F476658

General Info

Members Datasets Scaffolds Average Seq Length
709 306 709 120

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10049224|Ga0316578_100492241
Length 114
Sequence MPDCLFCKIASGEIPSEIVYQDDQVTVFNDIKPAAPVHLLVIPNIHIPSVAAMEESDIDLFGRLFLAARKAAQQAGIDESGYRLIVNNGPDAHQEVFHVHMHILGGGEMQHPMG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
256 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
257 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
258 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
288 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.14
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028696 3300003203 Bacteria 2117
2 Ga0065704_10570846 3300005289 Bacteria 623
3 Ga0065704_10596573 3300005289 Bacteria 585
4 Ga0065707_10027591 3300005295 Bacteria 1200
5 Ga0065707_10105333 3300005295 Bacteria 2650
6 Ga0065707_10329623 3300005295 Bacteria 936
7 Ga0070676_10413024 3300005328 Bacteria 941
8 Ga0070690_100483358 3300005330 Bacteria 924
9 Ga0070690_100926445 3300005330 Bacteria 683
10 Ga0070677_10039988 3300005333 Bacteria 1843
11 Ga0068869_100081685 3300005334 Bacteria 2414
12 Ga0068869_100263038 3300005334 Bacteria 1381
13 Ga0068869_101257403 3300005334 Bacteria 652
14 Ga0070680_100073644 3300005336 Bacteria 2809
15 Ga0070680_100076659 3300005336 Bacteria 2753
16 Ga0070680_100258591 3300005336 Bacteria 1472
17 Ga0070680_100381635 3300005336 Bacteria 1200
18 Ga0070680_101728537 3300005336 Bacteria 542
19 Ga0068868_100125085 3300005338 Bacteria 2100
20 Ga0070689_100044499 3300005340 Bacteria 3415
21 Ga0070689_100088254 3300005340 Bacteria 2440
22 Ga0070689_102137562 3300005340 Bacteria 513
23 Ga0070691_10201129 3300005341 Bacteria 1047
24 Ga0070691_10209997 3300005341 Bacteria 1027
25 Ga0070691_10491621 3300005341 Bacteria 708
26 Ga0070687_101344454 3300005343 Bacteria 532
27 Ga0070692_10005338 3300005345 Bacteria 5466
28 Ga0070692_10047687 3300005345 Bacteria 2218
29 Ga0070668_100250279 3300005347 Bacteria 1471
30 Ga0070669_101472297 3300005353 Bacteria 591
31 Ga0070671_101294070 3300005355 Bacteria 643
32 Ga0070674_100153370 3300005356 Bacteria 1740
33 Ga0070674_100199714 3300005356 Bacteria 1543
34 Ga0070673_100221540 3300005364 Bacteria 1637
35 Ga0070673_101633537 3300005364 Bacteria 609
36 Ga0070673_101899831 3300005364 Bacteria 564
37 Ga0070688_100123219 3300005365 Bacteria 1739
38 Ga0070688_100763208 3300005365 Bacteria 754
39 Ga0070714_100807380 3300005435 Bacteria 909
40 Ga0070713_100507851 3300005436 Bacteria 1138
41 Ga0070710_10151581 3300005437 Bacteria 1430
42 Ga0070701_10290299 3300005438 Bacteria 1002
43 Ga0070701_10322260 3300005438 Bacteria 956
44 Ga0070701_11034061 3300005438 Bacteria 575
45 Ga0070711_100495849 3300005439 Bacteria 1006
46 Ga0070705_100005218 3300005440 Bacteria 6311
47 Ga0070705_100010397 3300005440 Bacteria 4657
48 Ga0070705_100011800 3300005440 Bacteria 4422
49 Ga0070705_100041177 3300005440 Bacteria 2632
50 Ga0070705_100097312 3300005440 Bacteria 1849
51 Ga0070705_100293911 3300005440 Bacteria 1161
52 Ga0070705_100601447 3300005440 Bacteria 851
53 Ga0070705_100678336 3300005440 Bacteria 807
54 Ga0070705_101483474 3300005440 Bacteria 568
55 Ga0070705_101550414 3300005440 Bacteria 556
56 Ga0070700_100002243 3300005441 Bacteria 9838
57 Ga0070700_100037745 3300005441 Bacteria 2940
58 Ga0070700_100062202 3300005441 Bacteria 2358
59 Ga0070700_100103395 3300005441 Bacteria 1881
60 Ga0070700_100114186 3300005441 Bacteria 1800
61 Ga0070700_100242150 3300005441 Bacteria 1289
62 Ga0070694_100005289 3300005444 Bacteria 7806
63 Ga0070694_100071167 3300005444 Bacteria 2397
64 Ga0070694_100088018 3300005444 Bacteria 2174
65 Ga0070694_100097506 3300005444 Bacteria 2074
66 Ga0070694_100205992 3300005444 Bacteria 1468
67 Ga0070694_100234559 3300005444 Bacteria 1382
68 Ga0070694_100379531 3300005444 Bacteria 1102
69 Ga0070694_100468519 3300005444 Bacteria 997
70 Ga0070708_101797927 3300005445 Bacteria 569
71 Ga0070662_100781646 3300005457 Bacteria 811
72 Ga0070681_10000081 3300005458 Bacteria 71809
73 Ga0068867_100041138 3300005459 Bacteria 3377
74 Ga0068867_100544744 3300005459 Bacteria 1004
75 Ga0070706_100428612 3300005467 Bacteria 1231
76 Ga0070706_100583187 3300005467 Bacteria 1039
77 Ga0070707_100070257 3300005468 Bacteria 3373
78 Ga0070707_100390916 3300005468 Bacteria 1351
79 Ga0070698_100004625 3300005471 Bacteria 15121
80 Ga0070698_100038692 3300005471 Bacteria 4913
81 Ga0070698_100214960 3300005471 Bacteria 1857
82 Ga0070699_100188068 3300005518 Bacteria 1834
83 Ga0070699_100328149 3300005518 Bacteria 1376
84 Ga0070699_100807023 3300005518 Bacteria 859
85 Ga0070699_101200854 3300005518 Bacteria 696
86 Ga0070699_101753470 3300005518 Bacteria 568
87 Ga0070679_100087834 3300005530 Bacteria 3097
88 Ga0070679_100961419 3300005530 Bacteria 798
89 Ga0070679_101332505 3300005530 Bacteria 664
90 Ga0070697_100620813 3300005536 Bacteria 951
91 Ga0070672_100049380 3300005543 Bacteria 3273
92 Ga0070686_100096793 3300005544 Bacteria 1985
93 Ga0070686_100295425 3300005544 Bacteria 1200
94 Ga0070686_100300817 3300005544 Bacteria 1190
95 Ga0070695_100001505 3300005545 Bacteria 12926
96 Ga0070695_100026646 3300005545 Bacteria 3578
97 Ga0070695_100031307 3300005545 Bacteria 3317
98 Ga0070695_100141072 3300005545 Bacteria 1671
99 Ga0070695_100485606 3300005545 Bacteria 953
100 Ga0070695_100687629 3300005545 Bacteria 811
101 Ga0070695_101272979 3300005545 Bacteria 607
102 Ga0070696_100029015 3300005546 Bacteria 3777
103 Ga0070696_100075059 3300005546 Bacteria 2385
104 Ga0070696_100160365 3300005546 Bacteria 1657
105 Ga0070696_100206865 3300005546 Bacteria 1467
106 Ga0070696_100241887 3300005546 Bacteria 1362
107 Ga0070696_100338142 3300005546 Bacteria 1163
108 Ga0070696_100368546 3300005546 Bacteria 1116
109 Ga0070696_100438461 3300005546 Bacteria 1029
110 Ga0070696_100442244 3300005546 Bacteria 1024
111 Ga0070696_101255112 3300005546 Bacteria 628
112 Ga0070696_101501741 3300005546 Bacteria 577
113 Ga0070693_100051202 3300005547 Bacteria 2364
114 Ga0070693_100187688 3300005547 Bacteria 1335
115 Ga0070693_100265882 3300005547 Bacteria 1143
116 Ga0070704_100069852 3300005549 Bacteria 2546
117 Ga0070704_100129221 3300005549 Bacteria 1955
118 Ga0070704_100203790 3300005549 Bacteria 1599
119 Ga0070704_100266307 3300005549 Bacteria 1414
120 Ga0070704_101091672 3300005549 Bacteria 724
121 Ga0070704_101106416 3300005549 Bacteria 720
122 Ga0068855_100777780 3300005563 Bacteria 1019
123 Ga0068857_100325486 3300005577 Bacteria 1420
124 Ga0068854_100084875 3300005578 Bacteria 2344
125 Ga0068856_100188274 3300005614 Bacteria 2077
126 Ga0068856_101800911 3300005614 Bacteria 624
127 Ga0070702_100045349 3300005615 Bacteria 2487
128 Ga0070702_100089935 3300005615 Bacteria 1859
129 Ga0070702_100167399 3300005615 Bacteria 1426
130 Ga0070702_100273543 3300005615 Bacteria 1156
131 Ga0068859_100054594 3300005617 Bacteria 4019
132 Ga0068859_100188149 3300005617 Bacteria 2149
133 Ga0068859_100299024 3300005617 Bacteria 1703
134 Ga0068859_100801290 3300005617 Bacteria 1030
135 Ga0068859_100948811 3300005617 Bacteria 944
136 Ga0068864_100182993 3300005618 Bacteria 1917
137 Ga0068864_101585004 3300005618 Bacteria 659
138 Ga0068866_10347163 3300005718 Bacteria 942
139 Ga0068861_100508371 3300005719 Bacteria 1090
140 Ga0068861_100681305 3300005719 Bacteria 953
141 Ga0068870_10426963 3300005840 Bacteria 868
142 Ga0068863_101503799 3300005841 Bacteria 682
143 Ga0068858_100023814 3300005842 Bacteria 5705
144 Ga0068858_101782523 3300005842 Unclassified 608
145 Ga0068860_100109367 3300005843 Bacteria 2642
146 Ga0068860_100952298 3300005843 Bacteria 876
147 Ga0068862_100211533 3300005844 Bacteria 1752
148 Ga0068862_100257889 3300005844 Bacteria 1591
149 Ga0068862_100398441 3300005844 Bacteria 1287
150 Ga0068862_101441351 3300005844 Bacteria 693
151 Ga0081538_10108255 3300005981 Bacteria 1373
152 Ga0081539_10004782 3300005985 Bacteria 14603
153 Ga0070715_10135105 3300006163 Bacteria 1191
154 Ga0070716_100433289 3300006173 Bacteria 954
155 Ga0070716_100436828 3300006173 Bacteria 950
156 Ga0070716_100589231 3300006173 Bacteria 835
157 Ga0070712_101528012 3300006175 Bacteria 584
158 Ga0097621_100523859 3300006237 Bacteria 1076
159 Ga0097621_101152387 3300006237 Bacteria 729
160 Ga0097621_101620359 3300006237 Bacteria 615
161 Ga0075428_100013956 3300006844 Bacteria 8945
162 Ga0075428_100033964 3300006844 Bacteria 5627
163 Ga0075428_100249469 3300006844 Bacteria 1913
164 Ga0075428_100273746 3300006844 Bacteria 1816
165 Ga0075430_100006977 3300006846 Bacteria 9521
166 Ga0075430_100044517 3300006846 Bacteria 3752
167 Ga0075430_100051971 3300006846 Bacteria 3451
168 Ga0075430_100094969 3300006846 Bacteria 2492
169 Ga0075430_100337202 3300006846 Bacteria 1246
170 Ga0075430_100364272 3300006846 Bacteria 1193
171 Ga0075430_101322881 3300006846 Bacteria 593
172 Ga0075431_100020329 3300006847 Bacteria 6782
173 Ga0075431_100110864 3300006847 Bacteria 2832
174 Ga0075431_100126308 3300006847 Bacteria 2639
175 Ga0075433_10000480 3300006852 Bacteria 26041
176 Ga0075433_10020641 3300006852 Bacteria 5513
177 Ga0075433_10286274 3300006852 Bacteria 1460
178 Ga0075433_10383488 3300006852 Bacteria 1241
179 Ga0075433_10467997 3300006852 Bacteria 1110
180 Ga0075433_10598315 3300006852 Bacteria 968
181 Ga0075433_10697675 3300006852 Bacteria 889
182 Ga0075433_11414364 3300006852 Bacteria 602
183 Ga0075434_100000079 3300006871 Bacteria 52051
184 Ga0075434_100001287 3300006871 Bacteria 20920
185 Ga0075434_100020461 3300006871 Bacteria 6420
186 Ga0075434_100126328 3300006871 Bacteria 2574
187 Ga0075434_100784007 3300006871 Bacteria 970
188 Ga0075434_100863928 3300006871 Bacteria 920
189 Ga0075434_101147703 3300006871 Bacteria 790
190 Ga0075429_100000100 3300006880 Bacteria 47693
191 Ga0075429_100367967 3300006880 Bacteria 1259
192 Ga0075429_100407123 3300006880 Bacteria 1191
193 Ga0075429_100518442 3300006880 Bacteria 1044
194 Ga0068865_100208955 3300006881 Bacteria 1520
