
| 232 | 3300009092 | Ga0105250_10077252 | Ga0105250_100772523 | 118 |
| 233 | 3300009093 | Ga0105240_12356249 | Ga0105240_123562491 | 118 |
| 234 | 3300009094 | Ga0111539_10013498 | Ga0111539_100134989 | 118 |
| 235 | 3300009094 | Ga0111539_10029705 | Ga0111539_100297059 | 118 |
| 236 | 3300009094 | Ga0111539_10036478 | Ga0111539_100364789 | 118 |
| 237 | 3300009094 | Ga0111539_10155934 | Ga0111539_101559344 | 118 |
| 238 | 3300009094 | Ga0111539_10201316 | Ga0111539_102013162 | 118 |
| 239 | 3300009094 | Ga0111539_10310723 | Ga0111539_103107234 | 118 |
| 240 | 3300009094 | Ga0111539_10320185 | Ga0111539_103201854 | 118 |
| 241 | 3300009094 | Ga0111539_11099843 | Ga0111539_110998432 | 118 |
| 242 | 3300009094 | Ga0111539_11661899 | Ga0111539_116618992 | 118 |
| 243 | 3300009094 | Ga0111539_11863665 | Ga0111539_118636652 | 118 |
| 244 | 3300009094 | Ga0111539_11935591 | Ga0111539_119355912 | 118 |
| 245 | 3300009147 | Ga0114129_10011817 | Ga0114129_100118175 | 118 |
| 246 | 3300009147 | Ga0114129_10105488 | Ga0114129_101054885 | 118 |
| 247 | 3300009147 | Ga0114129_10610148 | Ga0114129_106101483 | 118 |
| 248 | 3300009147 | Ga0114129_11383659 | Ga0114129_113836592 | 118 |
| 249 | 3300009147 | Ga0114129_11614027 | Ga0114129_116140272 | 118 |
| 250 | 3300009147 | Ga0114129_11744730 | Ga0114129_117447302 | 118 |
| 251 | 3300009148 | Ga0105243_10181886 | Ga0105243_101818864 | 118 |
| 252 | 3300009148 | Ga0105243_12286481 | Ga0105243_122864812 | 118 |
| 253 | 3300009148 | Ga0105243_12664274 | Ga0105243_126642741 | 118 |
| 254 | 3300009177 | Ga0105248_10668234 | Ga0105248_106682342 | 118 |
| 255 | 3300009177 | Ga0105248_12906309 | Ga0105248_129063091 | 118 |
| 256 | 3300009553 | Ga0105249_10096280 | Ga0105249_100962805 | 118 |
| 257 | 3300009553 | Ga0105249_10102987 | Ga0105249_101029875 | 118 |
| 258 | 3300010159 | Ga0099796_10075186 | Ga0099796_100751862 | 118 |
| 259 | 3300010375 | Ga0105239_10172608 | Ga0105239_101726082 | 118 |
| 260 | 3300011119 | Ga0105246_11618355 | Ga0105246_116183552 | 118 |
| 261 | 3300013297 | Ga0157378_11028577 | Ga0157378_110285772 | 118 |
| 262 | 3300013306 | Ga0163162_10169104 | Ga0163162_101691042 | 118 |
| 263 | 3300013307 | Ga0157372_11064740 | Ga0157372_110647403 | 118 |
| 264 | 3300013307 | Ga0157372_11661021 | Ga0157372_116610212 | 118 |
| 265 | 3300013308 | Ga0157375_11533541 | Ga0157375_115335412 | 118 |
| 266 | 3300013308 | Ga0157375_12859398 | Ga0157375_128593982 | 118 |
| 267 | 3300014326 | Ga0157380_10122036 | Ga0157380_101220365 | 118 |
| 268 | 3300014326 | Ga0157380_10328451 | Ga0157380_103284512 | 118 |
| 269 | 3300014326 | Ga0157380_11248357 | Ga0157380_112483572 | 118 |
| 270 | 3300014745 | Ga0157377_10958053 | Ga0157377_109580532 | 118 |
| 271 | 3300014968 | Ga0157379_10109750 | Ga0157379_101097505 | 118 |
| 272 | 3300025885 | Ga0207653_10305872 | Ga0207653_103058721 | 118 |
| 273 | 3300025885 | Ga0207653_10399583 | Ga0207653_103995832 | 118 |
| 274 | 3300025898 | Ga0207692_10040663 | Ga0207692_100406634 | 118 |
| 275 | 3300025898 | Ga0207692_10240455 | Ga0207692_102404552 | 118 |
| 276 | 3300025899 | Ga0207642_10057496 | Ga0207642_100574962 | 118 |
| 277 | 3300025901 | Ga0207688_10179994 | Ga0207688_101799943 | 118 |
| 278 | 3300025905 | Ga0207685_10294079 | Ga0207685_102940792 | 118 |
| 279 | 3300025906 | Ga0207699_11114596 | Ga0207699_111145962 | 118 |
| 280 | 3300025907 | Ga0207645_10079638 | Ga0207645_100796384 | 118 |
| 281 | 3300025908 | Ga0207643_10234840 | Ga0207643_102348402 | 118 |
| 282 | 3300025910 | Ga0207684_10189827 | Ga0207684_101898273 | 118 |
| 283 | 3300025911 | Ga0207654_10740362 | Ga0207654_107403621 | 118 |
| 284 | 3300025912 | Ga0207707_10007590 | Ga0207707_100075908 | 118 |
| 285 | 3300025912 | Ga0207707_10174695 | Ga0207707_101746953 | 118 |
| 286 | 3300025916 | Ga0207663_11220927 | Ga0207663_112209271 | 118 |
| 287 | 3300025917 | Ga0207660_10135994 | Ga0207660_101359942 | 118 |
| 288 | 3300025917 | Ga0207660_10484147 | Ga0207660_104841472 | 118 |
| 289 | 3300025917 | Ga0207660_10584725 | Ga0207660_105847252 | 118 |
| 290 | 3300025918 | Ga0207662_10011539 | Ga0207662_100115397 | 118 |
| 291 | 3300025918 | Ga0207662_10439632 | Ga0207662_104396323 | 118 |
| 292 | 3300025918 | Ga0207662_10765445 | Ga0207662_107654452 | 118 |
| 293 | 3300025921 | Ga0207652_10063323 | Ga0207652_100633233 | 118 |
| 294 | 3300025921 | Ga0207652_10734118 | Ga0207652_107341182 | 118 |
| 295 | 3300025922 | Ga0207646_10034021 | Ga0207646_100340211 | 118 |
| 296 | 3300025922 | Ga0207646_11315685 | Ga0207646_113156852 | 118 |
| 297 | 3300025923 | Ga0207681_10002005 | Ga0207681_1000200514 | 118 |
| 298 | 3300025923 | Ga0207681_10554103 | Ga0207681_105541032 | 118 |