195 Ga0068865_101397972 3300006881 Bacteria 625
196 Ga0068865_101698018 3300006881 Bacteria 569
197 Ga0075436_100000529 3300006914 Bacteria 24848
198 Ga0075436_100000789 3300006914 Bacteria 21020
199 Ga0075436_100061499 3300006914 Bacteria 2594
200 Ga0075436_100106581 3300006914 Bacteria 1955
201 Ga0075436_100150487 3300006914 Bacteria 1638
202 Ga0097620_100054593 3300006931 Bacteria 4019
203 Ga0097620_100188154 3300006931 Bacteria 2149
204 Ga0097620_100299041 3300006931 Bacteria 1703
205 Ga0097620_100801326 3300006931 Bacteria 1030
206 Ga0097620_100948861 3300006931 Bacteria 944
207 Ga0075435_100000655 3300007076 Bacteria 21307
208 Ga0075435_100003904 3300007076 Bacteria 10179
209 Ga0075435_100009301 3300007076 Bacteria 7103
210 Ga0075435_100049195 3300007076 Bacteria 3389
211 Ga0075435_102014928 3300007076 Bacteria 507
212 Ga0099794_10007992 3300007265 Bacteria 4375
213 Ga0099794_10022268 3300007265 Bacteria 2888
214 Ga0099795_10283253 3300007788 Bacteria 724
215 Ga0099795_10418362 3300007788 Bacteria 612
216 Ga0105250_10077252 3300009092 Bacteria 1348
217 Ga0105240_12356249 3300009093 Unclassified 551
218 Ga0111539_10013498 3300009094 Bacteria 10209
219 Ga0111539_10029705 3300009094 Bacteria 6654
220 Ga0111539_10036478 3300009094 Bacteria 5944
221 Ga0111539_10155934 3300009094 Bacteria 2672
222 Ga0111539_10201316 3300009094 Bacteria 2322
223 Ga0111539_10310723 3300009094 Bacteria 1834
224 Ga0111539_10320185 3300009094 Bacteria 1805
225 Ga0111539_11099843 3300009094 Bacteria 924
226 Ga0111539_11661899 3300009094 Bacteria 741
227 Ga0111539_11863665 3300009094 Bacteria 697
228 Ga0111539_11935591 3300009094 Bacteria 684
229 Ga0114129_10011817 3300009147 Bacteria 12420
230 Ga0114129_10105488 3300009147 Bacteria 3894
231 Ga0114129_10610148 3300009147 Bacteria 1413
232 Ga0114129_11383659 3300009147 Bacteria 869
233 Ga0114129_11614027 3300009147 Bacteria 794
234 Ga0114129_11744730 3300009147 Bacteria 758
235 Ga0105243_10181886 3300009148 Bacteria 1829
236 Ga0105243_12286481 3300009148 Bacteria 578
237 Ga0105243_12353746 3300009148 Bacteria 571
238 Ga0105243_12664274 3300009148 Bacteria 540
239 Ga0105248_10668234 3300009177 Bacteria 1172
240 Ga0105248_12906309 3300009177 Bacteria 546
241 Ga0105249_10096280 3300009553 Bacteria 2777
242 Ga0105249_10102987 3300009553 Bacteria 2688
243 Ga0099796_10075186 3300010159 Bacteria 1228
244 Ga0105239_10172608 3300010375 Bacteria 2418
245 Ga0105246_11618355 3300011119 Bacteria 613
246 Ga0157378_11028577 3300013297 Bacteria 859
247 Ga0163162_10169104 3300013306 Bacteria 2310
248 Ga0157372_11064740 3300013307 Bacteria 936
249 Ga0157372_11661021 3300013307 Bacteria 735
250 Ga0157375_11533541 3300013308 Bacteria 787
251 Ga0157375_12859398 3300013308 Bacteria 577
252 Ga0157380_10122036 3300014326 Bacteria 2209
253 Ga0157380_10328451 3300014326 Bacteria 1421
254 Ga0157380_11248357 3300014326 Bacteria 788
255 Ga0157377_10958053 3300014745 Bacteria 644
256 Ga0157379_10109750 3300014968 Bacteria 2478
257 Ga0207653_10305872 3300025885 Bacteria 617
258 Ga0207653_10399583 3300025885 Bacteria 539
259 Ga0207692_10040663 3300025898 Bacteria 2296
260 Ga0207692_10240455 3300025898 Bacteria 1081
261 Ga0207642_10057496 3300025899 Bacteria 1789
262 Ga0207688_10179994 3300025901 Bacteria 1260
263 Ga0207685_10294079 3300025905 Bacteria 801
264 Ga0207699_11114596 3300025906 Bacteria 584
265 Ga0207645_10079638 3300025907 Bacteria 2100
266 Ga0207643_10234840 3300025908 Bacteria 1126
267 Ga0207684_10189827 3300025910 Bacteria 1772
268 Ga0207654_10740362 3300025911 Bacteria 708
269 Ga0207707_10007590 3300025912 Bacteria 9451
270 Ga0207707_10174695 3300025912 Bacteria 1877
271 Ga0207663_11220927 3300025916 Bacteria 605
272 Ga0207660_10135994 3300025917 Bacteria 1875
273 Ga0207660_10484147 3300025917 Bacteria 1003
274 Ga0207660_10584725 3300025917 Bacteria 909
275 Ga0207662_10011539 3300025918 Bacteria 4905
276 Ga0207662_10439632 3300025918 Bacteria 890
277 Ga0207662_10765445 3300025918 Bacteria 679
278 Ga0207652_10063323 3300025921 Bacteria 3198
279 Ga0207652_10734118 3300025921 Bacteria 880
280 Ga0207646_10034021 3300025922 Bacteria 4606
281 Ga0207646_11315685 3300025922 Bacteria 631
282 Ga0207681_10002005 3300025923 Bacteria 13073
283 Ga0207681_10554103 3300025923 Bacteria 946
284 Ga0207694_10966997 3300025924 Bacteria 720
285 Ga0207659_10039287 3300025926 Bacteria 3299
286 Ga0207700_10419794 3300025928 Bacteria 1175
287 Ga0207664_10211487 3300025929 Bacteria 1678
288 Ga0207706_10044590 3300025933 Bacteria 3930
289 Ga0207709_10009164 3300025935 Bacteria 5452
290 Ga0207709_10237095 3300025935 Bacteria 1325
291 Ga0207709_10708040 3300025935 Bacteria 806
292 Ga0207709_10985346 3300025935 Bacteria 688
293 Ga0207670_10051873 3300025936 Bacteria 2757
294 Ga0207670_10139389 3300025936 Bacteria 1787
295 Ga0207670_10642978 3300025936 Bacteria 874
296 Ga0207670_10695374 3300025936 Bacteria 841
297 Ga0207670_10813710 3300025936 Bacteria 779
298 Ga0207670_11198060 3300025936 Bacteria 643
299 Ga0207669_10043573 3300025937 Bacteria 2629
300 Ga0207704_10016097 3300025938 Bacteria 3833
301 Ga0207665_10155307 3300025939 Bacteria 1642
302 Ga0207665_10167973 3300025939 Bacteria 1582
303 Ga0207665_10587247 3300025939 Bacteria 869
304 Ga0207691_10152795 3300025940 Bacteria 2029
305 Ga0207689_10080631 3300025942 Bacteria 2675
306 Ga0207689_10109005 3300025942 Bacteria 2275
307 Ga0207661_10072757 3300025944 Bacteria 2813
308 Ga0207667_10645454 3300025949 Bacteria 1064
309 Ga0207651_10042207 3300025960 Bacteria 3034
310 Ga0207651_11667926 3300025960 Bacteria 574
311 Ga0207712_10047143 3300025961 Bacteria 2990
312 Ga0207712_10270191 3300025961 Bacteria 1383
313 Ga0207712_10388852 3300025961 Bacteria 1169
314 Ga0207668_10057398 3300025972 Bacteria 2715
315 Ga0207640_10117957 3300025981 Bacteria 1895
316 Ga0207677_10115093 3300026023 Bacteria 2011
317 Ga0207703_10029223 3300026035 Bacteria 4348
318 Ga0207703_11033217 3300026035 Bacteria 789
319 Ga0207708_10079581 3300026075 Bacteria 2517
320 Ga0207708_10093074 3300026075 Bacteria 2326
321 Ga0207708_10097048 3300026075 Bacteria 2278
322 Ga0207708_10257402 3300026075 Bacteria 1408
323 Ga0207702_11432171 3300026078 Bacteria 685
324 Ga0207641_10510824 3300026088 Bacteria 1168
325 Ga0207641_10761805 3300026088 Bacteria 956
326 Ga0207641_10882191 3300026088 Bacteria 888
327 Ga0207648_10051799 3300026089 Bacteria 3588
328 Ga0207648_11061352 3300026089 Bacteria 759
329 Ga0207676_10219315 3300026095 Bacteria 1693
330 Ga0207674_10099832 3300026116 Bacteria 2885
331 Ga0207674_10217411 3300026116 Bacteria 1859
332 Ga0207674_10752728 3300026116 Bacteria 940
333 Ga0207675_100038588 3300026118 Bacteria 4457
334 Ga0207675_100770057 3300026118 Bacteria 974
335 Ga0209969_1004244 3300027360 Bacteria 2004
336 Ga0209969_1033634 3300027360 Bacteria 787
337 Ga0209967_1005391 3300027364 Bacteria 1715
338 Ga0209967_1008205 3300027364 Bacteria 1434
339 Ga0209981_1000836 3300027378 Bacteria 3889
340 Ga0209981_1006379 3300027378 Bacteria 1577
341 Ga0209981_1022610 3300027378 Bacteria 902
342 Ga0209996_1020278 3300027395 Bacteria 931
343 Ga0209996_1048160 3300027395 Bacteria 642
344 Ga0210000_1002454 3300027462 Bacteria 2639
345 Ga0210000_1003595 3300027462 Bacteria 2235
346 Ga0210000_1019850 3300027462 Bacteria 1024
347 Ga0210000_1061270 3300027462 Bacteria 609
348 Ga0209995_1009323 3300027471 Bacteria 1587
349 Ga0209968_1005969 3300027526 Bacteria 1833
350 Ga0209999_1011623 3300027543 Bacteria 1594
351 Ga0209999_1016133 3300027543 Bacteria 1359
352 Ga0209999_1020350 3300027543 Bacteria 1219
353 Ga0209982_1007530 3300027552 Bacteria 1591
354 Ga0209970_1080269 3300027614 Bacteria 612
355 Ga0209983_1022842 3300027665 Bacteria 1313
356 Ga0209588_1070846 3300027671 Bacteria 1126
357 Ga0209588_1093254 3300027671 Bacteria 970
358 Ga0209971_1003692 3300027682 Bacteria 3629
359 Ga0209966_1005356 3300027695 Bacteria 2201
360 Ga0209966_1009473 3300027695 Bacteria 1740
361 Ga0209966_1097057 3300027695 Bacteria 664
362 Ga0209974_10023970 3300027876 Bacteria 2019
363 Ga0207428_10025385 3300027907 Bacteria 4960
364 Ga0207428_10040931 3300027907 Bacteria 3753
365 Ga0207428_10131119 3300027907 Bacteria 1918
366 Ga0207428_10253196 3300027907 Bacteria 1313
367 Ga0207428_10840033 3300027907 Bacteria 651
368 Ga0268265_10001159 3300028380 Bacteria 23174
369 Ga0268265_10287607 3300028380 Bacteria 1474
370 Ga0268265_10290618 3300028380 Bacteria 1467
371 Ga0307408_100137592 3300031548 Bacteria 1913
372 Ga0307408_100414914 3300031548 Bacteria 1159
373 Ga0307408_100542108 3300031548 Bacteria 1025
374 Ga0316578_10049224 3300031728 Bacteria 2462
375 Ga0307405_10707397 3300031731 Bacteria 835
376 Ga0316577_10091297 3300031733 Bacteria 1705
377 Ga0307413_10276368 3300031824 Bacteria 1261
378 Ga0307413_10288608 3300031824 Bacteria 1238
379 Ga0307410_11263433 3300031852 Bacteria 645
380 Ga0307406_10672945 3300031901 Bacteria 861
381 Ga0307406_10770264 3300031901 Bacteria 810
382 Ga0307407_10532386 3300031903 Bacteria 866
383 Ga0307412_10328122 3300031911 Bacteria 1220
384 Ga0307412_11312247 3300031911 Bacteria 652
385 Ga0307409_100370250 3300031995 Bacteria 1358
386 Ga0307416_100084117 3300032002 Bacteria 2702
387 Ga0307416_101331134 3300032002 Bacteria 824
388 Ga0307416_102261756 3300032002 Bacteria 644
389 Ga0307416_102642827 3300032002 Bacteria 599
390 Ga0307416_102759232 3300032002 Unclassified 587
391 Ga0307416_103120348 3300032002 Bacteria 554
392 Ga0307411_10031659 3300032005 Bacteria 3258
393 Ga0307411_10046102 3300032005 Bacteria 2808
394 Ga0307411_10538554 3300032005 Bacteria 994
395 Ga0307415_101164953 3300032126 Bacteria 725
396 Ga0373959_0039589 3300034820 Bacteria 984
397 Ga0373938_0014497 3300034957 Bacteria 1514
398 Ga0373938_0049865 3300034957 Bacteria 953
399 Ga0373926_0029654 3300035083 Bacteria 1924
400 Ga0373952_0060084 3300035092 Bacteria 927
401 Ga0373932_0198017 3300035112 Bacteria 713
402 Ga0373936_0054593 3300035113 Bacteria 1621
403 Ga0373936_0117177 3300035113 Bacteria 1135
404 Ga0373939_0055492 3300035114 Bacteria 1244
405 Ga0373939_0098681 3300035114 Bacteria 999
406 Ga0373953_0028337 3300035117 Bacteria 2159
407 Ga0373953_0220347 3300035117 Bacteria 822
408 Ga0373954_0001511 3300035118 Bacteria 9463
409 Ga0373956_0165188 3300035119 Bacteria 1044
410 Ga0373960_0053316 3300035121 Bacteria 1206
411 Ga0373960_0115977 3300035121 Bacteria 884
412 Ga0373960_0186225 3300035121 Bacteria 727
413 Ga0373955_0003334 3300035172 Bacteria 7054
414 Ga0373955_0127557 3300035172 Bacteria 1483
415 Ga0373955_0548087 3300035172 Bacteria 707
416 Ga0373942_0002391 3300035207 Bacteria 4561
417 Ga0373961_0015462 3300035241 Bacteria 1952
418 Ga0373961_0020738 3300035241 Bacteria 1741
419 Ga0316574_0126274 3300035398 Bacteria 1644
420 Ga0373924_0043921 3300035410 Bacteria 1836
421 Ga0373924_0094759 3300035410 Bacteria 1280
422 Ga0373931_0008167 3300035691 Bacteria 4959
423 Ga0373931_0674708 3300035691 Bacteria 681
424 Ga0373935_0572217 3300035692 Bacteria 825
425 Ga0373933_0011855 3300035724 Bacteria 4814
426 Ga0373933_0018495 3300035724 Bacteria 3919
427 Ga0373933_0359974 3300035724 Bacteria 946
428 Ga0373947_0058905 3300035725 Bacteria 2328
429 Ga0373937_0001313 3300036401 Bacteria 20818
430 Ga0373937_0019027 3300036401 Bacteria 6144
431 Ga0373937_0033470 3300036401 Bacteria 4667
432 Ga0373937_0117971 3300036401 Bacteria 2472
433 Ga0316582_0081899 3300036647 Bacteria 2109
434 Ga0316584_0030436 3300036712 Bacteria 3987
435 Ga0373925_0059535 3300037068 Bacteria 2865
436 Ga0436365_1920613 3300039437 Bacteria 1105
437 Ga0436360_0526383 3300039438 Bacteria 1219
438 Ga0439439_0058260 3300041406 Bacteria 1022
439 Ga0439453_0035069 3300041408 Bacteria 965
440 Ga0439461_0098261 3300041410 Bacteria 710
441 Ga0451802_0106108 3300041460 Bacteria 514
442 Ga0451839_0301690 3300041496 Bacteria 917
443 Ga0439441_000219 3300042001 Bacteria 5405
444 Ga0439441_148769 3300042001 Bacteria 551
445 Ga0439443_016332 3300042003 Bacteria 1133
446 Ga0439443_050491 3300042003 Bacteria 727
447 Ga0439454_035451 3300042011 Bacteria 799
448 Ga0439456_012653 3300042013 Bacteria 1750
449 Ga0450923_094551 3300042125 Bacteria 684
450 Ga0439446_0029196 3300042156 Bacteria 1591
451 Ga0439446_0105136 3300042156 Bacteria 896
452 Ga0439434_0000867 3300042435 Bacteria 8710
453 Ga0439434_0073656 3300042435 Bacteria 1077
454 Ga0439434_0274291 3300042435 Bacteria 580
455 Ga0439435_0007268 3300042436 Bacteria 2526
456 Ga0439444_0003897 3300042437 Bacteria 2135
457 Ga0439459_0081256 3300042438 Bacteria 766
458 Ga0439460_0058644 3300042461 Bacteria 1170
459 Ga0450893_0068260 3300042532 Bacteria 688
460 Ga0451577_0642743 3300042876 Bacteria 962
461 Ga0451577_1385759 3300042876 Bacteria 624
462 Ga0453683_0541986 3300044673 Bacteria 757
463 Ga0453683_0930934 3300044673 Bacteria 575
464 Ga0466963_0246298 3300044694 Bacteria 1254
465 Ga0466960_0068503 3300044901 Bacteria 1761
466 Ga0466960_0344018 3300044901 Bacteria 849
467 Ga0451576_0106040 3300045051 Bacteria 2924
468 Ga0451576_0136400 3300045051 Bacteria 2559
469 Ga0451576_0226550 3300045051 Bacteria 1952
470 Ga0451576_0226592 3300045051 Bacteria 1952
471 Ga0451576_2413427 3300045051 Bacteria 538
472 Ga0466958_0076169 3300045836 Bacteria 2059
473 Ga0466967_0008116 3300045976 Bacteria 7660
474 Ga0495592_0695869 3300046454 Bacteria 612
475 Ga0495603_0238847 3300046455 Bacteria 1047
476 Ga0495590_0354744 3300046457 Bacteria 558
477 Ga0495629_0060679 3300046459 Bacteria 2643
478 Ga0495651_0165640 3300046462 Bacteria 1579
479 Ga0495662_0031220 3300046476 Bacteria 2573
480 Ga0495662_0138463 3300046476 Bacteria 1198
481 Ga0495584_0050854 3300046491 Bacteria 2087
482 Ga0495584_0087837 3300046491 Bacteria 1567
483 Ga0495584_0249144 3300046491 Bacteria 903
484 Ga0495608_0000767 3300046511 Bacteria 22475
485 Ga0495608_0310669 3300046511 Bacteria 975
486 Ga0495618_0033918 3300046514 Bacteria 3200
487 Ga0495628_0003354 3300046516 Bacteria 14318
488 Ga0495628_0536684 3300046516 Bacteria 841
489 Ga0495630_0020245 3300046517 Bacteria 4903
490 Ga0495644_0096494 3300046523 Bacteria 1117
491 Ga0495666_0005319 3300046526 Bacteria 6490
492 Ga0495642_0091091 3300046528 Bacteria 1291
493 Ga0495642_0108562 3300046528 Bacteria 1185
494 Ga0495652_0595961 3300046529 Bacteria 754
495 Ga0495640_0013075 3300046533 Bacteria 6321
496 Ga0495640_0024651 3300046533 Bacteria 4374
497 Ga0495586_0020862 3300046535 Bacteria 3490
498 Ga0495587_0028889 3300046536 Bacteria 3369
499 Ga0495609_0179220 3300046538 Bacteria 892
500 Ga0495645_0028191 3300046543 Bacteria 4080
501 Ga0495667_0014877 3300046559 Bacteria 5257
502 Ga0495667_0120746 3300046559 Bacteria 1692
503 Ga0495634_0004750 3300046642 Bacteria 10569
504 Ga0495635_0075811 3300046663 Bacteria 2304
505 Ga0495635_0098814 3300046663 Bacteria 1995
506 Ga0495659_0149090 3300046664 Bacteria 938
507 Ga0495659_0232069 3300046664 Bacteria 765
508 Ga0495659_0274160 3300046664 Bacteria 708
509 Ga0495657_0350814 3300046675 Bacteria 873
510 Ga0495599_0094489 3300046678 Bacteria 1865
511 Ga0495623_0097921 3300046679 Bacteria 1791
512 Ga0495623_0402531 3300046679 Bacteria 736
513 Ga0495646_0255191 3300046680 Bacteria 938
514 Ga0495658_0033007 3300046683 Bacteria 2831
515 Ga0495669_0016877 3300046684 Bacteria 3131
516 Ga0495669_0081557 3300046684 Bacteria 1485
517 Ga0495669_0168285 3300046684 Bacteria 1042
518 Ga0495613_0027811 3300046689 Bacteria 4208
519 Ga0495624_0051034 3300046690 Bacteria 2619
520 Ga0495671_0604241 3300046692 Bacteria 522
521 Ga0495600_0014090 3300046809 Bacteria 5036
522 Ga0495600_0780057 3300046809 Bacteria 570
523 Ga0495604_0003259 3300047317 Bacteria 12969
524 Ga0495604_0115359 3300047317 Bacteria 1952
525 Ga0495604_0165596 3300047317 Bacteria 1559
526 Ga0495604_0858958 3300047317 Bacteria 569
527 Ga0495636_0017357 3300047318 Bacteria 2881
528 Ga0495674_0164174 3300047319 Bacteria 1857
529 Ga0495680_0007743 3300047322 Bacteria 9811
530 Ga0495680_0182929 3300047322 Bacteria 1511
531 Ga0501290_028777 3300049513 Bacteria 789
532 Ga0501290_056162 3300049513 Bacteria 624
533 Ga0501291_051778 3300049514 Bacteria 750
534 Ga0501291_155202 3300049514 Bacteria 520
535 Ga0501296_024027 3300049519 Bacteria 793
536 Ga0501299_017791 3300049522 Bacteria 1272
537 Ga0501031_0071786 3300049568 Bacteria 2254
538 Ga0501031_0259271 3300049568 Bacteria 1130
539 Ga0501032_0117810 3300049569 Bacteria 1756
540 Ga0501033_0038508 3300049570 Bacteria 3574
541 Ga0501033_0248006 3300049570 Bacteria 1263
542 Ga0501036_0098691 3300049572 Bacteria 2469
543 Ga0501036_0399362 3300049572 Bacteria 1147
544 Ga0501036_0706092 3300049572 Bacteria 833
545 Ga0501037_0077355 3300049573 Bacteria 2414
546 Ga0501037_0163388 3300049573 Bacteria 1587
547 Ga0501037_0276465 3300049573 Bacteria 1171
548 Ga0501037_0292492 3300049573 Bacteria 1133
549 Ga0501038_0012391 3300049574 Bacteria 7793
550 Ga0501039_0028433 3300049575 Bacteria 4304
551 Ga0501039_0048062 3300049575 Bacteria 3298
552 Ga0501039_0066519 3300049575 Bacteria 2798
553 Ga0501039_0953095 3300049575 Bacteria 667
554 Ga0501040_0004390 3300049576 Bacteria 9163
555 Ga0501040_0309215 3300049576 Bacteria 1130
556 Ga0501041_0026263 3300049577 Bacteria 3502
557 Ga0501041_0028785 3300049577 Bacteria 3351
558 Ga0501041_0168708 3300049577 Bacteria 1369
559 Ga0501042_0003021 3300049578 Bacteria 10463
560 Ga0501042_0342532 3300049578 Bacteria 1081
561 Ga0501042_0371039 3300049578 Bacteria 1036
562 Ga0501042_0847043 3300049578 Bacteria 666
563 Ga0501043_0039549 3300049579 Bacteria 3706
564 Ga0501043_1234851 3300049579 Bacteria 524
565 Ga0501046_0003243 3300049580 Bacteria 14952
566 Ga0501046_0025733 3300049580 Bacteria 4813
567 Ga0501046_0194088 3300049580 Bacteria 1514
568 Ga0501046_0315807 3300049580 Bacteria 1139
569 Ga0501048_0007325 3300049582 Bacteria 8364
570 Ga0501048_0095589 3300049582 Bacteria 2095
571 Ga0501048_0255963 3300049582 Bacteria 1243
572 Ga0501048_0294256 3300049582 Bacteria 1155
573 Ga0501067_0284097 3300049583 Bacteria 921
574 Ga0501067_0523826 3300049583 Bacteria 663
575 Ga0501068_0002746 3300049584 Bacteria 9355
576 Ga0501068_0081979 3300049584 Bacteria 1981
577 Ga0501068_0181367 3300049584 Bacteria 1331
578 Ga0501068_0325359 3300049584 Bacteria 986
579 Ga0501069_0024556 3300049585 Bacteria 3288
580 Ga0501069_0290424 3300049585 Bacteria 958
581 Ga0501069_0538260 3300049585 Bacteria 698
582 Ga0501070_0086060 3300049586 Bacteria 2602
583 Ga0501070_0730260 3300049586 Bacteria 782
584 Ga0501071_0005475 3300049587 Bacteria 8166
585 Ga0501071_0018923 3300049587 Bacteria 4777
586 Ga0501071_0029827 3300049587 Bacteria 3853
587 Ga0501071_0237264 3300049587 Bacteria 1375
588 Ga0501071_0252574 3300049587 Bacteria 1331
589 Ga0501071_0352656 3300049587 Bacteria 1120
590 Ga0501071_0387803 3300049587 Bacteria 1066
591 Ga0501071_0775939 3300049587 Bacteria 739
592 Ga0501072_0007949 3300049588 Bacteria 8052
593 Ga0501072_0011492 3300049588 Bacteria 6768
594 Ga0501072_0019791 3300049588 Bacteria 5208
595 Ga0501072_0032348 3300049588 Bacteria 4097
596 Ga0501072_0106058 3300049588 Bacteria 2235
597 Ga0501072_0455327 3300049588 Bacteria 1013
598 Ga0501072_0783434 3300049588 Bacteria 747
599 Ga0501073_0081968 3300049589 Bacteria 2244
600 Ga0501073_0567593 3300049589 Bacteria 784
601 Ga0501073_0831295 3300049589 Bacteria 636
602 Ga0501074_0022089 3300049590 Bacteria 4623
603 Ga0501074_0060359 3300049590 Bacteria 2732
604 Ga0501075_0002198 3300049591 Bacteria 12907
605 Ga0501075_0004962 3300049591 Bacteria 9071
606 Ga0501075_0158338 3300049591 Bacteria 1727
607 Ga0501075_0885772 3300049591 Bacteria 679
608 Ga0501075_1092638 3300049591 Bacteria 606
609 Ga0501075_1111525 3300049591 Bacteria 600
610 Ga0501076_0000429 3300049592 Bacteria 26487
611 Ga0501076_0023753 3300049592 Bacteria 4729
612 Ga0501076_0037359 3300049592 Bacteria 3808
613 Ga0501076_0828663 3300049592 Bacteria 763
614 Ga0501076_0948510 3300049592 Bacteria 709
615 Ga0501076_1447674 3300049592 Bacteria 564
616 Ga0501077_0022192 3300049593 Bacteria 4020