| 299 | 3300025924 | Ga0207694_10966997 | Ga0207694_109669972 | 118 |
| 300 | 3300025926 | Ga0207659_10039287 | Ga0207659_100392876 | 118 |
| 301 | 3300025928 | Ga0207700_10419794 | Ga0207700_104197941 | 118 |
| 302 | 3300025929 | Ga0207664_10211487 | Ga0207664_102114874 | 118 |
| 303 | 3300025933 | Ga0207706_10044590 | Ga0207706_100445906 | 118 |
| 304 | 3300025935 | Ga0207709_10009164 | Ga0207709_100091648 | 118 |
| 305 | 3300025935 | Ga0207709_10237095 | Ga0207709_102370952 | 118 |
| 306 | 3300025935 | Ga0207709_10708040 | Ga0207709_107080401 | 118 |
| 307 | 3300025935 | Ga0207709_10985346 | Ga0207709_109853462 | 118 |
| 308 | 3300025936 | Ga0207670_10051873 | Ga0207670_100518732 | 118 |
| 309 | 3300025936 | Ga0207670_10139389 | Ga0207670_101393894 | 118 |
| 310 | 3300025936 | Ga0207670_10642978 | Ga0207670_106429781 | 118 |
| 311 | 3300025936 | Ga0207670_10695374 | Ga0207670_106953742 | 118 |
| 312 | 3300025936 | Ga0207670_10813710 | Ga0207670_108137102 | 118 |
| 313 | 3300025936 | Ga0207670_11198060 | Ga0207670_111980602 | 118 |
| 314 | 3300025937 | Ga0207669_10043573 | Ga0207669_100435734 | 118 |
| 315 | 3300025938 | Ga0207704_10016097 | Ga0207704_100160974 | 118 |
| 316 | 3300025939 | Ga0207665_10155307 | Ga0207665_101553074 | 118 |
| 317 | 3300025939 | Ga0207665_10167973 | Ga0207665_101679734 | 118 |
| 318 | 3300025939 | Ga0207665_10587247 | Ga0207665_105872472 | 118 |
| 319 | 3300025940 | Ga0207691_10152795 | Ga0207691_101527953 | 118 |
| 320 | 3300025942 | Ga0207689_10080631 | Ga0207689_100806315 | 118 |
| 321 | 3300025942 | Ga0207689_10109005 | Ga0207689_101090054 | 118 |
| 322 | 3300025944 | Ga0207661_10072757 | Ga0207661_100727574 | 118 |
| 323 | 3300025949 | Ga0207667_10645454 | Ga0207667_106454542 | 118 |
| 324 | 3300025960 | Ga0207651_10042207 | Ga0207651_100422074 | 118 |
| 325 | 3300025961 | Ga0207712_10047143 | Ga0207712_100471433 | 118 |
| 326 | 3300025961 | Ga0207712_10270191 | Ga0207712_102701913 | 118 |
| 327 | 3300025961 | Ga0207712_10388852 | Ga0207712_103888522 | 118 |
| 328 | 3300025972 | Ga0207668_10057398 | Ga0207668_100573986 | 118 |
| 329 | 3300025981 | Ga0207640_10117957 | Ga0207640_101179573 | 118 |
| 330 | 3300026023 | Ga0207677_10115093 | Ga0207677_101150934 | 118 |
| 331 | 3300026035 | Ga0207703_10029223 | Ga0207703_100292238 | 118 |
| 332 | 3300026035 | Ga0207703_11033217 | Ga0207703_110332172 | 118 |
| 333 | 3300026075 | Ga0207708_10079581 | Ga0207708_100795813 | 118 |
| 334 | 3300026075 | Ga0207708_10093074 | Ga0207708_100930744 | 118 |
| 335 | 3300026075 | Ga0207708_10097048 | Ga0207708_100970482 | 118 |
| 336 | 3300026075 | Ga0207708_10257402 | Ga0207708_102574024 | 118 |
| 337 | 3300026078 | Ga0207702_11432171 | Ga0207702_114321712 | 118 |
| 338 | 3300026088 | Ga0207641_10510824 | Ga0207641_105108242 | 118 |
| 339 | 3300026088 | Ga0207641_10761805 | Ga0207641_107618053 | 118 |
| 340 | 3300026088 | Ga0207641_10882191 | Ga0207641_108821911 | 118 |
| 341 | 3300026089 | Ga0207648_10051799 | Ga0207648_100517994 | 118 |
| 342 | 3300026089 | Ga0207648_11061352 | Ga0207648_110613522 | 118 |
| 343 | 3300026095 | Ga0207676_10219315 | Ga0207676_102193153 | 118 |
| 344 | 3300026116 | Ga0207674_10099832 | Ga0207674_100998324 | 118 |
| 345 | 3300026116 | Ga0207674_10217411 | Ga0207674_102174114 | 118 |
| 346 | 3300026116 | Ga0207674_10752728 | Ga0207674_107527282 | 118 |
| 347 | 3300026118 | Ga0207675_100038588 | Ga0207675_1000385886 | 118 |
| 348 | 3300026118 | Ga0207675_100770057 | Ga0207675_1007700572 | 118 |
| 349 | 3300027360 | Ga0209969_1004244 | Ga0209969_10042442 | 118 |
| 350 | 3300027364 | Ga0209967_1005391 | Ga0209967_10053913 | 118 |
| 351 | 3300027364 | Ga0209967_1008205 | Ga0209967_10082053 | 118 |
| 352 | 3300027378 | Ga0209981_1000836 | Ga0209981_10008367 | 118 |
| 353 | 3300027378 | Ga0209981_1006379 | Ga0209981_10063794 | 118 |
| 354 | 3300027378 | Ga0209981_1022610 | Ga0209981_10226102 | 118 |
| 355 | 3300027395 | Ga0209996_1020278 | Ga0209996_10202782 | 118 |
| 356 | 3300027395 | Ga0209996_1048160 | Ga0209996_10481602 | 118 |
| 357 | 3300027462 | Ga0210000_1002454 | Ga0210000_10024544 | 118 |
| 358 | 3300027462 | Ga0210000_1003595 | Ga0210000_10035952 | 118 |
| 359 | 3300027462 | Ga0210000_1019850 | Ga0210000_10198502 | 118 |
| 360 | 3300027462 | Ga0210000_1061270 | Ga0210000_10612702 | 118 |
| 361 | 3300027471 | Ga0209995_1009323 | Ga0209995_10093232 | 118 |
| 362 | 3300027526 | Ga0209968_1005969 | Ga0209968_10059694 | 118 |
| 363 | 3300027543 | Ga0209999_1011623 | Ga0209999_10116234 | 118 |
| 364 | 3300027543 | Ga0209999_1016133 | Ga0209999_10161332 | 118 |
| 365 | 3300027543 | Ga0209999_1020350 | Ga0209999_10203502 | 118 |