617 Ga0501077_0223566 3300049593 Bacteria 1196
618 Ga0501079_0021474 3300049741 Bacteria 4939
619 Ga0501079_0041234 3300049741 Bacteria 3562
620 Ga0501079_0095219 3300049741 Bacteria 2307
621 Ga0501079_0438437 3300049741 Bacteria 1026
622 Ga0501080_0000634 3300049742 Bacteria 27899
623 Ga0501080_0018543 3300049742 Bacteria 6438
624 Ga0501080_0034438 3300049742 Bacteria 4728
625 Ga0501080_0257367 3300049742 Bacteria 1591
626 Ga0501081_0007073 3300049743 Bacteria 7295
627 Ga0501081_0025861 3300049743 Bacteria 3953
628 Ga0501081_0300506 3300049743 Bacteria 1177
629 Ga0501083_1150845 3300049744 Bacteria 505
630 Ga0501273_029267 3300049770 Bacteria 778
631 Ga0501283_040433 3300049779 Bacteria 806
632 Ga0501035_0343165 3300049822 Bacteria 1251
633 Ga0501044_0117696 3300049823 Bacteria 2661
634 Ga0501045_0038739 3300049824 Bacteria 3467
635 Ga0501045_0472590 3300049824 Bacteria 932
636 Ga0501045_0866118 3300049824 Bacteria 664
637 Ga0501045_1043912 3300049824 Bacteria 599
638 nmdc:mga0k408_656765_c1 3300050493 Bacteria 616
639 nmdc:mga05p37_1255_c1 3300050507 Bacteria 29442
640 nmdc:mga05p37_326471_c1 3300050507 Bacteria 1814
641 nmdc:mga05p37_46253_c1 3300050507 Bacteria 5351
642 nmdc:mga05p37_543024_c1 3300050507 Bacteria 1325
643 nmdc:mga05p37_557944_c1 3300050507 Bacteria 1302
644 nmdc:mga05p37_896453_c1 3300050507 Bacteria 957
645 nmdc:mga09592_109_c1 3300050508 Bacteria 51482
646 nmdc:mga09592_120181_c1 3300050508 Bacteria 2256
647 nmdc:mga09592_160785_c1 3300050508 Bacteria 1940
648 nmdc:mga09592_51500_c1 3300050508 Bacteria 3474
649 nmdc:mga0qj67_139878_c1 3300050509 Bacteria 1963
650 nmdc:mga0qj67_187335_c1 3300050509 Bacteria 1681
651 nmdc:mga0qj67_2200_c1 3300050509 Bacteria 13866
652 nmdc:mga0qj67_38319_c1 3300050509 Bacteria 3760
653 nmdc:mga0qj67_448253_c1 3300050509 Bacteria 1040
654 nmdc:mga0qj67_631194_c1 3300050509 Bacteria 856
655 nmdc:mga0qj67_6675_c1 3300050509 Bacteria 8476
656 nmdc:mga0qj67_715935_c1 3300050509 Bacteria 796
657 nmdc:mga06r32_151321_c1 3300050510 Bacteria 2299
658 nmdc:mga06r32_296652_c1 3300050510 Bacteria 1603
659 nmdc:mga06r32_328435_c1 3300050510 Bacteria 1515
660 nmdc:mga06r32_392232_c1 3300050510 Bacteria 1371
661 nmdc:mga06r32_7661_c1 3300050510 Bacteria 9710
662 nmdc:mga08y16_10670_c1 3300050511 Bacteria 9643
663 nmdc:mga08y16_124577_c1 3300050511 Bacteria 2681
664 nmdc:mga08y16_1390157_c1 3300050511 Bacteria 665
665 nmdc:mga08y16_1392374_c1 3300050511 Bacteria 665
666 nmdc:mga08y16_205809_c1 3300050511 Bacteria 2039
667 nmdc:mga08y16_58461_c1 3300050511 Bacteria 4029
668 nmdc:mga08y16_624448_c1 3300050511 Bacteria 1084
669 nmdc:mga08y16_660425_c1 3300050511 Bacteria 1049
670 nmdc:mga08y16_73557_c1 3300050511 Bacteria 3562
671 nmdc:mga08y16_805050_c1 3300050511 Bacteria 932
672 nmdc:mga08y16_85617_c1 3300050511 Bacteria 3285
673 nmdc:mga0n895_12039_c1 3300050512 Bacteria 7744
674 nmdc:mga0n895_734_c1 3300050512 Bacteria 23141
675 nmdc:mga0n895_741372_c1 3300050512 Bacteria 976
676 nmdc:mga0n895_749808_c1 3300050512 Bacteria 969
677 nmdc:mga0n895_787149_c1 3300050512 Bacteria 942
678 nmdc:mga0n895_7924_c1 3300050512 Bacteria 9159
679 nmdc:mga0rr50_135268_c1 3300050513 Bacteria 1978
680 nmdc:mga0rr50_2416_c1 3300050513 Bacteria 10515
681 nmdc:mga0rr50_3670_c1 3300050513 Bacteria 8893
682 nmdc:mga0rr50_509898_c1 3300050513 Bacteria 1023
683 nmdc:mga0rr50_647896_c1 3300050513 Bacteria 901
684 nmdc:mga0rr50_92416_c1 3300050513 Bacteria 2359
685 nmdc:mga08x19_1688_c1 3300050514 Bacteria 13577
686 nmdc:mga08x19_193748_c1 3300050514 Bacteria 1391
687 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
688 nmdc:mga08x19_41543_c1 3300050514 Bacteria 2929
689 nmdc:mga08x19_415502_c1 3300050514 Bacteria 945
690 nmdc:mga08x19_71597_c1 3300050514 Bacteria 2261
691 nmdc:mga0a205_1601770_c1 3300050515 Bacteria 500
692 nmdc:mga0a205_169979_c1 3300050515 Bacteria 2076
693 nmdc:mga0a205_174980_c1 3300050515 Bacteria 2042
694 nmdc:mga0a205_20918_c1 3300050515 Bacteria 6183
695 nmdc:mga0a205_783914_c1 3300050515 Bacteria 801
696 nmdc:mga0a205_94583_c1 3300050515 Bacteria 2887
697 Ga0495601_0031047 3300053077 Bacteria 3320
698 Ga0501084_0005520 3300054114 Bacteria 10383
699 Ga0501084_0015444 3300054114 Bacteria 6332
700 Ga0501084_0108528 3300054114 Bacteria 2332
701 Ga0501084_0254343 3300054114 Bacteria 1483
702 Ga0590071_110935 3300059421 Bacteria 696
703 Ga0590071_200354 3300059421 Bacteria 525
704 Ga0501082_0029179 3300060353 Bacteria 4752
705 Ga0501082_0078152 3300060353 Bacteria 2854
706 Ga0501082_1587434 3300060353 Bacteria 571
707 Ga0530510_0000245 3300061734 Bacteria 34065
708 Ga0530510_0034283 3300061734 Bacteria 3655
709 Ga0530510_0127461 3300061734 Bacteria 1871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_1043912 Ga0501045_1043912_23_346 107
2 3300050493 nmdc:mga0k408_656765_c1 nmdc:mga0k408_656765_c1_274_600 107
3 3300050509 nmdc:mga0qj67_187335_c1 nmdc:mga0qj67_187335_c1_853_1179 107
4 3300049591 Ga0501075_0885772 Ga0501075_0885772_61_399 112
5 3300031728 Ga0316578_10049224 Ga0316578_100492241 113
6 3300031733 Ga0316577_10091297 Ga0316577_100912972 113
7 3300036647 Ga0316582_0081899 Ga0316582_0081899_348_692 113
8 3300036712 Ga0316584_0030436 Ga0316584_0030436_182_526 113
9 3300025960 Ga0207651_11667926 Ga0207651_116679262 115
10 3300005438 Ga0070701_11034061 Ga0070701_110340611 116
11 3300009148 Ga0105243_12353746 Ga0105243_123537461 116
12 3300035398 Ga0316574_0126274 Ga0316574_0126274_671_1036 116
13 3300039438 Ga0436360_0526383 Ga0436360_0526383_89_445 116
14 3300049824 Ga0501045_0472590 Ga0501045_0472590_396_749 116
15 3300027360 Ga0209969_1033634 Ga0209969_10336342 117
16 3300049573 Ga0501037_0163388 Ga0501037_0163388_993_1376 117
17 3300049584 Ga0501068_0081979 Ga0501068_0081979_580_939 117
18 3300003203 JGI25406J46586_10028696 JGI25406J46586_100286964 118
19 3300005289 Ga0065704_10570846 Ga0065704_105708461 118
20 3300005289 Ga0065704_10596573 Ga0065704_105965732 118
21 3300005295 Ga0065707_10027591 Ga0065707_100275912 118
22 3300005295 Ga0065707_10105333 Ga0065707_101053335 118
23 3300005295 Ga0065707_10329623 Ga0065707_103296233 118
24 3300005328 Ga0070676_10413024 Ga0070676_104130243 118
25 3300005330 Ga0070690_100483358 Ga0070690_1004833582 118
26 3300005330 Ga0070690_100926445 Ga0070690_1009264452 118
27 3300005333 Ga0070677_10039988 Ga0070677_100399881 118
28 3300005334 Ga0068869_100081685 Ga0068869_1000816854 118
29 3300005334 Ga0068869_100263038 Ga0068869_1002630382 118
30 3300005334 Ga0068869_101257403 Ga0068869_1012574032 118
31 3300005336 Ga0070680_100073644 Ga0070680_1000736444 118
32 3300005336 Ga0070680_100076659 Ga0070680_1000766595 118
33 3300005336 Ga0070680_100258591 Ga0070680_1002585913 118
34 3300005336 Ga0070680_100381635 Ga0070680_1003816352 118
35 3300005336 Ga0070680_101728537 Ga0070680_1017285372 118
36 3300005338 Ga0068868_100125085 Ga0068868_1001250853 118
37 3300005340 Ga0070689_100044499 Ga0070689_1000444992 118
38 3300005340 Ga0070689_100088254 Ga0070689_1000882544 118
39 3300005340 Ga0070689_102137562 Ga0070689_1021375621 118
40 3300005341 Ga0070691_10201129 Ga0070691_102011292 118
41 3300005341 Ga0070691_10209997 Ga0070691_102099972 118
42 3300005341 Ga0070691_10491621 Ga0070691_104916211 118
43 3300005343 Ga0070687_101344454 Ga0070687_1013444541 118
44 3300005345 Ga0070692_10005338 Ga0070692_100053384 118
45 3300005345 Ga0070692_10047687 Ga0070692_100476874 118
46 3300005347 Ga0070668_100250279 Ga0070668_1002502793 118
47 3300005353 Ga0070669_101472297 Ga0070669_1014722972 118
48 3300005355 Ga0070671_101294070 Ga0070671_1012940702 118
49 3300005356 Ga0070674_100153370 Ga0070674_1001533702 118
50 3300005356 Ga0070674_100199714 Ga0070674_1001997142 118
51 3300005364 Ga0070673_100221540 Ga0070673_1002215401 118
52 3300005364 Ga0070673_101633537 Ga0070673_1016335371 118
53 3300005364 Ga0070673_101899831 Ga0070673_1018998311 118
54 3300005365 Ga0070688_100123219 Ga0070688_1001232193 118
55 3300005365 Ga0070688_100763208 Ga0070688_1007632082 118
56 3300005435 Ga0070714_100807380 Ga0070714_1008073801 118
57 3300005436 Ga0070713_100507851 Ga0070713_1005078511 118
58 3300005437 Ga0070710_10151581 Ga0070710_101515812 118
59 3300005438 Ga0070701_10290299 Ga0070701_102902993 118
60 3300005438 Ga0070701_10322260 Ga0070701_103222602 118
61 3300005439 Ga0070711_100495849 Ga0070711_1004958492 118
62 3300005440 Ga0070705_100005218 Ga0070705_1000052185 118
63 3300005440 Ga0070705_100010397 Ga0070705_1000103977 118
64 3300005440 Ga0070705_100011800 Ga0070705_1000118005 118
65 3300005440 Ga0070705_100041177 Ga0070705_1000411774 118
66 3300005440 Ga0070705_100097312 Ga0070705_1000973124 118
67 3300005440 Ga0070705_100293911 Ga0070705_1002939113 118
68 3300005440 Ga0070705_100601447 Ga0070705_1006014472 118
69 3300005440 Ga0070705_100678336 Ga0070705_1006783361 118
70 3300005440 Ga0070705_101483474 Ga0070705_1014834741 118
71 3300005440 Ga0070705_101550414 Ga0070705_1015504142 118
72 3300005441 Ga0070700_100002243 Ga0070700_10000224312 118
73 3300005441 Ga0070700_100037745 Ga0070700_1000377454 118
74 3300005441 Ga0070700_100062202 Ga0070700_1000622024 118
75 3300005441 Ga0070700_100103395 Ga0070700_1001033954 118
76 3300005441 Ga0070700_100114186 Ga0070700_1001141864 118
77 3300005441 Ga0070700_100242150 Ga0070700_1002421502 118
78 3300005444 Ga0070694_100005289 Ga0070694_1000052897 118
79 3300005444 Ga0070694_100071167 Ga0070694_1000711675 118
80 3300005444 Ga0070694_100088018 Ga0070694_1000880184 118
81 3300005444 Ga0070694_100097506 Ga0070694_1000975064 118
82 3300005444 Ga0070694_100205992 Ga0070694_1002059923 118
83 3300005444 Ga0070694_100234559 Ga0070694_1002345593 118
84 3300005444 Ga0070694_100379531 Ga0070694_1003795312 118
85 3300005444 Ga0070694_100468519 Ga0070694_1004685193 118
86 3300005445 Ga0070708_101797927 Ga0070708_1017979272 118
87 3300005457 Ga0070662_100781646 Ga0070662_1007816462 118
88 3300005458 Ga0070681_10000081 Ga0070681_1000008149 118
89 3300005459 Ga0068867_100041138 Ga0068867_1000411384 118
90 3300005459 Ga0068867_100544744 Ga0068867_1005447443 118
91 3300005467 Ga0070706_100428612 Ga0070706_1004286123 118
92 3300005467 Ga0070706_100583187 Ga0070706_1005831871 118
93 3300005468 Ga0070707_100070257 Ga0070707_1000702572 118
94 3300005468 Ga0070707_100390916 Ga0070707_1003909162 118
95 3300005471 Ga0070698_100004625 Ga0070698_1000046252 118
96 3300005471 Ga0070698_100038692 Ga0070698_1000386921 118
97 3300005471 Ga0070698_100214960 Ga0070698_1002149604 118
98 3300005518 Ga0070699_100188068 Ga0070699_1001880682 118
99 3300005518 Ga0070699_100328149 Ga0070699_1003281492 118
100 3300005518 Ga0070699_100807023 Ga0070699_1008070232 118
101 3300005518 Ga0070699_101200854 Ga0070699_1012008542 118
102 3300005518 Ga0070699_101753470 Ga0070699_1017534701 118
103 3300005530 Ga0070679_100087834 Ga0070679_1000878345 118
104 3300005530 Ga0070679_100961419 Ga0070679_1009614192 118
105 3300005530 Ga0070679_101332505 Ga0070679_1013325052 118
106 3300005536 Ga0070697_100620813 Ga0070697_1006208132 118
107 3300005543 Ga0070672_100049380 Ga0070672_1000493804 118
108 3300005544 Ga0070686_100096793 Ga0070686_1000967934 118
109 3300005544 Ga0070686_100295425 Ga0070686_1002954253 118
110 3300005544 Ga0070686_100300817 Ga0070686_1003008173 118
111 3300005545 Ga0070695_100001505 Ga0070695_10000150515 118
112 3300005545 Ga0070695_100026646 Ga0070695_1000266464 118
113 3300005545 Ga0070695_100031307 Ga0070695_1000313071 118
114 3300005545 Ga0070695_100141072 Ga0070695_1001410724 118
115 3300005545 Ga0070695_100485606 Ga0070695_1004856062 118
116 3300005545 Ga0070695_100687629 Ga0070695_1006876292 118
117 3300005545 Ga0070695_101272979 Ga0070695_1012729791 118
118 3300005546 Ga0070696_100029015 Ga0070696_1000290155 118
119 3300005546 Ga0070696_100075059 Ga0070696_1000750592 118
120 3300005546 Ga0070696_100160365 Ga0070696_1001603654 118
121 3300005546 Ga0070696_100206865 Ga0070696_1002068651 118
122 3300005546 Ga0070696_100241887 Ga0070696_1002418871 118
123 3300005546 Ga0070696_100338142 Ga0070696_1003381422 118
124 3300005546 Ga0070696_100368546 Ga0070696_1003685462 118
125 3300005546 Ga0070696_100438461 Ga0070696_1004384612 118
126 3300005546 Ga0070696_100442244 Ga0070696_1004422441 118
127 3300005546 Ga0070696_101255112 Ga0070696_1012551122 118
128 3300005546 Ga0070696_101501741 Ga0070696_1015017412 118
129 3300005547 Ga0070693_100051202 Ga0070693_1000512024 118
130 3300005547 Ga0070693_100187688 Ga0070693_1001876882 118
131 3300005547 Ga0070693_100265882 Ga0070693_1002658822 118
132 3300005549 Ga0070704_100069852 Ga0070704_1000698524 118
133 3300005549 Ga0070704_100129221 Ga0070704_1001292214 118
134 3300005549 Ga0070704_100203790 Ga0070704_1002037904 118
135 3300005549 Ga0070704_100266307 Ga0070704_1002663071 118
136 3300005549 Ga0070704_101091672 Ga0070704_1010916722 118
137 3300005549 Ga0070704_101106416 Ga0070704_1011064162 118
138 3300005563 Ga0068855_100777780 Ga0068855_1007777802 118
139 3300005577 Ga0068857_100325486 Ga0068857_1003254864 118
140 3300005578 Ga0068854_100084875 Ga0068854_1000848752 118
141 3300005614 Ga0068856_100188274 Ga0068856_1001882744 118
142 3300005614 Ga0068856_101800911 Ga0068856_1018009112 118
143 3300005615 Ga0070702_100045349 Ga0070702_1000453493 118
144 3300005615 Ga0070702_100089935 Ga0070702_1000899354 118
145 3300005615 Ga0070702_100167399 Ga0070702_1001673992 118
146 3300005615 Ga0070702_100273543 Ga0070702_1002735432 118
147 3300005617 Ga0068859_100054594 Ga0068859_1000545947 118
148 3300005617 Ga0068859_100188149 Ga0068859_1001881494 118
149 3300005617 Ga0068859_100299024 Ga0068859_1002990243 118
150 3300005617 Ga0068859_100801290 Ga0068859_1008012901 118
151 3300005617 Ga0068859_100948811 Ga0068859_1009488112 118
152 3300005618 Ga0068864_100182993 Ga0068864_1001829932 118
153 3300005618 Ga0068864_101585004 Ga0068864_1015850042 118
154 3300005718 Ga0068866_10347163 Ga0068866_103471632 118
155 3300005719 Ga0068861_100508371 Ga0068861_1005083713 118
156 3300005719 Ga0068861_100681305 Ga0068861_1006813052 118
157 3300005840 Ga0068870_10426963 Ga0068870_104269632 118
158 3300005841 Ga0068863_101503799 Ga0068863_1015037992 118
159 3300005842 Ga0068858_100023814 Ga0068858_1000238149 118
160 3300005842 Ga0068858_101782523 Ga0068858_1017825232 118
161 3300005843 Ga0068860_100109367 Ga0068860_1001093674 118
162 3300005843 Ga0068860_100952298 Ga0068860_1009522983 118
163 3300005844 Ga0068862_100211533 Ga0068862_1002115334 118
164 3300005844 Ga0068862_100257889 Ga0068862_1002578894 118
165 3300005844 Ga0068862_100398441 Ga0068862_1003984413 118
166 3300005844 Ga0068862_101441351 Ga0068862_1014413512 118
167 3300005981 Ga0081538_10108255 Ga0081538_101082553 118
168 3300005985 Ga0081539_10004782 Ga0081539_1000478219 118
169 3300006163 Ga0070715_10135105 Ga0070715_101351053 118
170 3300006173 Ga0070716_100433289 Ga0070716_1004332893 118
171 3300006173 Ga0070716_100436828 Ga0070716_1004368283 118
172 3300006173 Ga0070716_100589231 Ga0070716_1005892312 118
173 3300006175 Ga0070712_101528012 Ga0070712_1015280121 118
174 3300006237 Ga0097621_100523859 Ga0097621_1005238592 118
175 3300006237 Ga0097621_101152387 Ga0097621_1011523872 118
176 3300006237 Ga0097621_101620359 Ga0097621_1016203592 118
177 3300006844 Ga0075428_100013956 Ga0075428_1000139564 118
178 3300006844 Ga0075428_100033964 Ga0075428_1000339649 118
179 3300006844 Ga0075428_100249469 Ga0075428_1002494693 118
180 3300006844 Ga0075428_100273746 Ga0075428_1002737462 118
181 3300006846 Ga0075430_100006977 Ga0075430_1000069777 118
182 3300006846 Ga0075430_100044517 Ga0075430_1000445173 118
183 3300006846 Ga0075430_100051971 Ga0075430_1000519714 118
184 3300006846 Ga0075430_100094969 Ga0075430_1000949696 118
185 3300006846 Ga0075430_100337202 Ga0075430_1003372023 118
186 3300006846 Ga0075430_100364272 Ga0075430_1003642723 118
187 3300006846 Ga0075430_101322881 Ga0075430_1013228812 118
188 3300006847 Ga0075431_100020329 Ga0075431_1000203296 118
189 3300006847 Ga0075431_100110864 Ga0075431_1001108644 118
190 3300006847 Ga0075431_100126308 Ga0075431_1001263085 118
191 3300006852 Ga0075433_10000480 Ga0075433_1000048028 118
192 3300006852 Ga0075433_10020641 Ga0075433_100206418 118
193 3300006852 Ga0075433_10286274 Ga0075433_102862743 118
194 3300006852 Ga0075433_10383488 Ga0075433_103834882 118
195 3300006852 Ga0075433_10467997 Ga0075433_104679972 118
196 3300006852 Ga0075433_10598315 Ga0075433_105983153 118
197 3300006852 Ga0075433_10697675 Ga0075433_106976752 118
198 3300006852 Ga0075433_11414364 Ga0075433_114143642 118
199 3300006871 Ga0075434_100000079 Ga0075434_10000007952 118
200 3300006871 Ga0075434_100001287 Ga0075434_10000128714 118
201 3300006871 Ga0075434_100020461 Ga0075434_1000204617 118
202 3300006871 Ga0075434_100126328 Ga0075434_1001263284 118
203 3300006871 Ga0075434_100784007 Ga0075434_1007840072 118
204 3300006871 Ga0075434_100863928 Ga0075434_1008639283 118
205 3300006871 Ga0075434_101147703 Ga0075434_1011477031 118
206 3300006880 Ga0075429_100000100 Ga0075429_10000010041 118
207 3300006880 Ga0075429_100367967 Ga0075429_1003679673 118
208 3300006880 Ga0075429_100407123 Ga0075429_1004071233 118
209 3300006880 Ga0075429_100518442 Ga0075429_1005184422 118
210 3300006881 Ga0068865_100208955 Ga0068865_1002089554 118
211 3300006881 Ga0068865_101397972 Ga0068865_1013979722 118
212 3300006881 Ga0068865_101698018 Ga0068865_1016980182 118
213 3300006914 Ga0075436_100000529 Ga0075436_1000005299 118
214 3300006914 Ga0075436_100000789 Ga0075436_1000007894 118
215 3300006914 Ga0075436_100061499 Ga0075436_1000614995 118
216 3300006914 Ga0075436_100106581 Ga0075436_1001065813 118
217 3300006914 Ga0075436_100150487 Ga0075436_1001504872 118
218 3300006931 Ga0097620_100054593 Ga0097620_1000545933 118
219 3300006931 Ga0097620_100188154 Ga0097620_1001881543 118
220 3300006931 Ga0097620_100299041 Ga0097620_1002990413 118
221 3300006931 Ga0097620_100801326 Ga0097620_1008013261 118
222 3300006931 Ga0097620_100948861 Ga0097620_1009488613 118
223 3300007076 Ga0075435_100000655 Ga0075435_10000065520 118
224 3300007076 Ga0075435_100003904 Ga0075435_1000039049 118
225 3300007076 Ga0075435_100009301 Ga0075435_1000093014 118
226 3300007076 Ga0075435_100049195 Ga0075435_1000491956 118
227 3300007076 Ga0075435_102014928 Ga0075435_1020149282 118
228 3300007265 Ga0099794_10007992 Ga0099794_100079923 118
229 3300007265 Ga0099794_10022268 Ga0099794_100222682 118
230 3300007788 Ga0099795_10283253 Ga0099795_102832532 118
231 3300007788 Ga0099795_10418362 Ga0099795_104183621 118
232 3300009092 Ga0105250_10077252 Ga0105250_100772523 118
233 3300009093 Ga0105240_12356249 Ga0105240_123562491 118
234 3300009094 Ga0111539_10013498 Ga0111539_100134989 118
235 3300009094 Ga0111539_10029705 Ga0111539_100297059 118
236 3300009094 Ga0111539_10036478 Ga0111539_100364789 118
237 3300009094 Ga0111539_10155934 Ga0111539_101559344 118
238 3300009094 Ga0111539_10201316 Ga0111539_102013162 118
239 3300009094 Ga0111539_10310723 Ga0111539_103107234 118
240 3300009094 Ga0111539_10320185 Ga0111539_103201854 118
241 3300009094 Ga0111539_11099843 Ga0111539_110998432 118
242 3300009094 Ga0111539_11661899 Ga0111539_116618992 118
243 3300009094 Ga0111539_11863665 Ga0111539_118636652 118
244 3300009094 Ga0111539_11935591 Ga0111539_119355912 118
245 3300009147 Ga0114129_10011817 Ga0114129_100118175 118
246 3300009147 Ga0114129_10105488 Ga0114129_101054885 118
247 3300009147 Ga0114129_10610148 Ga0114129_106101483 118
248 3300009147 Ga0114129_11383659 Ga0114129_113836592 118
249 3300009147 Ga0114129_11614027 Ga0114129_116140272 118
250 3300009147 Ga0114129_11744730 Ga0114129_117447302 118
251 3300009148 Ga0105243_10181886 Ga0105243_101818864 118
252 3300009148 Ga0105243_12286481 Ga0105243_122864812 118
253 3300009148 Ga0105243_12664274 Ga0105243_126642741 118
254 3300009177 Ga0105248_10668234 Ga0105248_106682342 118
255 3300009177 Ga0105248_12906309 Ga0105248_129063091 118
256 3300009553 Ga0105249_10096280 Ga0105249_100962805 118
257 3300009553 Ga0105249_10102987 Ga0105249_101029875 118