| 366 | 3300027552 | Ga0209982_1007530 | Ga0209982_10075303 | 118 |
| 367 | 3300027614 | Ga0209970_1080269 | Ga0209970_10802692 | 118 |
| 368 | 3300027665 | Ga0209983_1022842 | Ga0209983_10228423 | 118 |
| 369 | 3300027671 | Ga0209588_1070846 | Ga0209588_10708463 | 118 |
| 370 | 3300027671 | Ga0209588_1093254 | Ga0209588_10932542 | 118 |
| 371 | 3300027682 | Ga0209971_1003692 | Ga0209971_10036924 | 118 |
| 372 | 3300027695 | Ga0209966_1005356 | Ga0209966_10053562 | 118 |
| 373 | 3300027695 | Ga0209966_1009473 | Ga0209966_10094733 | 118 |
| 374 | 3300027695 | Ga0209966_1097057 | Ga0209966_10970572 | 118 |
| 375 | 3300027876 | Ga0209974_10023970 | Ga0209974_100239704 | 118 |
| 376 | 3300027907 | Ga0207428_10025385 | Ga0207428_100253858 | 118 |
| 377 | 3300027907 | Ga0207428_10040931 | Ga0207428_100409314 | 118 |
| 378 | 3300027907 | Ga0207428_10131119 | Ga0207428_101311194 | 118 |
| 379 | 3300027907 | Ga0207428_10253196 | Ga0207428_102531962 | 118 |
| 380 | 3300027907 | Ga0207428_10840033 | Ga0207428_108400332 | 118 |
| 381 | 3300028380 | Ga0268265_10001159 | Ga0268265_1000115926 | 118 |
| 382 | 3300028380 | Ga0268265_10287607 | Ga0268265_102876072 | 118 |
| 383 | 3300028380 | Ga0268265_10290618 | Ga0268265_102906182 | 118 |
| 384 | 3300031548 | Ga0307408_100137592 | Ga0307408_1001375923 | 118 |
| 385 | 3300031548 | Ga0307408_100414914 | Ga0307408_1004149142 | 118 |
| 386 | 3300031548 | Ga0307408_100542108 | Ga0307408_1005421082 | 118 |
| 387 | 3300031731 | Ga0307405_10707397 | Ga0307405_107073972 | 118 |
| 388 | 3300031824 | Ga0307413_10276368 | Ga0307413_102763683 | 118 |
| 389 | 3300031824 | Ga0307413_10288608 | Ga0307413_102886082 | 118 |
| 390 | 3300031852 | Ga0307410_11263433 | Ga0307410_112634332 | 118 |
| 391 | 3300031901 | Ga0307406_10672945 | Ga0307406_106729452 | 118 |
| 392 | 3300031901 | Ga0307406_10770264 | Ga0307406_107702641 | 118 |
| 393 | 3300031903 | Ga0307407_10532386 | Ga0307407_105323862 | 118 |
| 394 | 3300031911 | Ga0307412_10328122 | Ga0307412_103281224 | 118 |
| 395 | 3300031911 | Ga0307412_11312247 | Ga0307412_113122472 | 118 |
| 396 | 3300031995 | Ga0307409_100370250 | Ga0307409_1003702503 | 118 |
| 397 | 3300032002 | Ga0307416_100084117 | Ga0307416_1000841172 | 118 |
| 398 | 3300032002 | Ga0307416_101331134 | Ga0307416_1013311342 | 118 |
| 399 | 3300032002 | Ga0307416_102261756 | Ga0307416_1022617562 | 118 |
| 400 | 3300032002 | Ga0307416_102642827 | Ga0307416_1026428272 | 118 |
| 401 | 3300032002 | Ga0307416_102759232 | Ga0307416_1027592322 | 118 |
| 402 | 3300032002 | Ga0307416_103120348 | Ga0307416_1031203481 | 118 |
| 403 | 3300032005 | Ga0307411_10031659 | Ga0307411_100316594 | 118 |
| 404 | 3300032005 | Ga0307411_10046102 | Ga0307411_100461026 | 118 |
| 405 | 3300032005 | Ga0307411_10538554 | Ga0307411_105385542 | 118 |
| 406 | 3300032126 | Ga0307415_101164953 | Ga0307415_1011649532 | 118 |
| 407 | 3300034820 | Ga0373959_0039589 | Ga0373959_0039589_338_700 | 118 |
| 408 | 3300034957 | Ga0373938_0014497 | Ga0373938_0014497_380_748 | 118 |
| 409 | 3300034957 | Ga0373938_0049865 | Ga0373938_0049865_565_927 | 118 |
| 410 | 3300035083 | Ga0373926_0029654 | Ga0373926_0029654_161_523 | 118 |
| 411 | 3300035092 | Ga0373952_0060084 | Ga0373952_0060084_293_655 | 118 |
| 412 | 3300035112 | Ga0373932_0198017 | Ga0373932_0198017_133_501 | 118 |
| 413 | 3300035113 | Ga0373936_0054593 | Ga0373936_0054593_299_661 | 118 |
| 414 | 3300035113 | Ga0373936_0117177 | Ga0373936_0117177_288_650 | 118 |
| 415 | 3300035114 | Ga0373939_0055492 | Ga0373939_0055492_701_1060 | 118 |
| 416 | 3300035114 | Ga0373939_0098681 | Ga0373939_0098681_316_675 | 118 |
| 417 | 3300035117 | Ga0373953_0028337 | Ga0373953_0028337_65_427 | 118 |
| 418 | 3300035117 | Ga0373953_0220347 | Ga0373953_0220347_140_499 | 118 |
| 419 | 3300035118 | Ga0373954_0001511 | Ga0373954_0001511_7901_8275 | 118 |
| 420 | 3300035119 | Ga0373956_0165188 | Ga0373956_0165188_272_631 | 118 |
| 421 | 3300035121 | Ga0373960_0053316 | Ga0373960_0053316_610_978 | 118 |
| 422 | 3300035121 | Ga0373960_0115977 | Ga0373960_0115977_49_411 | 118 |
| 423 | 3300035121 | Ga0373960_0186225 | Ga0373960_0186225_126_482 | 118 |
| 424 | 3300035172 | Ga0373955_0003334 | Ga0373955_0003334_3408_3770 | 118 |
| 425 | 3300035172 | Ga0373955_0127557 | Ga0373955_0127557_684_1058 | 118 |
| 426 | 3300035172 | Ga0373955_0548087 | Ga0373955_0548087_247_606 | 118 |
| 427 | 3300035207 | Ga0373942_0002391 | Ga0373942_0002391_3230_3604 | 118 |
| 428 | 3300035241 | Ga0373961_0015462 | Ga0373961_0015462_854_1222 | 118 |
| 429 | 3300035241 | Ga0373961_0020738 | Ga0373961_0020738_1273_1635 | 118 |
| 430 | 3300035410 | Ga0373924_0043921 | Ga0373924_0043921_565_927 | 118 |
| 431 | 3300035410 | Ga0373924_0094759 | Ga0373924_0094759_779_1141 | 118 |
| 432 | 3300035691 | Ga0373931_0008167 | Ga0373931_0008167_1257_1619 | 118 |
| 433 | 3300035691 | Ga0373931_0674708 | Ga0373931_0674708_247_606 | 118 |
| 434 | 3300035692 | Ga0373935_0572217 | Ga0373935_0572217_137_496 | 118 |
| 435 | 3300035724 | Ga0373933_0011855 | Ga0373933_0011855_1511_1873 | 118 |
| 436 | 3300035724 | Ga0373933_0018495 | Ga0373933_0018495_2575_2949 | 118 |
| 437 | 3300035724 | Ga0373933_0359974 | Ga0373933_0359974_223_582 | 118 |
| 438 | 3300035725 | Ga0373947_0058905 | Ga0373947_0058905_602_964 | 118 |
| 439 | 3300036401 | Ga0373937_0001313 | Ga0373937_0001313_4049_4423 | 118 |
| 440 | 3300036401 | Ga0373937_0019027 | Ga0373937_0019027_3781_4140 | 118 |
| 441 | 3300036401 | Ga0373937_0033470 | Ga0373937_0033470_3914_4276 | 118 |
| 442 | 3300036401 | Ga0373937_0117971 | Ga0373937_0117971_454_828 | 118 |
| 443 | 3300037068 | Ga0373925_0059535 | Ga0373925_0059535_103_465 | 118 |
| 444 | 3300039437 | Ga0436365_1920613 | Ga0436365_1920613_88_447 | 118 |
| 445 | 3300041406 | Ga0439439_0058260 | Ga0439439_0058260_384_755 | 118 |
| 446 | 3300041408 | Ga0439453_0035069 | Ga0439453_0035069_145_516 | 118 |
| 447 | 3300041410 | Ga0439461_0098261 | Ga0439461_0098261_283_642 | 118 |
| 448 | 3300041460 | Ga0451802_0106108 | Ga0451802_0106108_84_446 | 118 |
| 449 | 3300041496 | Ga0451839_0301690 | Ga0451839_0301690_179_535 | 118 |
| 450 | 3300042001 | Ga0439441_000219 | Ga0439441_000219_4162_4533 | 118 |
| 451 | 3300042001 | Ga0439441_148769 | Ga0439441_148769_99_470 | 118 |
| 452 | 3300042003 | Ga0439443_016332 | Ga0439443_016332_578_949 | 118 |
| 453 | 3300042003 | Ga0439443_050491 | Ga0439443_050491_274_645 | 118 |
| 454 | 3300042011 | Ga0439454_035451 | Ga0439454_035451_415_786 | 118 |
| 455 | 3300042013 | Ga0439456_012653 | Ga0439456_012653_582_953 | 118 |
| 456 | 3300042125 | Ga0450923_094551 | Ga0450923_094551_141_512 | 118 |
| 457 | 3300042156 | Ga0439446_0029196 | Ga0439446_0029196_300_659 | 118 |
| 458 | 3300042156 | Ga0439446_0105136 | Ga0439446_0105136_513_884 | 118 |
| 459 | 3300042435 | Ga0439434_0000867 | Ga0439434_0000867_3730_4089 | 118 |
| 460 | 3300042435 | Ga0439434_0073656 | Ga0439434_0073656_236_595 | 118 |
| 461 | 3300042435 | Ga0439434_0274291 | Ga0439434_0274291_39_410 | 118 |
| 462 | 3300042436 | Ga0439435_0007268 | Ga0439435_0007268_1646_2005 | 118 |
| 463 | 3300042437 | Ga0439444_0003897 | Ga0439444_0003897_41_412 | 118 |
| 464 | 3300042438 | Ga0439459_0081256 | Ga0439459_0081256_98_460 | 118 |
| 465 | 3300042461 | Ga0439460_0058644 | Ga0439460_0058644_336_707 | 118 |
| 466 | 3300042532 | Ga0450893_0068260 | Ga0450893_0068260_301_672 | 118 |
| 467 | 3300042876 | Ga0451577_0642743 | Ga0451577_0642743_446_805 | 118 |
| 468 | 3300042876 | Ga0451577_1385759 | Ga0451577_1385759_189_548 | 118 |
| 469 | 3300044673 | Ga0453683_0541986 | Ga0453683_0541986_319_678 | 118 |
| 470 | 3300044673 | Ga0453683_0930934 | Ga0453683_0930934_171_530 | 118 |
| 471 | 3300044694 | Ga0466963_0246298 | Ga0466963_0246298_192_557 | 118 |
| 472 | 3300044901 | Ga0466960_0068503 | Ga0466960_0068503_238_594 | 118 |
| 473 | 3300044901 | Ga0466960_0344018 | Ga0466960_0344018_111_470 | 118 |
| 474 | 3300045051 | Ga0451576_0106040 | Ga0451576_0106040_355_714 | 118 |
| 475 | 3300045051 | Ga0451576_0136400 | Ga0451576_0136400_923_1282 | 118 |
| 476 | 3300045051 | Ga0451576_0226550 | Ga0451576_0226550_1219_1581 | 118 |
| 477 | 3300045051 | Ga0451576_0226592 | Ga0451576_0226592_267_629 | 118 |
| 478 | 3300045051 | Ga0451576_2413427 | Ga0451576_2413427_49_411 | 118 |
| 479 | 3300045836 | Ga0466958_0076169 | Ga0466958_0076169_80_445 | 118 |
| 480 | 3300045976 | Ga0466967_0008116 | Ga0466967_0008116_4914_5279 | 118 |
| 481 | 3300046454 | Ga0495592_0695869 | Ga0495592_0695869_106_465 | 118 |
| 482 | 3300046455 | Ga0495603_0238847 | Ga0495603_0238847_603_974 | 118 |
| 483 | 3300046457 | Ga0495590_0354744 | Ga0495590_0354744_13_369 | 118 |
| 484 | 3300046459 | Ga0495629_0060679 | Ga0495629_0060679_110_469 | 118 |
| 485 | 3300046462 | Ga0495651_0165640 | Ga0495651_0165640_246_605 | 118 |
| 486 | 3300046476 | Ga0495662_0031220 | Ga0495662_0031220_617_976 | 118 |
| 487 | 3300046476 | Ga0495662_0138463 | Ga0495662_0138463_56_418 | 118 |
| 488 | 3300046491 | Ga0495584_0050854 | Ga0495584_0050854_329_700 | 118 |
| 489 | 3300046491 | Ga0495584_0087837 | Ga0495584_0087837_650_1009 | 118 |
| 490 | 3300046491 | Ga0495584_0249144 | Ga0495584_0249144_449_808 | 118 |
| 491 | 3300046511 | Ga0495608_0000767 | Ga0495608_0000767_6371_6730 | 118 |
| 492 | 3300046511 | Ga0495608_0310669 | Ga0495608_0310669_10_384 | 118 |