258 3300010159 Ga0099796_10075186 Ga0099796_100751862 118
259 3300010375 Ga0105239_10172608 Ga0105239_101726082 118
260 3300011119 Ga0105246_11618355 Ga0105246_116183552 118
261 3300013297 Ga0157378_11028577 Ga0157378_110285772 118
262 3300013306 Ga0163162_10169104 Ga0163162_101691042 118
263 3300013307 Ga0157372_11064740 Ga0157372_110647403 118
264 3300013307 Ga0157372_11661021 Ga0157372_116610212 118
265 3300013308 Ga0157375_11533541 Ga0157375_115335412 118
266 3300013308 Ga0157375_12859398 Ga0157375_128593982 118
267 3300014326 Ga0157380_10122036 Ga0157380_101220365 118
268 3300014326 Ga0157380_10328451 Ga0157380_103284512 118
269 3300014326 Ga0157380_11248357 Ga0157380_112483572 118
270 3300014745 Ga0157377_10958053 Ga0157377_109580532 118
271 3300014968 Ga0157379_10109750 Ga0157379_101097505 118
272 3300025885 Ga0207653_10305872 Ga0207653_103058721 118
273 3300025885 Ga0207653_10399583 Ga0207653_103995832 118
274 3300025898 Ga0207692_10040663 Ga0207692_100406634 118
275 3300025898 Ga0207692_10240455 Ga0207692_102404552 118
276 3300025899 Ga0207642_10057496 Ga0207642_100574962 118
277 3300025901 Ga0207688_10179994 Ga0207688_101799943 118
278 3300025905 Ga0207685_10294079 Ga0207685_102940792 118
279 3300025906 Ga0207699_11114596 Ga0207699_111145962 118
280 3300025907 Ga0207645_10079638 Ga0207645_100796384 118
281 3300025908 Ga0207643_10234840 Ga0207643_102348402 118
282 3300025910 Ga0207684_10189827 Ga0207684_101898273 118
283 3300025911 Ga0207654_10740362 Ga0207654_107403621 118
284 3300025912 Ga0207707_10007590 Ga0207707_100075908 118
285 3300025912 Ga0207707_10174695 Ga0207707_101746953 118
286 3300025916 Ga0207663_11220927 Ga0207663_112209271 118
287 3300025917 Ga0207660_10135994 Ga0207660_101359942 118
288 3300025917 Ga0207660_10484147 Ga0207660_104841472 118
289 3300025917 Ga0207660_10584725 Ga0207660_105847252 118
290 3300025918 Ga0207662_10011539 Ga0207662_100115397 118
291 3300025918 Ga0207662_10439632 Ga0207662_104396323 118
292 3300025918 Ga0207662_10765445 Ga0207662_107654452 118
293 3300025921 Ga0207652_10063323 Ga0207652_100633233 118
294 3300025921 Ga0207652_10734118 Ga0207652_107341182 118
295 3300025922 Ga0207646_10034021 Ga0207646_100340211 118
296 3300025922 Ga0207646_11315685 Ga0207646_113156852 118
297 3300025923 Ga0207681_10002005 Ga0207681_1000200514 118
298 3300025923 Ga0207681_10554103 Ga0207681_105541032 118
299 3300025924 Ga0207694_10966997 Ga0207694_109669972 118
300 3300025926 Ga0207659_10039287 Ga0207659_100392876 118
301 3300025928 Ga0207700_10419794 Ga0207700_104197941 118
302 3300025929 Ga0207664_10211487 Ga0207664_102114874 118
303 3300025933 Ga0207706_10044590 Ga0207706_100445906 118
304 3300025935 Ga0207709_10009164 Ga0207709_100091648 118
305 3300025935 Ga0207709_10237095 Ga0207709_102370952 118
306 3300025935 Ga0207709_10708040 Ga0207709_107080401 118
307 3300025935 Ga0207709_10985346 Ga0207709_109853462 118
308 3300025936 Ga0207670_10051873 Ga0207670_100518732 118
309 3300025936 Ga0207670_10139389 Ga0207670_101393894 118
310 3300025936 Ga0207670_10642978 Ga0207670_106429781 118
311 3300025936 Ga0207670_10695374 Ga0207670_106953742 118
312 3300025936 Ga0207670_10813710 Ga0207670_108137102 118
313 3300025936 Ga0207670_11198060 Ga0207670_111980602 118
314 3300025937 Ga0207669_10043573 Ga0207669_100435734 118
315 3300025938 Ga0207704_10016097 Ga0207704_100160974 118
316 3300025939 Ga0207665_10155307 Ga0207665_101553074 118
317 3300025939 Ga0207665_10167973 Ga0207665_101679734 118
318 3300025939 Ga0207665_10587247 Ga0207665_105872472 118
319 3300025940 Ga0207691_10152795 Ga0207691_101527953 118
320 3300025942 Ga0207689_10080631 Ga0207689_100806315 118
321 3300025942 Ga0207689_10109005 Ga0207689_101090054 118
322 3300025944 Ga0207661_10072757 Ga0207661_100727574 118
323 3300025949 Ga0207667_10645454 Ga0207667_106454542 118
324 3300025960 Ga0207651_10042207 Ga0207651_100422074 118
325 3300025961 Ga0207712_10047143 Ga0207712_100471433 118
326 3300025961 Ga0207712_10270191 Ga0207712_102701913 118
327 3300025961 Ga0207712_10388852 Ga0207712_103888522 118
328 3300025972 Ga0207668_10057398 Ga0207668_100573986 118
329 3300025981 Ga0207640_10117957 Ga0207640_101179573 118
330 3300026023 Ga0207677_10115093 Ga0207677_101150934 118
331 3300026035 Ga0207703_10029223 Ga0207703_100292238 118
332 3300026035 Ga0207703_11033217 Ga0207703_110332172 118
333 3300026075 Ga0207708_10079581 Ga0207708_100795813 118
334 3300026075 Ga0207708_10093074 Ga0207708_100930744 118
335 3300026075 Ga0207708_10097048 Ga0207708_100970482 118
336 3300026075 Ga0207708_10257402 Ga0207708_102574024 118
337 3300026078 Ga0207702_11432171 Ga0207702_114321712 118
338 3300026088 Ga0207641_10510824 Ga0207641_105108242 118
339 3300026088 Ga0207641_10761805 Ga0207641_107618053 118
340 3300026088 Ga0207641_10882191 Ga0207641_108821911 118
341 3300026089 Ga0207648_10051799 Ga0207648_100517994 118
342 3300026089 Ga0207648_11061352 Ga0207648_110613522 118
343 3300026095 Ga0207676_10219315 Ga0207676_102193153 118
344 3300026116 Ga0207674_10099832 Ga0207674_100998324 118
345 3300026116 Ga0207674_10217411 Ga0207674_102174114 118
346 3300026116 Ga0207674_10752728 Ga0207674_107527282 118
347 3300026118 Ga0207675_100038588 Ga0207675_1000385886 118
348 3300026118 Ga0207675_100770057 Ga0207675_1007700572 118
349 3300027360 Ga0209969_1004244 Ga0209969_10042442 118
350 3300027364 Ga0209967_1005391 Ga0209967_10053913 118
351 3300027364 Ga0209967_1008205 Ga0209967_10082053 118
352 3300027378 Ga0209981_1000836 Ga0209981_10008367 118
353 3300027378 Ga0209981_1006379 Ga0209981_10063794 118
354 3300027378 Ga0209981_1022610 Ga0209981_10226102 118
355 3300027395 Ga0209996_1020278 Ga0209996_10202782 118
356 3300027395 Ga0209996_1048160 Ga0209996_10481602 118
357 3300027462 Ga0210000_1002454 Ga0210000_10024544 118
358 3300027462 Ga0210000_1003595 Ga0210000_10035952 118
359 3300027462 Ga0210000_1019850 Ga0210000_10198502 118
360 3300027462 Ga0210000_1061270 Ga0210000_10612702 118
361 3300027471 Ga0209995_1009323 Ga0209995_10093232 118
362 3300027526 Ga0209968_1005969 Ga0209968_10059694 118
363 3300027543 Ga0209999_1011623 Ga0209999_10116234 118
364 3300027543 Ga0209999_1016133 Ga0209999_10161332 118
365 3300027543 Ga0209999_1020350 Ga0209999_10203502 118
366 3300027552 Ga0209982_1007530 Ga0209982_10075303 118
367 3300027614 Ga0209970_1080269 Ga0209970_10802692 118
368 3300027665 Ga0209983_1022842 Ga0209983_10228423 118
369 3300027671 Ga0209588_1070846 Ga0209588_10708463 118
370 3300027671 Ga0209588_1093254 Ga0209588_10932542 118
371 3300027682 Ga0209971_1003692 Ga0209971_10036924 118
372 3300027695 Ga0209966_1005356 Ga0209966_10053562 118
373 3300027695 Ga0209966_1009473 Ga0209966_10094733 118
374 3300027695 Ga0209966_1097057 Ga0209966_10970572 118
375 3300027876 Ga0209974_10023970 Ga0209974_100239704 118
376 3300027907 Ga0207428_10025385 Ga0207428_100253858 118
377 3300027907 Ga0207428_10040931 Ga0207428_100409314 118
378 3300027907 Ga0207428_10131119 Ga0207428_101311194 118
379 3300027907 Ga0207428_10253196 Ga0207428_102531962 118
380 3300027907 Ga0207428_10840033 Ga0207428_108400332 118
381 3300028380 Ga0268265_10001159 Ga0268265_1000115926 118
382 3300028380 Ga0268265_10287607 Ga0268265_102876072 118
383 3300028380 Ga0268265_10290618 Ga0268265_102906182 118
384 3300031548 Ga0307408_100137592 Ga0307408_1001375923 118
385 3300031548 Ga0307408_100414914 Ga0307408_1004149142 118
386 3300031548 Ga0307408_100542108 Ga0307408_1005421082 118
387 3300031731 Ga0307405_10707397 Ga0307405_107073972 118
388 3300031824 Ga0307413_10276368 Ga0307413_102763683 118
389 3300031824 Ga0307413_10288608 Ga0307413_102886082 118
390 3300031852 Ga0307410_11263433 Ga0307410_112634332 118
391 3300031901 Ga0307406_10672945 Ga0307406_106729452 118
392 3300031901 Ga0307406_10770264 Ga0307406_107702641 118
393 3300031903 Ga0307407_10532386 Ga0307407_105323862 118
394 3300031911 Ga0307412_10328122 Ga0307412_103281224 118
395 3300031911 Ga0307412_11312247 Ga0307412_113122472 118
396 3300031995 Ga0307409_100370250 Ga0307409_1003702503 118
397 3300032002 Ga0307416_100084117 Ga0307416_1000841172 118
398 3300032002 Ga0307416_101331134 Ga0307416_1013311342 118
399 3300032002 Ga0307416_102261756 Ga0307416_1022617562 118
400 3300032002 Ga0307416_102642827 Ga0307416_1026428272 118
401 3300032002 Ga0307416_102759232 Ga0307416_1027592322 118
402 3300032002 Ga0307416_103120348 Ga0307416_1031203481 118
403 3300032005 Ga0307411_10031659 Ga0307411_100316594 118
404 3300032005 Ga0307411_10046102 Ga0307411_100461026 118
405 3300032005 Ga0307411_10538554 Ga0307411_105385542 118
406 3300032126 Ga0307415_101164953 Ga0307415_1011649532 118
407 3300034820 Ga0373959_0039589 Ga0373959_0039589_338_700 118
408 3300034957 Ga0373938_0014497 Ga0373938_0014497_380_748 118
409 3300034957 Ga0373938_0049865 Ga0373938_0049865_565_927 118
410 3300035083 Ga0373926_0029654 Ga0373926_0029654_161_523 118
411 3300035092 Ga0373952_0060084 Ga0373952_0060084_293_655 118
412 3300035112 Ga0373932_0198017 Ga0373932_0198017_133_501 118
413 3300035113 Ga0373936_0054593 Ga0373936_0054593_299_661 118
414 3300035113 Ga0373936_0117177 Ga0373936_0117177_288_650 118
415 3300035114 Ga0373939_0055492 Ga0373939_0055492_701_1060 118
416 3300035114 Ga0373939_0098681 Ga0373939_0098681_316_675 118
417 3300035117 Ga0373953_0028337 Ga0373953_0028337_65_427 118
418 3300035117 Ga0373953_0220347 Ga0373953_0220347_140_499 118
419 3300035118 Ga0373954_0001511 Ga0373954_0001511_7901_8275 118
420 3300035119 Ga0373956_0165188 Ga0373956_0165188_272_631 118
421 3300035121 Ga0373960_0053316 Ga0373960_0053316_610_978 118
422 3300035121 Ga0373960_0115977 Ga0373960_0115977_49_411 118
423 3300035121 Ga0373960_0186225 Ga0373960_0186225_126_482 118
424 3300035172 Ga0373955_0003334 Ga0373955_0003334_3408_3770 118
425 3300035172 Ga0373955_0127557 Ga0373955_0127557_684_1058 118
426 3300035172 Ga0373955_0548087 Ga0373955_0548087_247_606 118
427 3300035207 Ga0373942_0002391 Ga0373942_0002391_3230_3604 118
428 3300035241 Ga0373961_0015462 Ga0373961_0015462_854_1222 118
429 3300035241 Ga0373961_0020738 Ga0373961_0020738_1273_1635 118
430 3300035410 Ga0373924_0043921 Ga0373924_0043921_565_927 118
431 3300035410 Ga0373924_0094759 Ga0373924_0094759_779_1141 118
432 3300035691 Ga0373931_0008167 Ga0373931_0008167_1257_1619 118
433 3300035691 Ga0373931_0674708 Ga0373931_0674708_247_606 118
434 3300035692 Ga0373935_0572217 Ga0373935_0572217_137_496 118
435 3300035724 Ga0373933_0011855 Ga0373933_0011855_1511_1873 118
436 3300035724 Ga0373933_0018495 Ga0373933_0018495_2575_2949 118
437 3300035724 Ga0373933_0359974 Ga0373933_0359974_223_582 118
438 3300035725 Ga0373947_0058905 Ga0373947_0058905_602_964 118
439 3300036401 Ga0373937_0001313 Ga0373937_0001313_4049_4423 118
440 3300036401 Ga0373937_0019027 Ga0373937_0019027_3781_4140 118
441 3300036401 Ga0373937_0033470 Ga0373937_0033470_3914_4276 118
442 3300036401 Ga0373937_0117971 Ga0373937_0117971_454_828 118
443 3300037068 Ga0373925_0059535 Ga0373925_0059535_103_465 118
444 3300039437 Ga0436365_1920613 Ga0436365_1920613_88_447 118
445 3300041406 Ga0439439_0058260 Ga0439439_0058260_384_755 118
446 3300041408 Ga0439453_0035069 Ga0439453_0035069_145_516 118
447 3300041410 Ga0439461_0098261 Ga0439461_0098261_283_642 118
448 3300041460 Ga0451802_0106108 Ga0451802_0106108_84_446 118
449 3300041496 Ga0451839_0301690 Ga0451839_0301690_179_535 118
450 3300042001 Ga0439441_000219 Ga0439441_000219_4162_4533 118
451 3300042001 Ga0439441_148769 Ga0439441_148769_99_470 118
452 3300042003 Ga0439443_016332 Ga0439443_016332_578_949 118
453 3300042003 Ga0439443_050491 Ga0439443_050491_274_645 118
454 3300042011 Ga0439454_035451 Ga0439454_035451_415_786 118
455 3300042013 Ga0439456_012653 Ga0439456_012653_582_953 118
456 3300042125 Ga0450923_094551 Ga0450923_094551_141_512 118
457 3300042156 Ga0439446_0029196 Ga0439446_0029196_300_659 118
458 3300042156 Ga0439446_0105136 Ga0439446_0105136_513_884 118
459 3300042435 Ga0439434_0000867 Ga0439434_0000867_3730_4089 118
460 3300042435 Ga0439434_0073656 Ga0439434_0073656_236_595 118
461 3300042435 Ga0439434_0274291 Ga0439434_0274291_39_410 118
462 3300042436 Ga0439435_0007268 Ga0439435_0007268_1646_2005 118
463 3300042437 Ga0439444_0003897 Ga0439444_0003897_41_412 118
464 3300042438 Ga0439459_0081256 Ga0439459_0081256_98_460 118
465 3300042461 Ga0439460_0058644 Ga0439460_0058644_336_707 118
466 3300042532 Ga0450893_0068260 Ga0450893_0068260_301_672 118
467 3300042876 Ga0451577_0642743 Ga0451577_0642743_446_805 118
468 3300042876 Ga0451577_1385759 Ga0451577_1385759_189_548 118
469 3300044673 Ga0453683_0541986 Ga0453683_0541986_319_678 118
470 3300044673 Ga0453683_0930934 Ga0453683_0930934_171_530 118
471 3300044694 Ga0466963_0246298 Ga0466963_0246298_192_557 118
472 3300044901 Ga0466960_0068503 Ga0466960_0068503_238_594 118
473 3300044901 Ga0466960_0344018 Ga0466960_0344018_111_470 118
474 3300045051 Ga0451576_0106040 Ga0451576_0106040_355_714 118
475 3300045051 Ga0451576_0136400 Ga0451576_0136400_923_1282 118
476 3300045051 Ga0451576_0226550 Ga0451576_0226550_1219_1581 118
477 3300045051 Ga0451576_0226592 Ga0451576_0226592_267_629 118
478 3300045051 Ga0451576_2413427 Ga0451576_2413427_49_411 118
479 3300045836 Ga0466958_0076169 Ga0466958_0076169_80_445 118
480 3300045976 Ga0466967_0008116 Ga0466967_0008116_4914_5279 118
481 3300046454 Ga0495592_0695869 Ga0495592_0695869_106_465 118
482 3300046455 Ga0495603_0238847 Ga0495603_0238847_603_974 118
483 3300046457 Ga0495590_0354744 Ga0495590_0354744_13_369 118
484 3300046459 Ga0495629_0060679 Ga0495629_0060679_110_469 118
485 3300046462 Ga0495651_0165640 Ga0495651_0165640_246_605 118
486 3300046476 Ga0495662_0031220 Ga0495662_0031220_617_976 118
487 3300046476 Ga0495662_0138463 Ga0495662_0138463_56_418 118
488 3300046491 Ga0495584_0050854 Ga0495584_0050854_329_700 118
489 3300046491 Ga0495584_0087837 Ga0495584_0087837_650_1009 118
490 3300046491 Ga0495584_0249144 Ga0495584_0249144_449_808 118
491 3300046511 Ga0495608_0000767 Ga0495608_0000767_6371_6730 118
492 3300046511 Ga0495608_0310669 Ga0495608_0310669_10_384 118
493 3300046514 Ga0495618_0033918 Ga0495618_0033918_170_529 118
494 3300046516 Ga0495628_0003354 Ga0495628_0003354_4836_5195 118
495 3300046516 Ga0495628_0536684 Ga0495628_0536684_217_576 118
496 3300046517 Ga0495630_0020245 Ga0495630_0020245_1803_2162 118
497 3300046523 Ga0495644_0096494 Ga0495644_0096494_530_904 118
498 3300046526 Ga0495666_0005319 Ga0495666_0005319_3977_4336 118
499 3300046528 Ga0495642_0091091 Ga0495642_0091091_87_446 118
500 3300046528 Ga0495642_0108562 Ga0495642_0108562_11_370 118
501 3300046529 Ga0495652_0595961 Ga0495652_0595961_248_607 118
502 3300046533 Ga0495640_0013075 Ga0495640_0013075_2195_2554 118
503 3300046533 Ga0495640_0024651 Ga0495640_0024651_240_599 118
504 3300046535 Ga0495586_0020862 Ga0495586_0020862_2542_2901 118
505 3300046536 Ga0495587_0028889 Ga0495587_0028889_1101_1460 118
506 3300046538 Ga0495609_0179220 Ga0495609_0179220_300_659 118
507 3300046543 Ga0495645_0028191 Ga0495645_0028191_2147_2506 118
508 3300046559 Ga0495667_0014877 Ga0495667_0014877_2596_2955 118
509 3300046559 Ga0495667_0120746 Ga0495667_0120746_897_1259 118
510 3300046642 Ga0495634_0004750 Ga0495634_0004750_1808_2167 118
511 3300046663 Ga0495635_0075811 Ga0495635_0075811_1837_2196 118
512 3300046663 Ga0495635_0098814 Ga0495635_0098814_759_1121 118
513 3300046664 Ga0495659_0149090 Ga0495659_0149090_473_832 118
514 3300046664 Ga0495659_0232069 Ga0495659_0232069_270_629 118
515 3300046664 Ga0495659_0274160 Ga0495659_0274160_233_592 118
516 3300046675 Ga0495657_0350814 Ga0495657_0350814_309_671 118
517 3300046678 Ga0495599_0094489 Ga0495599_0094489_1286_1645 118
518 3300046679 Ga0495623_0097921 Ga0495623_0097921_1095_1454 118
519 3300046679 Ga0495623_0402531 Ga0495623_0402531_52_414 118
520 3300046680 Ga0495646_0255191 Ga0495646_0255191_135_494 118
521 3300046683 Ga0495658_0033007 Ga0495658_0033007_2195_2554 118
522 3300046684 Ga0495669_0016877 Ga0495669_0016877_1305_1664 118
523 3300046684 Ga0495669_0081557 Ga0495669_0081557_560_931 118
524 3300046684 Ga0495669_0168285 Ga0495669_0168285_316_672 118
525 3300046689 Ga0495613_0027811 Ga0495613_0027811_1472_1831 118
526 3300046690 Ga0495624_0051034 Ga0495624_0051034_929_1288 118
527 3300046692 Ga0495671_0604241 Ga0495671_0604241_40_411 118
528 3300046809 Ga0495600_0014090 Ga0495600_0014090_2355_2714 118
529 3300046809 Ga0495600_0780057 Ga0495600_0780057_169_528 118
530 3300047317 Ga0495604_0003259 Ga0495604_0003259_10744_11103 118
531 3300047317 Ga0495604_0115359 Ga0495604_0115359_491_850 118
532 3300047317 Ga0495604_0165596 Ga0495604_0165596_335_697 118
533 3300047317 Ga0495604_0858958 Ga0495604_0858958_76_450 118
534 3300047318 Ga0495636_0017357 Ga0495636_0017357_2128_2487 118
535 3300047319 Ga0495674_0164174 Ga0495674_0164174_1297_1656 118
536 3300047322 Ga0495680_0007743 Ga0495680_0007743_6765_7124 118
537 3300047322 Ga0495680_0182929 Ga0495680_0182929_482_844 118
538 3300049513 Ga0501290_028777 Ga0501290_028777_271_630 118
539 3300049513 Ga0501290_056162 Ga0501290_056162_16_375 118
540 3300049514 Ga0501291_051778 Ga0501291_051778_153_512 118
541 3300049514 Ga0501291_155202 Ga0501291_155202_94_453 118
542 3300049519 Ga0501296_024027 Ga0501296_024027_335_694 118
543 3300049522 Ga0501299_017791 Ga0501299_017791_134_505 118
544 3300049568 Ga0501031_0071786 Ga0501031_0071786_1453_1815 118
545 3300049568 Ga0501031_0259271 Ga0501031_0259271_372_731 118
546 3300049569 Ga0501032_0117810 Ga0501032_0117810_1156_1518 118
547 3300049570 Ga0501033_0038508 Ga0501033_0038508_288_650 118
548 3300049570 Ga0501033_0248006 Ga0501033_0248006_34_405 118
549 3300049572 Ga0501036_0098691 Ga0501036_0098691_1094_1456 118
550 3300049572 Ga0501036_0399362 Ga0501036_0399362_528_899 118
551 3300049572 Ga0501036_0706092 Ga0501036_0706092_54_425 118
552 3300049573 Ga0501037_0077355 Ga0501037_0077355_1733_2095 118
553 3300049573 Ga0501037_0276465 Ga0501037_0276465_622_981 118
554 3300049573 Ga0501037_0292492 Ga0501037_0292492_236_607 118
555 3300049574 Ga0501038_0012391 Ga0501038_0012391_1317_1679 118
556 3300049575 Ga0501039_0028433 Ga0501039_0028433_133_504 118
557 3300049575 Ga0501039_0048062 Ga0501039_0048062_1146_1541 118
558 3300049575 Ga0501039_0066519 Ga0501039_0066519_1240_1602 118
559 3300049575 Ga0501039_0953095 Ga0501039_0953095_135_491 118
560 3300049576 Ga0501040_0004390 Ga0501040_0004390_7086_7448 118
561 3300049576 Ga0501040_0309215 Ga0501040_0309215_540_899 118
562 3300049577 Ga0501041_0026263 Ga0501041_0026263_63_422 118
563 3300049577 Ga0501041_0028785 Ga0501041_0028785_1402_1764 118
564 3300049577 Ga0501041_0168708 Ga0501041_0168708_735_1094 118
565 3300049578 Ga0501042_0003021 Ga0501042_0003021_5423_5785 118
566 3300049578 Ga0501042_0342532 Ga0501042_0342532_554_913 118
567 3300049578 Ga0501042_0371039 Ga0501042_0371039_386_757 118
568 3300049578 Ga0501042_0847043 Ga0501042_0847043_186_548 118
569 3300049579 Ga0501043_0039549 Ga0501043_0039549_3088_3450 118
570 3300049579 Ga0501043_1234851 Ga0501043_1234851_45_404 118
571 3300049580 Ga0501046_0003243 Ga0501046_0003243_4438_4800 118
572 3300049580 Ga0501046_0025733 Ga0501046_0025733_3417_3788 118
573 3300049580 Ga0501046_0194088 Ga0501046_0194088_1113_1472 118
574 3300049580 Ga0501046_0315807 Ga0501046_0315807_54_413 118
575 3300049582 Ga0501048_0007325 Ga0501048_0007325_2892_3254 118
576 3300049582 Ga0501048_0095589 Ga0501048_0095589_1336_1707 118
577 3300049582 Ga0501048_0255963 Ga0501048_0255963_760_1131 118
578 3300049582 Ga0501048_0294256 Ga0501048_0294256_640_999 118
579 3300049583 Ga0501067_0284097 Ga0501067_0284097_234_590 118
580 3300049583 Ga0501067_0523826 Ga0501067_0523826_97_456 118
581 3300049584 Ga0501068_0002746 Ga0501068_0002746_5962_6324 118
582 3300049584 Ga0501068_0181367 Ga0501068_0181367_314_673 118
583 3300049584 Ga0501068_0325359 Ga0501068_0325359_187_549 118
584 3300049585 Ga0501069_0024556 Ga0501069_0024556_657_1013 118