| 493 | 3300046514 | Ga0495618_0033918 | Ga0495618_0033918_170_529 | 118 |
| 494 | 3300046516 | Ga0495628_0003354 | Ga0495628_0003354_4836_5195 | 118 |
| 495 | 3300046516 | Ga0495628_0536684 | Ga0495628_0536684_217_576 | 118 |
| 496 | 3300046517 | Ga0495630_0020245 | Ga0495630_0020245_1803_2162 | 118 |
| 497 | 3300046523 | Ga0495644_0096494 | Ga0495644_0096494_530_904 | 118 |
| 498 | 3300046526 | Ga0495666_0005319 | Ga0495666_0005319_3977_4336 | 118 |
| 499 | 3300046528 | Ga0495642_0091091 | Ga0495642_0091091_87_446 | 118 |
| 500 | 3300046528 | Ga0495642_0108562 | Ga0495642_0108562_11_370 | 118 |
| 501 | 3300046529 | Ga0495652_0595961 | Ga0495652_0595961_248_607 | 118 |
| 502 | 3300046533 | Ga0495640_0013075 | Ga0495640_0013075_2195_2554 | 118 |
| 503 | 3300046533 | Ga0495640_0024651 | Ga0495640_0024651_240_599 | 118 |
| 504 | 3300046535 | Ga0495586_0020862 | Ga0495586_0020862_2542_2901 | 118 |
| 505 | 3300046536 | Ga0495587_0028889 | Ga0495587_0028889_1101_1460 | 118 |
| 506 | 3300046538 | Ga0495609_0179220 | Ga0495609_0179220_300_659 | 118 |
| 507 | 3300046543 | Ga0495645_0028191 | Ga0495645_0028191_2147_2506 | 118 |
| 508 | 3300046559 | Ga0495667_0014877 | Ga0495667_0014877_2596_2955 | 118 |
| 509 | 3300046559 | Ga0495667_0120746 | Ga0495667_0120746_897_1259 | 118 |
| 510 | 3300046642 | Ga0495634_0004750 | Ga0495634_0004750_1808_2167 | 118 |
| 511 | 3300046663 | Ga0495635_0075811 | Ga0495635_0075811_1837_2196 | 118 |
| 512 | 3300046663 | Ga0495635_0098814 | Ga0495635_0098814_759_1121 | 118 |
| 513 | 3300046664 | Ga0495659_0149090 | Ga0495659_0149090_473_832 | 118 |
| 514 | 3300046664 | Ga0495659_0232069 | Ga0495659_0232069_270_629 | 118 |
| 515 | 3300046664 | Ga0495659_0274160 | Ga0495659_0274160_233_592 | 118 |
| 516 | 3300046675 | Ga0495657_0350814 | Ga0495657_0350814_309_671 | 118 |
| 517 | 3300046678 | Ga0495599_0094489 | Ga0495599_0094489_1286_1645 | 118 |
| 518 | 3300046679 | Ga0495623_0097921 | Ga0495623_0097921_1095_1454 | 118 |
| 519 | 3300046679 | Ga0495623_0402531 | Ga0495623_0402531_52_414 | 118 |
| 520 | 3300046680 | Ga0495646_0255191 | Ga0495646_0255191_135_494 | 118 |
| 521 | 3300046683 | Ga0495658_0033007 | Ga0495658_0033007_2195_2554 | 118 |
| 522 | 3300046684 | Ga0495669_0016877 | Ga0495669_0016877_1305_1664 | 118 |
| 523 | 3300046684 | Ga0495669_0081557 | Ga0495669_0081557_560_931 | 118 |
| 524 | 3300046684 | Ga0495669_0168285 | Ga0495669_0168285_316_672 | 118 |
| 525 | 3300046689 | Ga0495613_0027811 | Ga0495613_0027811_1472_1831 | 118 |
| 526 | 3300046690 | Ga0495624_0051034 | Ga0495624_0051034_929_1288 | 118 |
| 527 | 3300046692 | Ga0495671_0604241 | Ga0495671_0604241_40_411 | 118 |
| 528 | 3300046809 | Ga0495600_0014090 | Ga0495600_0014090_2355_2714 | 118 |
| 529 | 3300046809 | Ga0495600_0780057 | Ga0495600_0780057_169_528 | 118 |
| 530 | 3300047317 | Ga0495604_0003259 | Ga0495604_0003259_10744_11103 | 118 |
| 531 | 3300047317 | Ga0495604_0115359 | Ga0495604_0115359_491_850 | 118 |
| 532 | 3300047317 | Ga0495604_0165596 | Ga0495604_0165596_335_697 | 118 |
| 533 | 3300047317 | Ga0495604_0858958 | Ga0495604_0858958_76_450 | 118 |
| 534 | 3300047318 | Ga0495636_0017357 | Ga0495636_0017357_2128_2487 | 118 |
| 535 | 3300047319 | Ga0495674_0164174 | Ga0495674_0164174_1297_1656 | 118 |
| 536 | 3300047322 | Ga0495680_0007743 | Ga0495680_0007743_6765_7124 | 118 |
| 537 | 3300047322 | Ga0495680_0182929 | Ga0495680_0182929_482_844 | 118 |
| 538 | 3300049513 | Ga0501290_028777 | Ga0501290_028777_271_630 | 118 |
| 539 | 3300049513 | Ga0501290_056162 | Ga0501290_056162_16_375 | 118 |
| 540 | 3300049514 | Ga0501291_051778 | Ga0501291_051778_153_512 | 118 |
| 541 | 3300049514 | Ga0501291_155202 | Ga0501291_155202_94_453 | 118 |
| 542 | 3300049519 | Ga0501296_024027 | Ga0501296_024027_335_694 | 118 |
| 543 | 3300049522 | Ga0501299_017791 | Ga0501299_017791_134_505 | 118 |
| 544 | 3300049568 | Ga0501031_0071786 | Ga0501031_0071786_1453_1815 | 118 |
| 545 | 3300049568 | Ga0501031_0259271 | Ga0501031_0259271_372_731 | 118 |
| 546 | 3300049569 | Ga0501032_0117810 | Ga0501032_0117810_1156_1518 | 118 |
| 547 | 3300049570 | Ga0501033_0038508 | Ga0501033_0038508_288_650 | 118 |
| 548 | 3300049570 | Ga0501033_0248006 | Ga0501033_0248006_34_405 | 118 |
| 549 | 3300049572 | Ga0501036_0098691 | Ga0501036_0098691_1094_1456 | 118 |
| 550 | 3300049572 | Ga0501036_0399362 | Ga0501036_0399362_528_899 | 118 |
| 551 | 3300049572 | Ga0501036_0706092 | Ga0501036_0706092_54_425 | 118 |
| 552 | 3300049573 | Ga0501037_0077355 | Ga0501037_0077355_1733_2095 | 118 |
| 553 | 3300049573 | Ga0501037_0276465 | Ga0501037_0276465_622_981 | 118 |