585 3300049585 Ga0501069_0290424 Ga0501069_0290424_332_688 118
586 3300049585 Ga0501069_0538260 Ga0501069_0538260_219_575 118
587 3300049586 Ga0501070_0086060 Ga0501070_0086060_563_925 118
588 3300049586 Ga0501070_0730260 Ga0501070_0730260_195_554 118
589 3300049587 Ga0501071_0005475 Ga0501071_0005475_1547_1906 118
590 3300049587 Ga0501071_0018923 Ga0501071_0018923_1438_1800 118
591 3300049587 Ga0501071_0029827 Ga0501071_0029827_2116_2487 118
592 3300049587 Ga0501071_0237264 Ga0501071_0237264_115_474 118
593 3300049587 Ga0501071_0252574 Ga0501071_0252574_826_1221 118
594 3300049587 Ga0501071_0352656 Ga0501071_0352656_451_810 118
595 3300049587 Ga0501071_0387803 Ga0501071_0387803_473_832 118
596 3300049587 Ga0501071_0775939 Ga0501071_0775939_141_500 118
597 3300049588 Ga0501072_0007949 Ga0501072_0007949_3115_3486 118
598 3300049588 Ga0501072_0011492 Ga0501072_0011492_2232_2594 118
599 3300049588 Ga0501072_0019791 Ga0501072_0019791_255_614 118
600 3300049588 Ga0501072_0032348 Ga0501072_0032348_1759_2130 118
601 3300049588 Ga0501072_0106058 Ga0501072_0106058_1845_2216 118
602 3300049588 Ga0501072_0455327 Ga0501072_0455327_319_678 118
603 3300049588 Ga0501072_0783434 Ga0501072_0783434_338_697 118
604 3300049589 Ga0501073_0081968 Ga0501073_0081968_1240_1626 118
605 3300049589 Ga0501073_0567593 Ga0501073_0567593_292_663 118
606 3300049589 Ga0501073_0831295 Ga0501073_0831295_137_505 118
607 3300049590 Ga0501074_0022089 Ga0501074_0022089_1321_1683 118
608 3300049590 Ga0501074_0060359 Ga0501074_0060359_670_1041 118
609 3300049591 Ga0501075_0002198 Ga0501075_0002198_328_699 118
610 3300049591 Ga0501075_0004962 Ga0501075_0004962_5537_5899 118
611 3300049591 Ga0501075_0158338 Ga0501075_0158338_176_535 118
612 3300049591 Ga0501075_1092638 Ga0501075_1092638_110_469 118
613 3300049591 Ga0501075_1111525 Ga0501075_1111525_196_558 118
614 3300049592 Ga0501076_0000429 Ga0501076_0000429_599_994 118
615 3300049592 Ga0501076_0023753 Ga0501076_0023753_2610_2972 118
616 3300049592 Ga0501076_0037359 Ga0501076_0037359_514_873 118
617 3300049592 Ga0501076_0828663 Ga0501076_0828663_52_411 118
618 3300049592 Ga0501076_0948510 Ga0501076_0948510_52_411 118
619 3300049592 Ga0501076_1447674 Ga0501076_1447674_178_537 118
620 3300049593 Ga0501077_0022192 Ga0501077_0022192_95_457 118
621 3300049593 Ga0501077_0223566 Ga0501077_0223566_294_665 118
622 3300049741 Ga0501079_0021474 Ga0501079_0021474_224_583 118
623 3300049741 Ga0501079_0041234 Ga0501079_0041234_1716_2078 118
624 3300049741 Ga0501079_0095219 Ga0501079_0095219_788_1159 118
625 3300049741 Ga0501079_0438437 Ga0501079_0438437_615_986 118
626 3300049742 Ga0501080_0000634 Ga0501080_0000634_7409_7768 118
627 3300049742 Ga0501080_0018543 Ga0501080_0018543_5655_6026 118
628 3300049742 Ga0501080_0034438 Ga0501080_0034438_1267_1629 118
629 3300049742 Ga0501080_0257367 Ga0501080_0257367_895_1257 118
630 3300049743 Ga0501081_0007073 Ga0501081_0007073_3528_3899 118
631 3300049743 Ga0501081_0025861 Ga0501081_0025861_2354_2716 118
632 3300049743 Ga0501081_0300506 Ga0501081_0300506_634_993 118
633 3300049744 Ga0501083_1150845 Ga0501083_1150845_126_485 118
634 3300049770 Ga0501273_029267 Ga0501273_029267_117_476 118
635 3300049779 Ga0501283_040433 Ga0501283_040433_324_683 118
636 3300049822 Ga0501035_0343165 Ga0501035_0343165_721_1092 118
637 3300049823 Ga0501044_0117696 Ga0501044_0117696_906_1268 118
638 3300049824 Ga0501045_0038739 Ga0501045_0038739_1814_2176 118
639 3300049824 Ga0501045_0866118 Ga0501045_0866118_87_458 118
640 3300050507 nmdc:mga05p37_1255_c1 nmdc:mga05p37_1255_c1_7421_7783 118
641 3300050507 nmdc:mga05p37_326471_c1 nmdc:mga05p37_326471_c1_24_386 118
642 3300050507 nmdc:mga05p37_46253_c1 nmdc:mga05p37_46253_c1_3955_4317 118
643 3300050507 nmdc:mga05p37_543024_c1 nmdc:mga05p37_543024_c1_244_615 118
644 3300050507 nmdc:mga05p37_557944_c1 nmdc:mga05p37_557944_c1_295_666 118
645 3300050507 nmdc:mga05p37_896453_c1 nmdc:mga05p37_896453_c1_480_851 118
646 3300050508 nmdc:mga09592_109_c1 nmdc:mga09592_109_c1_15730_16092 118
647 3300050508 nmdc:mga09592_120181_c1 nmdc:mga09592_120181_c1_373_741 118
648 3300050508 nmdc:mga09592_160785_c1 nmdc:mga09592_160785_c1_325_684 118
649 3300050508 nmdc:mga09592_51500_c1 nmdc:mga09592_51500_c1_1890_2261 118
650 3300050509 nmdc:mga0qj67_139878_c1 nmdc:mga0qj67_139878_c1_1507_1878 118
651 3300050509 nmdc:mga0qj67_2200_c1 nmdc:mga0qj67_2200_c1_3180_3539 118
652 3300050509 nmdc:mga0qj67_38319_c1 nmdc:mga0qj67_38319_c1_1713_2081 118
653 3300050509 nmdc:mga0qj67_448253_c1 nmdc:mga0qj67_448253_c1_62_421 118
654 3300050509 nmdc:mga0qj67_631194_c1 nmdc:mga0qj67_631194_c1_195_554 118
655 3300050509 nmdc:mga0qj67_6675_c1 nmdc:mga0qj67_6675_c1_1825_2196 118
656 3300050509 nmdc:mga0qj67_715935_c1 nmdc:mga0qj67_715935_c1_260_631 118
657 3300050510 nmdc:mga06r32_151321_c1 nmdc:mga06r32_151321_c1_796_1155 118
658 3300050510 nmdc:mga06r32_296652_c1 nmdc:mga06r32_296652_c1_711_1070 118
659 3300050510 nmdc:mga06r32_328435_c1 nmdc:mga06r32_328435_c1_854_1213 118
660 3300050510 nmdc:mga06r32_392232_c1 nmdc:mga06r32_392232_c1_608_979 118
661 3300050510 nmdc:mga06r32_7661_c1 nmdc:mga06r32_7661_c1_1367_1729 118
662 3300050511 nmdc:mga08y16_10670_c1 nmdc:mga08y16_10670_c1_6397_6756 118
663 3300050511 nmdc:mga08y16_124577_c1 nmdc:mga08y16_124577_c1_837_1196 118
664 3300050511 nmdc:mga08y16_1390157_c1 nmdc:mga08y16_1390157_c1_115_474 118
665 3300050511 nmdc:mga08y16_1392374_c1 nmdc:mga08y16_1392374_c1_269_628 118
666 3300050511 nmdc:mga08y16_205809_c1 nmdc:mga08y16_205809_c1_1085_1444 118
667 3300050511 nmdc:mga08y16_58461_c1 nmdc:mga08y16_58461_c1_2340_2711 118
668 3300050511 nmdc:mga08y16_624448_c1 nmdc:mga08y16_624448_c1_300_659 118
669 3300050511 nmdc:mga08y16_660425_c1 nmdc:mga08y16_660425_c1_214_588 118
670 3300050511 nmdc:mga08y16_73557_c1 nmdc:mga08y16_73557_c1_1944_2303 118
671 3300050511 nmdc:mga08y16_805050_c1 nmdc:mga08y16_805050_c1_479_850 118
672 3300050511 nmdc:mga08y16_85617_c1 nmdc:mga08y16_85617_c1_1844_2215 118
673 3300050512 nmdc:mga0n895_12039_c1 nmdc:mga0n895_12039_c1_516_887 118
674 3300050512 nmdc:mga0n895_734_c1 nmdc:mga0n895_734_c1_3926_4288 118
675 3300050512 nmdc:mga0n895_741372_c1 nmdc:mga0n895_741372_c1_200_559 118
676 3300050512 nmdc:mga0n895_749808_c1 nmdc:mga0n895_749808_c1_83_439 118
677 3300050512 nmdc:mga0n895_787149_c1 nmdc:mga0n895_787149_c1_96_455 118
678 3300050512 nmdc:mga0n895_7924_c1 nmdc:mga0n895_7924_c1_5209_5580 118
679 3300050513 nmdc:mga0rr50_135268_c1 nmdc:mga0rr50_135268_c1_1151_1510 118
680 3300050513 nmdc:mga0rr50_2416_c1 nmdc:mga0rr50_2416_c1_5255_5617 118
681 3300050513 nmdc:mga0rr50_3670_c1 nmdc:mga0rr50_3670_c1_4781_5152 118
682 3300050513 nmdc:mga0rr50_509898_c1 nmdc:mga0rr50_509898_c1_342_713 118
683 3300050513 nmdc:mga0rr50_647896_c1 nmdc:mga0rr50_647896_c1_252_611 118
684 3300050513 nmdc:mga0rr50_92416_c1 nmdc:mga0rr50_92416_c1_1762_2124 118
685 3300050514 nmdc:mga08x19_1688_c1 nmdc:mga08x19_1688_c1_9356_9712 118
686 3300050514 nmdc:mga08x19_193748_c1 nmdc:mga08x19_193748_c1_816_1187 118
687 3300050514 nmdc:mga08x19_258_c1 nmdc:mga08x19_258_c1_11452_11811 118
688 3300050514 nmdc:mga08x19_41543_c1 nmdc:mga08x19_41543_c1_1918_2280 118
689 3300050514 nmdc:mga08x19_415502_c1 nmdc:mga08x19_415502_c1_312_671 118
690 3300050514 nmdc:mga08x19_71597_c1 nmdc:mga08x19_71597_c1_728_1099 118
691 3300050515 nmdc:mga0a205_1601770_c1 nmdc:mga0a205_1601770_c1_24_380 118
692 3300050515 nmdc:mga0a205_169979_c1 nmdc:mga0a205_169979_c1_259_621 118
693 3300050515 nmdc:mga0a205_174980_c1 nmdc:mga0a205_174980_c1_1177_1536 118
694 3300050515 nmdc:mga0a205_20918_c1 nmdc:mga0a205_20918_c1_3776_4147 118
695 3300050515 nmdc:mga0a205_783914_c1 nmdc:mga0a205_783914_c1_67_429 118
696 3300050515 nmdc:mga0a205_94583_c1 nmdc:mga0a205_94583_c1_583_945 118
697 3300053077 Ga0495601_0031047 Ga0495601_0031047_2668_3027 118
698 3300054114 Ga0501084_0005520 Ga0501084_0005520_1592_1954 118
699 3300054114 Ga0501084_0015444 Ga0501084_0015444_2997_3368 118
700 3300054114 Ga0501084_0108528 Ga0501084_0108528_717_1076 118
701 3300054114 Ga0501084_0254343 Ga0501084_0254343_846_1208 118
702 3300059421 Ga0590071_110935 Ga0590071_110935_115_474 118
703 3300059421 Ga0590071_200354 Ga0590071_200354_115_474 118
704 3300060353 Ga0501082_0029179 Ga0501082_0029179_3498_3860 118
705 3300060353 Ga0501082_0078152 Ga0501082_0078152_1019_1414 118
706 3300060353 Ga0501082_1587434 Ga0501082_1587434_138_509 118
707 3300061734 Ga0530510_0000245 Ga0530510_0000245_34_405 118
708 3300061734 Ga0530510_0034283 Ga0530510_0034283_1886_2248 118
709 3300061734 Ga0530510_0127461 Ga0530510_0127461_135_506 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

3

113

0.96

PF01230

HIT

HIT domain

11

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5km6-assembly1.cif.gz_A-2 human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex 0.9516 5 109
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9451 5 109
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9445 5 109
3o1z-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) double cysteine mutant from rabbit 0.9412 5 109
7q2u-assembly2.cif.gz_DDD the crystal structure of the hint1 q62a mutant. 0.9406 5 109
ID Description Score Start End Superfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9333 5 109 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9185 17 109 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9152 2 115 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9077 2 115 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.907 1 114 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2W5IG94-F1-model_v4 deleted 0.966 3 117
AF-A0A356HRU5-F1-model_v4 deleted 0.9632 2 108
AF-A0A0J6NQ96-F1-model_v4 HIT family hydrolase 0.962 3 106 GO:0016787
AF-A0A1W9GZF2-F1-model_v4 Histidine triad nucleotide-binding protein 0.9603 3 118 GO:0003824
AF-A0A1H6FFC4-F1-model_v4 HIT-like protein (EC 3.-.-.-) 0.9593 2 110 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map