| 554 | 3300049573 | Ga0501037_0292492 | Ga0501037_0292492_236_607 | 118 |
| 555 | 3300049574 | Ga0501038_0012391 | Ga0501038_0012391_1317_1679 | 118 |
| 556 | 3300049575 | Ga0501039_0028433 | Ga0501039_0028433_133_504 | 118 |
| 557 | 3300049575 | Ga0501039_0048062 | Ga0501039_0048062_1146_1541 | 118 |
| 558 | 3300049575 | Ga0501039_0066519 | Ga0501039_0066519_1240_1602 | 118 |
| 559 | 3300049575 | Ga0501039_0953095 | Ga0501039_0953095_135_491 | 118 |
| 560 | 3300049576 | Ga0501040_0004390 | Ga0501040_0004390_7086_7448 | 118 |
| 561 | 3300049576 | Ga0501040_0309215 | Ga0501040_0309215_540_899 | 118 |
| 562 | 3300049577 | Ga0501041_0026263 | Ga0501041_0026263_63_422 | 118 |
| 563 | 3300049577 | Ga0501041_0028785 | Ga0501041_0028785_1402_1764 | 118 |
| 564 | 3300049577 | Ga0501041_0168708 | Ga0501041_0168708_735_1094 | 118 |
| 565 | 3300049578 | Ga0501042_0003021 | Ga0501042_0003021_5423_5785 | 118 |
| 566 | 3300049578 | Ga0501042_0342532 | Ga0501042_0342532_554_913 | 118 |
| 567 | 3300049578 | Ga0501042_0371039 | Ga0501042_0371039_386_757 | 118 |
| 568 | 3300049578 | Ga0501042_0847043 | Ga0501042_0847043_186_548 | 118 |
| 569 | 3300049579 | Ga0501043_0039549 | Ga0501043_0039549_3088_3450 | 118 |
| 570 | 3300049579 | Ga0501043_1234851 | Ga0501043_1234851_45_404 | 118 |
| 571 | 3300049580 | Ga0501046_0003243 | Ga0501046_0003243_4438_4800 | 118 |
| 572 | 3300049580 | Ga0501046_0025733 | Ga0501046_0025733_3417_3788 | 118 |
| 573 | 3300049580 | Ga0501046_0194088 | Ga0501046_0194088_1113_1472 | 118 |
| 574 | 3300049580 | Ga0501046_0315807 | Ga0501046_0315807_54_413 | 118 |
| 575 | 3300049582 | Ga0501048_0007325 | Ga0501048_0007325_2892_3254 | 118 |
| 576 | 3300049582 | Ga0501048_0095589 | Ga0501048_0095589_1336_1707 | 118 |
| 577 | 3300049582 | Ga0501048_0255963 | Ga0501048_0255963_760_1131 | 118 |
| 578 | 3300049582 | Ga0501048_0294256 | Ga0501048_0294256_640_999 | 118 |
| 579 | 3300049583 | Ga0501067_0284097 | Ga0501067_0284097_234_590 | 118 |
| 580 | 3300049583 | Ga0501067_0523826 | Ga0501067_0523826_97_456 | 118 |
| 581 | 3300049584 | Ga0501068_0002746 | Ga0501068_0002746_5962_6324 | 118 |
| 582 | 3300049584 | Ga0501068_0181367 | Ga0501068_0181367_314_673 | 118 |
| 583 | 3300049584 | Ga0501068_0325359 | Ga0501068_0325359_187_549 | 118 |
| 584 | 3300049585 | Ga0501069_0024556 | Ga0501069_0024556_657_1013 | 118 |
| 585 | 3300049585 | Ga0501069_0290424 | Ga0501069_0290424_332_688 | 118 |
| 586 | 3300049585 | Ga0501069_0538260 | Ga0501069_0538260_219_575 | 118 |
| 587 | 3300049586 | Ga0501070_0086060 | Ga0501070_0086060_563_925 | 118 |
| 588 | 3300049586 | Ga0501070_0730260 | Ga0501070_0730260_195_554 | 118 |
| 589 | 3300049587 | Ga0501071_0005475 | Ga0501071_0005475_1547_1906 | 118 |
| 590 | 3300049587 | Ga0501071_0018923 | Ga0501071_0018923_1438_1800 | 118 |
| 591 | 3300049587 | Ga0501071_0029827 | Ga0501071_0029827_2116_2487 | 118 |
| 592 | 3300049587 | Ga0501071_0237264 | Ga0501071_0237264_115_474 | 118 |
| 593 | 3300049587 | Ga0501071_0252574 | Ga0501071_0252574_826_1221 | 118 |
| 594 | 3300049587 | Ga0501071_0352656 | Ga0501071_0352656_451_810 | 118 |
| 595 | 3300049587 | Ga0501071_0387803 | Ga0501071_0387803_473_832 | 118 |
| 596 | 3300049587 | Ga0501071_0775939 | Ga0501071_0775939_141_500 | 118 |
| 597 | 3300049588 | Ga0501072_0007949 | Ga0501072_0007949_3115_3486 | 118 |
| 598 | 3300049588 | Ga0501072_0011492 | Ga0501072_0011492_2232_2594 | 118 |
| 599 | 3300049588 | Ga0501072_0019791 | Ga0501072_0019791_255_614 | 118 |
| 600 | 3300049588 | Ga0501072_0032348 | Ga0501072_0032348_1759_2130 | 118 |
| 601 | 3300049588 | Ga0501072_0106058 | Ga0501072_0106058_1845_2216 | 118 |
| 602 | 3300049588 | Ga0501072_0455327 | Ga0501072_0455327_319_678 | 118 |
| 603 | 3300049588 | Ga0501072_0783434 | Ga0501072_0783434_338_697 | 118 |
| 604 | 3300049589 | Ga0501073_0081968 | Ga0501073_0081968_1240_1626 | 118 |
| 605 | 3300049589 | Ga0501073_0567593 | Ga0501073_0567593_292_663 | 118 |
| 606 | 3300049589 | Ga0501073_0831295 | Ga0501073_0831295_137_505 | 118 |
| 607 | 3300049590 | Ga0501074_0022089 | Ga0501074_0022089_1321_1683 | 118 |
| 608 | 3300049590 | Ga0501074_0060359 | Ga0501074_0060359_670_1041 | 118 |
| 609 | 3300049591 | Ga0501075_0002198 | Ga0501075_0002198_328_699 | 118 |
| 610 | 3300049591 | Ga0501075_0004962 | Ga0501075_0004962_5537_5899 | 118 |
| 611 | 3300049591 | Ga0501075_0158338 | Ga0501075_0158338_176_535 | 118 |
| 612 | 3300049591 | Ga0501075_1092638 | Ga0501075_1092638_110_469 | 118 |
| 613 | 3300049591 | Ga0501075_1111525 | Ga0501075_1111525_196_558 | 118 |
| 614 | 3300049592 | Ga0501076_0000429 | Ga0501076_0000429_599_994 | 118 |
| 615 | 3300049592 | Ga0501076_0023753 | Ga0501076_0023753_2610_2972 | 118 |
| 616 | 3300049592 | Ga0501076_0037359 | Ga0501076_0037359_514_873 | 118 |
| 617 | 3300049592 | Ga0501076_0828663 | Ga0501076_0828663_52_411 | 118 |
| 618 | 3300049592 | Ga0501076_0948510 | Ga0501076_0948510_52_411 | 118 |
| 619 | 3300049592 | Ga0501076_1447674 | Ga0501076_1447674_178_537 | 118 |
| 620 | 3300049593 | Ga0501077_0022192 | Ga0501077_0022192_95_457 | 118 |
| 621 | 3300049593 | Ga0501077_0223566 | Ga0501077_0223566_294_665 | 118 |
| 622 | 3300049741 | Ga0501079_0021474 | Ga0501079_0021474_224_583 | 118 |
| 623 | 3300049741 | Ga0501079_0041234 | Ga0501079_0041234_1716_2078 | 118 |
| 624 | 3300049741 | Ga0501079_0095219 | Ga0501079_0095219_788_1159 | 118 |
| 625 | 3300049741 | Ga0501079_0438437 | Ga0501079_0438437_615_986 | 118 |
| 626 | 3300049742 | Ga0501080_0000634 | Ga0501080_0000634_7409_7768 | 118 |
| 627 | 3300049742 | Ga0501080_0018543 | Ga0501080_0018543_5655_6026 | 118 |
| 628 | 3300049742 | Ga0501080_0034438 | Ga0501080_0034438_1267_1629 | 118 |
| 629 | 3300049742 | Ga0501080_0257367 | Ga0501080_0257367_895_1257 | 118 |
| 630 | 3300049743 | Ga0501081_0007073 | Ga0501081_0007073_3528_3899 | 118 |
| 631 | 3300049743 | Ga0501081_0025861 | Ga0501081_0025861_2354_2716 | 118 |
| 632 | 3300049743 | Ga0501081_0300506 | Ga0501081_0300506_634_993 | 118 |
| 633 | 3300049744 | Ga0501083_1150845 | Ga0501083_1150845_126_485 | 118 |
| 634 | 3300049770 | Ga0501273_029267 | Ga0501273_029267_117_476 | 118 |
| 635 | 3300049779 | Ga0501283_040433 | Ga0501283_040433_324_683 | 118 |
| 636 | 3300049822 | Ga0501035_0343165 | Ga0501035_0343165_721_1092 | 118 |
| 637 | 3300049823 | Ga0501044_0117696 | Ga0501044_0117696_906_1268 | 118 |
| 638 | 3300049824 | Ga0501045_0038739 | Ga0501045_0038739_1814_2176 | 118 |
| 639 | 3300049824 | Ga0501045_0866118 | Ga0501045_0866118_87_458 | 118 |
| 640 | 3300050507 | nmdc:mga05p37_1255_c1 | nmdc:mga05p37_1255_c1_7421_7783 | 118 |
| 641 | 3300050507 | nmdc:mga05p37_326471_c1 | nmdc:mga05p37_326471_c1_24_386 | 118 |
| 642 | 3300050507 | nmdc:mga05p37_46253_c1 | nmdc:mga05p37_46253_c1_3955_4317 | 118 |
| 643 | 3300050507 | nmdc:mga05p37_543024_c1 | nmdc:mga05p37_543024_c1_244_615 | 118 |
| 644 | 3300050507 | nmdc:mga05p37_557944_c1 | nmdc:mga05p37_557944_c1_295_666 | 118 |
| 645 | 3300050507 | nmdc:mga05p37_896453_c1 | nmdc:mga05p37_896453_c1_480_851 | 118 |
| 646 | 3300050508 | nmdc:mga09592_109_c1 | nmdc:mga09592_109_c1_15730_16092 | 118 |
| 647 | 3300050508 | nmdc:mga09592_120181_c1 | nmdc:mga09592_120181_c1_373_741 | 118 |
| 648 | 3300050508 | nmdc:mga09592_160785_c1 | nmdc:mga09592_160785_c1_325_684 | 118 |
| 649 | 3300050508 | nmdc:mga09592_51500_c1 | nmdc:mga09592_51500_c1_1890_2261 | 118 |
| 650 | 3300050509 | nmdc:mga0qj67_139878_c1 | nmdc:mga0qj67_139878_c1_1507_1878 | 118 |
| 651 | 3300050509 | nmdc:mga0qj67_2200_c1 | nmdc:mga0qj67_2200_c1_3180_3539 | 118 |
| 652 | 3300050509 | nmdc:mga0qj67_38319_c1 | nmdc:mga0qj67_38319_c1_1713_2081 | 118 |
| 653 | 3300050509 | nmdc:mga0qj67_448253_c1 | nmdc:mga0qj67_448253_c1_62_421 | 118 |
| 654 | 3300050509 | nmdc:mga0qj67_631194_c1 | nmdc:mga0qj67_631194_c1_195_554 | 118 |
| 655 | 3300050509 | nmdc:mga0qj67_6675_c1 | nmdc:mga0qj67_6675_c1_1825_2196 | 118 |
| 656 | 3300050509 | nmdc:mga0qj67_715935_c1 | nmdc:mga0qj67_715935_c1_260_631 | 118 |
| 657 | 3300050510 | nmdc:mga06r32_151321_c1 | nmdc:mga06r32_151321_c1_796_1155 | 118 |
| 658 | 3300050510 | nmdc:mga06r32_296652_c1 | nmdc:mga06r32_296652_c1_711_1070 | 118 |
| 659 | 3300050510 | nmdc:mga06r32_328435_c1 | nmdc:mga06r32_328435_c1_854_1213 | 118 |
| 660 | 3300050510 | nmdc:mga06r32_392232_c1 | nmdc:mga06r32_392232_c1_608_979 | 118 |
| 661 | 3300050510 | nmdc:mga06r32_7661_c1 | nmdc:mga06r32_7661_c1_1367_1729 | 118 |
| 662 | 3300050511 | nmdc:mga08y16_10670_c1 | nmdc:mga08y16_10670_c1_6397_6756 | 118 |
| 663 | 3300050511 | nmdc:mga08y16_124577_c1 | nmdc:mga08y16_124577_c1_837_1196 | 118 |
| 664 | 3300050511 | nmdc:mga08y16_1390157_c1 | nmdc:mga08y16_1390157_c1_115_474 | 118 |
| 665 | 3300050511 | nmdc:mga08y16_1392374_c1 | nmdc:mga08y16_1392374_c1_269_628 | 118 |
| 666 | 3300050511 | nmdc:mga08y16_205809_c1 | nmdc:mga08y16_205809_c1_1085_1444 | 118 |
| 667 | 3300050511 | nmdc:mga08y16_58461_c1 | nmdc:mga08y16_58461_c1_2340_2711 | 118 |
| 668 | 3300050511 | nmdc:mga08y16_624448_c1 | nmdc:mga08y16_624448_c1_300_659 | 118 |
| 669 | 3300050511 | nmdc:mga08y16_660425_c1 | nmdc:mga08y16_660425_c1_214_588 | 118 |
| 670 | 3300050511 | nmdc:mga08y16_73557_c1 | nmdc:mga08y16_73557_c1_1944_2303 | 118 |
| 671 | 3300050511 | nmdc:mga08y16_805050_c1 | nmdc:mga08y16_805050_c1_479_850 | 118 |
| 672 | 3300050511 | nmdc:mga08y16_85617_c1 | nmdc:mga08y16_85617_c1_1844_2215 | 118 |
| 673 | 3300050512 | nmdc:mga0n895_12039_c1 | nmdc:mga0n895_12039_c1_516_887 | 118 |
| 674 | 3300050512 | nmdc:mga0n895_734_c1 | nmdc:mga0n895_734_c1_3926_4288 | 118 |
| 675 | 3300050512 | nmdc:mga0n895_741372_c1 | nmdc:mga0n895_741372_c1_200_559 | 118 |
| 676 | 3300050512 | nmdc:mga0n895_749808_c1 | nmdc:mga0n895_749808_c1_83_439 | 118 |
| 677 | 3300050512 | nmdc:mga0n895_787149_c1 | nmdc:mga0n895_787149_c1_96_455 | 118 |
| 678 | 3300050512 | nmdc:mga0n895_7924_c1 | nmdc:mga0n895_7924_c1_5209_5580 | 118 |
| 679 | 3300050513 | nmdc:mga0rr50_135268_c1 | nmdc:mga0rr50_135268_c1_1151_1510 | 118 |
| 680 | 3300050513 | nmdc:mga0rr50_2416_c1 | nmdc:mga0rr50_2416_c1_5255_5617 | 118 |
| 681 | 3300050513 | nmdc:mga0rr50_3670_c1 | nmdc:mga0rr50_3670_c1_4781_5152 | 118 |
| 682 | 3300050513 | nmdc:mga0rr50_509898_c1 | nmdc:mga0rr50_509898_c1_342_713 | 118 |
| 683 | 3300050513 | nmdc:mga0rr50_647896_c1 | nmdc:mga0rr50_647896_c1_252_611 | 118 |
| 684 | 3300050513 | nmdc:mga0rr50_92416_c1 | nmdc:mga0rr50_92416_c1_1762_2124 | 118 |
| 685 | 3300050514 | nmdc:mga08x19_1688_c1 | nmdc:mga08x19_1688_c1_9356_9712 | 118 |
| 686 | 3300050514 | nmdc:mga08x19_193748_c1 | nmdc:mga08x19_193748_c1_816_1187 | 118 |
| 687 | 3300050514 | nmdc:mga08x19_258_c1 | nmdc:mga08x19_258_c1_11452_11811 | 118 |
| 688 | 3300050514 | nmdc:mga08x19_41543_c1 | nmdc:mga08x19_41543_c1_1918_2280 | 118 |
| 689 | 3300050514 | nmdc:mga08x19_415502_c1 | nmdc:mga08x19_415502_c1_312_671 | 118 |
| 690 | 3300050514 | nmdc:mga08x19_71597_c1 | nmdc:mga08x19_71597_c1_728_1099 | 118 |
| 691 | 3300050515 | nmdc:mga0a205_1601770_c1 | nmdc:mga0a205_1601770_c1_24_380 | 118 |
| 692 | 3300050515 | nmdc:mga0a205_169979_c1 | nmdc:mga0a205_169979_c1_259_621 | 118 |
| 693 | 3300050515 | nmdc:mga0a205_174980_c1 | nmdc:mga0a205_174980_c1_1177_1536 | 118 |
| 694 | 3300050515 | nmdc:mga0a205_20918_c1 | nmdc:mga0a205_20918_c1_3776_4147 | 118 |
| 695 | 3300050515 | nmdc:mga0a205_783914_c1 | nmdc:mga0a205_783914_c1_67_429 | 118 |
| 696 | 3300050515 | nmdc:mga0a205_94583_c1 | nmdc:mga0a205_94583_c1_583_945 | 118 |
| 697 | 3300053077 | Ga0495601_0031047 | Ga0495601_0031047_2668_3027 | 118 |
| 698 | 3300054114 | Ga0501084_0005520 | Ga0501084_0005520_1592_1954 | 118 |
| 699 | 3300054114 | Ga0501084_0015444 | Ga0501084_0015444_2997_3368 | 118 |
| 700 | 3300054114 | Ga0501084_0108528 | Ga0501084_0108528_717_1076 | 118 |
| 701 | 3300054114 | Ga0501084_0254343 | Ga0501084_0254343_846_1208 | 118 |
| 702 | 3300059421 | Ga0590071_110935 | Ga0590071_110935_115_474 | 118 |
| 703 | 3300059421 | Ga0590071_200354 | Ga0590071_200354_115_474 | 118 |
| 704 | 3300060353 | Ga0501082_0029179 | Ga0501082_0029179_3498_3860 | 118 |
| 705 | 3300060353 | Ga0501082_0078152 | Ga0501082_0078152_1019_1414 | 118 |
| 706 | 3300060353 | Ga0501082_1587434 | Ga0501082_1587434_138_509 | 118 |
| 707 | 3300061734 | Ga0530510_0000245 | Ga0530510_0000245_34_405 | 118 |
| 708 | 3300061734 | Ga0530510_0034283 | Ga0530510_0034283_1886_2248 | 118 |
| 709 | 3300061734 | Ga0530510_0127461 | Ga0530510_0127461_135_506 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5km6-assembly1.cif.gz_A-2 | human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex | 0.9516 | 5 | 109 |
| 6d6j-assembly1.cif.gz_A | crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 | 0.9451 | 5 | 109 |
| 3qgz-assembly1.cif.gz_A | re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine | 0.9445 | 5 | 109 |
| 3o1z-assembly1.cif.gz_A-2 | high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) double cysteine mutant from rabbit | 0.9412 | 5 | 109 |
| 7q2u-assembly2.cif.gz_DDD | the crystal structure of the hint1 q62a mutant. | 0.9406 | 5 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kpcB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9333 | 5 | 109 | 3.30.428.10 |
| 4njyA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9185 | 17 | 109 | 3.30.428.10 |
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9152 | 2 | 115 | 3.30.428.10 |
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9077 | 2 | 115 | 3.30.428.10 |
| af_Q8STA5_22_150_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.907 | 1 | 114 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5IG94-F1-model_v4 | deleted | 0.966 | 3 | 117 |
|
| AF-A0A356HRU5-F1-model_v4 | deleted | 0.9632 | 2 | 108 |
|
| AF-A0A0J6NQ96-F1-model_v4 | HIT family hydrolase | 0.962 | 3 | 106 |
GO:0016787
|
| AF-A0A1W9GZF2-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9603 | 3 | 118 |
GO:0003824
|
| AF-A0A1H6FFC4-F1-model_v4 | HIT-like protein (EC 3.-.-.-) | 0.9593 | 2 | 110 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar