F476636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 287 | 709 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100076417|Ga0070680_1000764173 |
| Length | 330 |
| Sequence | VPEGNTSEPFTYAHAGVDIATADRAKERIKFLAQKTFNRNVLGGIGGFGALFRLDLQRWKNPILVSSADGVGTKLKVAFALGLHHTVGADLVNHCVNDIAVQGATPLFFLDYFASGKLDPEVTESVISGLADACRANGCALIGGETAQMPGFYADGEYDLAGFIVGAVDRDKMITGAAIKPGDVLIGLPSTGLHTNGYSLARKLLFEVAGYKPTQYVTAIREKAGAALLKTHRSYLHVIQKLTAGGLTTGMAHAQVEIGSWPVLPIFEHLRDLGHISQDEMMRTFNMGIGLIAAIPAAKFTRAKNLLDRAEEKFYVVGRTVKGERRVQYT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 183 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 203 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 284 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 285 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 286 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 4.23 |
| Rhizosphere | 95.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000170 | 3300000546 | Bacteria | 10703 |
| 2 | Ga0065712_10006833 | 3300005290 | Bacteria | 4704 |
| 3 | Ga0065712_10122814 | 3300005290 | Bacteria | 1636 |
| 4 | Ga0065715_10119435 | 3300005293 | Bacteria | 2274 |
| 5 | Ga0065707_10084507 | 3300005295 | Bacteria | 7130 |
| 6 | Ga0070658_10013778 | 3300005327 | Bacteria | 6489 |
| 7 | Ga0070683_100000210 | 3300005329 | Bacteria | 39660 |
| 8 | Ga0070683_100000219 | 3300005329 | Bacteria | 39225 |
| 9 | Ga0070683_100008686 | 3300005329 | Bacteria | 8637 |
| 10 | Ga0070683_100052357 | 3300005329 | Bacteria | 3781 |
| 11 | Ga0070683_100160702 | 3300005329 | Bacteria | 2131 |
| 12 | Ga0070670_100002071 | 3300005331 | Bacteria | 16420 |
| 13 | Ga0070670_100005558 | 3300005331 | Bacteria | 10636 |
| 14 | Ga0070670_100021126 | 3300005331 | Bacteria | 5599 |
| 15 | Ga0070670_100047338 | 3300005331 | Bacteria | 3700 |
| 16 | Ga0070670_100120931 | 3300005331 | Bacteria | 2259 |
| 17 | Ga0068869_100000308 | 3300005334 | Bacteria | 26106 |
| 18 | Ga0068869_100012602 | 3300005334 | Bacteria | 5592 |
| 19 | Ga0068869_100155207 | 3300005334 | Bacteria | 1778 |
| 20 | Ga0070666_10007292 | 3300005335 | Bacteria | 6812 |
| 21 | Ga0070666_10078652 | 3300005335 | Bacteria | 2251 |
| 22 | Ga0070666_10150146 | 3300005335 | Bacteria | 1626 |
| 23 | Ga0070680_100076417 | 3300005336 | Bacteria | 2757 |
| 24 | Ga0068868_100000046 | 3300005338 | Bacteria | 68441 |
| 25 | Ga0068868_100000672 | 3300005338 | Bacteria | 22916 |
| 26 | Ga0068868_100004012 | 3300005338 | Bacteria | 10279 |
| 27 | Ga0068868_100020771 | 3300005338 | Bacteria | 4940 |
| 28 | Ga0068868_100026074 | 3300005338 | Bacteria | 4451 |
| 29 | Ga0068868_100138296 | 3300005338 | Bacteria | 1998 |
| 30 | Ga0070660_100017822 | 3300005339 | Bacteria | 5180 |
| 31 | Ga0070689_100017917 | 3300005340 | Bacteria | 5207 |
| 32 | Ga0070661_100003076 | 3300005344 | Bacteria | 11480 |
| 33 | Ga0070661_100008061 | 3300005344 | Bacteria | 7270 |
| 34 | Ga0070661_100019594 | 3300005344 | Bacteria | 4822 |
| 35 | Ga0070669_100040918 | 3300005353 | Bacteria | 3369 |
| 36 | Ga0070669_100097632 | 3300005353 | Bacteria | 2212 |
| 37 | Ga0070669_100220675 | 3300005353 | Bacteria | 1499 |
| 38 | Ga0070675_100027795 | 3300005354 | Bacteria | 4548 |
| 39 | Ga0070675_100041425 | 3300005354 | Bacteria | 3762 |
| 40 | Ga0070675_100138379 | 3300005354 | Bacteria | 2079 |
| 41 | Ga0070675_100157962 | 3300005354 | Bacteria | 1948 |
| 42 | Ga0070675_100230880 | 3300005354 | Bacteria | 1614 |
| 43 | Ga0070671_100006477 | 3300005355 | Bacteria | 9362 |
| 44 | Ga0070671_100093079 | 3300005355 | Bacteria | 2526 |
| 45 | Ga0070671_100301754 | 3300005355 | Bacteria | 1364 |
| 46 | Ga0070674_100010619 | 3300005356 | Bacteria | 5576 |
| 47 | Ga0070674_100075450 | 3300005356 | Bacteria | 2395 |
| 48 | Ga0070674_100291949 | 3300005356 | Bacteria | 1296 |
| 49 | Ga0070674_100361199 | 3300005356 | Bacteria | 1176 |
| 50 | Ga0070673_100000212 | 3300005364 | Bacteria | 28926 |
| 51 | Ga0070673_100008245 | 3300005364 | Bacteria | 6918 |
| 52 | Ga0070673_100062093 | 3300005364 | Bacteria | 2967 |
| 53 | Ga0070673_100066244 | 3300005364 | Bacteria | 2885 |
| 54 | Ga0070673_100249254 | 3300005364 | Bacteria | 1547 |
| 55 | Ga0070688_100086199 | 3300005365 | Bacteria | 2043 |
| 56 | Ga0070659_100015437 | 3300005366 | Bacteria | 5721 |
| 57 | Ga0070667_100000728 | 3300005367 | Bacteria | 31585 |
| 58 | Ga0070667_100023077 | 3300005367 | Bacteria | 5161 |
| 59 | Ga0070667_100157327 | 3300005367 | Bacteria | 1999 |
| 60 | Ga0070703_10000740 | 3300005406 | Bacteria | 10913 |
| 61 | Ga0070709_10098283 | 3300005434 | Bacteria | 1945 |
| 62 | Ga0070713_100127070 | 3300005436 | Bacteria | 2244 |
| 63 | Ga0070711_100074236 | 3300005439 | Bacteria | 2405 |
| 64 | Ga0070705_100000238 | 3300005440 | Bacteria | 32601 |
| 65 | Ga0070700_100319731 | 3300005441 | Bacteria | 1140 |
| 66 | Ga0070663_100019435 | 3300005455 | Bacteria | 4478 |
| 67 | Ga0070678_100102872 | 3300005456 | Bacteria | 2218 |
| 68 | Ga0070678_100128053 | 3300005456 | Bacteria | 2013 |
| 69 | Ga0070662_100231624 | 3300005457 | Bacteria | 1478 |
| 70 | Ga0070681_10001472 | 3300005458 | Bacteria | 20780 |
| 71 | Ga0070681_10023707 | 3300005458 | Bacteria | 6176 |
| 72 | Ga0070681_10140535 | 3300005458 | Bacteria | 2345 |
| 73 | Ga0070681_10398797 | 3300005458 | Bacteria | 1287 |
| 74 | Ga0068867_100040795 | 3300005459 | Bacteria | 3390 |
| 75 | Ga0070706_100000820 | 3300005467 | Bacteria | 34294 |
| 76 | Ga0070707_100000107 | 3300005468 | Bacteria | 76101 |
| 77 | Ga0070698_100000063 | 3300005471 | Bacteria | 78062 |
| 78 | Ga0070698_100074006 | 3300005471 | Bacteria | 3412 |
| 79 | Ga0070698_100131060 | 3300005471 | Bacteria | 2463 |
| 80 | Ga0070698_100292779 | 3300005471 | Bacteria | 1559 |
| 81 | Ga0070698_100392952 | 3300005471 | Bacteria | 1320 |
| 82 | Ga0070699_100017361 | 3300005518 | Bacteria | 6179 |
| 83 | Ga0070679_100027214 | 3300005530 | Bacteria | 5625 |
| 84 | Ga0070679_100364344 | 3300005530 | Bacteria | 1393 |
| 85 | Ga0070684_100001658 | 3300005535 | Bacteria | 16158 |
| 86 | Ga0070684_100003273 | 3300005535 | Bacteria | 12129 |
| 87 | Ga0070684_100004177 | 3300005535 | Bacteria | 10942 |
| 88 | Ga0070697_100044328 | 3300005536 | Bacteria | 3602 |
| 89 | Ga0068853_100005020 | 3300005539 | Bacteria | 10318 |
| 90 | Ga0070672_100003190 | 3300005543 | Bacteria | 10614 |
| 91 | Ga0070672_100003279 | 3300005543 | Bacteria | 10478 |
| 92 | Ga0070686_100011648 | 3300005544 | Bacteria | 4995 |
| 93 | Ga0070686_100088003 | 3300005544 | Bacteria | 2072 |
| 94 | Ga0070696_100000011 | 3300005546 | Bacteria | 82210 |
| 95 | Ga0070665_100011352 | 3300005548 | Bacteria | 9007 |
| 96 | Ga0070665_100023727 | 3300005548 | Bacteria | 6178 |
| 97 | Ga0070665_100101186 | 3300005548 | Bacteria | 2886 |
| 98 | Ga0070665_100205549 | 3300005548 | Bacteria | 1970 |
| 99 | Ga0068855_100009510 | 3300005563 | Bacteria | 11739 |
| 100 | Ga0068855_100025821 | 3300005563 | Bacteria | 7025 |
| 101 | Ga0068855_100155676 | 3300005563 | Bacteria | 2596 |
| 102 | Ga0068855_100218230 | 3300005563 | Bacteria | 2140 |
| 103 | Ga0068855_100243156 | 3300005563 | Bacteria | 2010 |
| 104 | Ga0070664_100001996 | 3300005564 | Bacteria | 16362 |
| 105 | Ga0070664_100005403 | 3300005564 | Bacteria | 10256 |
| 106 | Ga0070664_100093085 | 3300005564 | Bacteria | 2611 |
| 107 | Ga0068857_100000448 | 3300005577 | Bacteria | 29339 |
| 108 | Ga0068857_100032648 | 3300005577 | Bacteria | 4603 |
| 109 | Ga0068857_100084925 | 3300005577 | Bacteria | 2829 |
| 110 | Ga0068856_100010522 | 3300005614 | Bacteria | 8982 |
| 111 | Ga0068856_100018092 | 3300005614 | Bacteria | 6832 |
| 112 | Ga0068856_100028116 | 3300005614 | Bacteria | 5489 |
| 113 | Ga0068852_100002149 | 3300005616 | Bacteria | 13529 |
| 114 | Ga0068852_100011908 | 3300005616 | Bacteria | 6577 |
| 115 | Ga0068852_100044710 | 3300005616 | Bacteria | 3764 |
| 116 | Ga0068852_100097860 | 3300005616 | Bacteria | 2640 |
| 117 | Ga0068859_100013491 | 3300005617 | Bacteria | 8194 |
| 118 | Ga0068859_100028738 | 3300005617 | Bacteria | 5574 |
| 119 | Ga0068859_100033089 | 3300005617 | Bacteria | 5193 |
| 120 | Ga0068859_100050677 | 3300005617 | Bacteria | 4170 |
| 121 | Ga0068859_100079735 | 3300005617 | Bacteria | 3314 |
| 122 | Ga0068859_100308187 | 3300005617 | Bacteria | 1677 |
| 123 | Ga0068859_100399926 | 3300005617 | Bacteria | 1469 |
| 124 | Ga0068864_100001251 | 3300005618 | Bacteria | 21104 |
| 125 | Ga0068864_100006868 | 3300005618 | Bacteria | 9324 |
| 126 | Ga0068864_100013647 | 3300005618 | Bacteria | 6735 |
| 127 | Ga0068864_100095356 | 3300005618 | Bacteria | 2631 |
| 128 | Ga0068866_10001191 | 3300005718 | Bacteria | 11349 |
| 129 | Ga0068861_100258453 | 3300005719 | Bacteria | 1490 |
| 130 | Ga0068851_10008480 | 3300005834 | Bacteria | 4753 |
| 131 | Ga0068851_10056819 | 3300005834 | Bacteria | 1997 |
| 132 | Ga0068851_10064677 | 3300005834 | Bacteria | 1880 |
| 133 | Ga0068851_10074448 | 3300005834 | Bacteria | 1763 |
| 134 | Ga0068870_10029783 | 3300005840 | Bacteria | 2753 |
| 135 | Ga0068863_100022882 | 3300005841 | Bacteria | 5972 |
| 136 | Ga0068863_100023057 | 3300005841 | Bacteria | 5948 |
| 137 | Ga0068863_100049767 | 3300005841 | Bacteria | 3973 |
| 138 | Ga0068863_100372639 | 3300005841 | Bacteria | 1393 |
| 139 | Ga0068858_100009818 | 3300005842 | Bacteria | 9107 |
| 140 | Ga0068858_100010536 | 3300005842 | Bacteria | 8755 |
| 141 | Ga0068858_100034388 | 3300005842 | Bacteria | 4701 |
| 142 | Ga0068858_100051993 | 3300005842 | Bacteria | 3791 |
| 143 | Ga0068858_100135852 | 3300005842 | Bacteria | 2308 |
| 144 | Ga0068858_100215491 | 3300005842 | Bacteria | 1818 |
| 145 | Ga0068860_100001032 | 3300005843 | Bacteria | 30687 |
| 146 | Ga0068860_100074397 | 3300005843 | Bacteria | 3230 |
| 147 | Ga0068860_100179456 | 3300005843 | Bacteria | 2047 |
| 148 | Ga0068860_100304871 | 3300005843 | Bacteria | 1561 |
| 149 | Ga0068862_100008314 | 3300005844 | Bacteria | 8587 |
| 150 | Ga0081455_10021838 | 3300005937 | Bacteria | 5995 |
| 151 | Ga0081455_10099872 | 3300005937 | Bacteria | 2333 |
| 152 | Ga0081540_1007130 | 3300005983 | Bacteria | 8019 |
| 153 | Ga0081539_10024630 | 3300005985 | Bacteria | 3898 |
| 154 | Ga0070717_10007402 | 3300006028 | Bacteria | 8151 |
| 155 | Ga0070717_10046772 | 3300006028 | Bacteria | 3542 |
| 156 | Ga0070716_100077051 | 3300006173 | Bacteria | 1978 |
| 157 | Ga0097621_100001657 | 3300006237 | Bacteria | 15226 |
| 158 | Ga0097621_100006730 | 3300006237 | Bacteria | 8166 |
| 159 | Ga0097621_100007914 | 3300006237 | Bacteria | 7625 |
| 160 | Ga0097621_100007951 | 3300006237 | Bacteria | 7609 |
| 161 | Ga0097621_100013125 | 3300006237 | Bacteria | 6162 |
| 162 | Ga0097621_100031616 | 3300006237 | Bacteria | 4202 |
| 163 | Ga0097621_100122510 | 3300006237 | Bacteria | 2207 |
| 164 | Ga0097621_100277190 | 3300006237 | Bacteria | 1475 |
| 165 | Ga0068871_100000863 | 3300006358 | Bacteria | 20190 |
| 166 | Ga0068871_100001734 | 3300006358 | Bacteria | 14693 |
| 167 | Ga0068871_100005075 | 3300006358 | Bacteria | 9197 |
| 168 | Ga0068871_100008275 | 3300006358 | Bacteria | 7476 |
| 169 | Ga0068871_100043732 | 3300006358 | Bacteria | 3599 |
| 170 | Ga0068871_100161676 | 3300006358 | Bacteria | 1916 |
| 171 | Ga0068871_100166565 | 3300006358 | Bacteria | 1887 |
| 172 | Ga0075428_100000364 | 3300006844 | Bacteria | 44975 |
| 173 | Ga0075428_100070245 | 3300006844 | Bacteria | 3828 |
| 174 | Ga0075428_100089480 | 3300006844 | Bacteria | 3358 |
| 175 | Ga0075428_100259575 | 3300006844 | Bacteria | 1871 |
| 176 | Ga0075430_100000555 | 3300006846 | Bacteria | 28350 |
| 177 | Ga0075431_100020182 | 3300006847 | Bacteria | 6805 |
| 178 | Ga0075431_100034207 | 3300006847 | Bacteria | 5236 |
| 179 | Ga0075433_10031264 | 3300006852 | Bacteria | 4550 |
| 180 | Ga0075433_10141572 | 3300006852 | Bacteria | 2137 |
| 181 | Ga0075434_100003240 | 3300006871 | Bacteria | 14532 |
| 182 | Ga0075434_100005959 | 3300006871 | Bacteria | 11157 |
| 183 | Ga0075434_100014805 | 3300006871 | Bacteria | 7465 |
| 184 | Ga0075434_100029208 | 3300006871 | Bacteria | 5422 |
| 185 | Ga0075434_100048927 | 3300006871 | Bacteria | 4196 |
| 186 | Ga0075434_100171329 | 3300006871 | Bacteria | 2191 |
| 187 | Ga0075434_100258295 | 3300006871 | Bacteria | 1761 |
| 188 | Ga0075429_100008602 | 3300006880 | Bacteria | 8878 |
| 189 | Ga0075429_100033840 | 3300006880 | Bacteria | 4440 |
| 190 | Ga0068865_100004795 | 3300006881 | Bacteria | 8179 |
| 191 | Ga0068865_100078750 | 3300006881 | Bacteria | 2358 |
| 192 | Ga0068865_100127798 | 3300006881 | Bacteria | 1900 |
| 193 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 194 | Ga0075436_100014436 | 3300006914 | Bacteria | 5410 |
| 195 | Ga0075436_100038172 | 3300006914 | Bacteria | 3315 |
| 196 | Ga0075436_100122792 | 3300006914 | Bacteria | 1818 |
| 197 | Ga0075436_100134116 | 3300006914 | Bacteria | 1738 |
| 198 | Ga0075436_100141285 | 3300006914 | Bacteria | 1692 |
| 199 | Ga0097620_100013490 | 3300006931 | Bacteria | 8194 |
| 200 | Ga0097620_100028740 | 3300006931 | Bacteria | 5574 |
| 201 | Ga0097620_100033089 | 3300006931 | Bacteria | 5193 |
| 202 | Ga0097620_100050677 | 3300006931 | Bacteria | 4170 |
| 203 | Ga0097620_100079736 | 3300006931 | Bacteria | 3314 |
| 204 | Ga0097620_100105786 | 3300006931 | Bacteria | 2873 |
| 205 | Ga0097620_100308169 | 3300006931 | Bacteria | 1677 |
| 206 | Ga0097620_100399918 | 3300006931 | Bacteria | 1469 |
| 207 | Ga0075435_100000346 | 3300007076 | Bacteria | 28639 |
| 208 | Ga0075435_100002191 | 3300007076 | Bacteria | 12888 |
| 209 | Ga0075435_100005602 | 3300007076 | Bacteria | 8793 |
| 210 | Ga0075435_100010740 | 3300007076 | Bacteria | 6706 |
| 211 | Ga0075435_100015759 | 3300007076 | Bacteria | 5687 |
| 212 | Ga0075435_100033922 | 3300007076 | Bacteria | 4040 |
| 213 | Ga0105240_10000663 | 3300009093 | Bacteria | 63262 |
| 214 | Ga0105240_10010389 | 3300009093 | Bacteria | 13085 |
| 215 | Ga0105240_10019935 | 3300009093 | Bacteria | 8955 |
| 216 | Ga0105240_10058841 | 3300009093 | Bacteria | 4797 |
| 217 | Ga0105240_10102912 | 3300009093 | Bacteria | 3470 |
| 218 | Ga0111539_10004361 | 3300009094 | Bacteria | 18532 |
| 219 | Ga0111539_10011681 | 3300009094 | Bacteria | 11017 |
| 220 | Ga0111539_10026321 | 3300009094 | Bacteria | 7112 |
| 221 | Ga0111539_10049947 | 3300009094 | Bacteria | 4985 |
| 222 | Ga0111539_10111128 | 3300009094 | Bacteria | 3216 |
| 223 | Ga0111539_10441776 | 3300009094 | Bacteria | 1515 |
| 224 | Ga0105245_10002815 | 3300009098 | Bacteria | 15638 |
| 225 | Ga0105245_10010419 | 3300009098 | Bacteria | 8096 |
| 226 | Ga0105245_10018240 | 3300009098 | Bacteria | 6136 |
| 227 | Ga0105245_10037780 | 3300009098 | Bacteria | 4293 |
| 228 | Ga0105245_10058454 | 3300009098 | Bacteria | 3471 |
| 229 | Ga0105245_10094137 | 3300009098 | Bacteria | 2761 |
| 230 | Ga0105247_10004217 | 3300009101 | Bacteria | 9218 |
| 231 | Ga0105247_10173739 | 3300009101 | Bacteria | 1434 |
| 232 | Ga0114129_10013084 | 3300009147 | Bacteria | 11820 |
| 233 | Ga0114129_10014211 | 3300009147 | Bacteria | 11343 |
| 234 | Ga0114129_10014362 | 3300009147 | Bacteria | 11288 |
| 235 | Ga0114129_10021276 | 3300009147 | Bacteria | 9210 |
| 236 | Ga0114129_10039725 | 3300009147 | Bacteria | 6636 |
| 237 | Ga0114129_10047663 | 3300009147 | Bacteria | 6021 |
| 238 | Ga0114129_10048489 | 3300009147 | Bacteria | 5968 |
| 239 | Ga0114129_10104363 | 3300009147 | Bacteria | 3917 |
| 240 | Ga0114129_10229445 | 3300009147 | Bacteria | 2501 |
| 241 | Ga0105243_10149516 | 3300009148 | Bacteria | 2002 |
| 242 | Ga0105243_10422857 | 3300009148 | Bacteria | 1243 |
| 243 | Ga0105241_10003115 | 3300009174 | Bacteria | 12345 |
| 244 | Ga0105241_10005170 | 3300009174 | Bacteria | 9627 |
| 245 | Ga0105241_10014948 | 3300009174 | Bacteria | 5683 |
| 246 | Ga0105241_10068995 | 3300009174 | Bacteria | 2740 |
| 247 | Ga0105242_10006628 | 3300009176 | Bacteria | 8927 |
| 248 | Ga0105248_10005114 | 3300009177 | Bacteria | 14471 |
| 249 | Ga0105248_10007643 | 3300009177 | Bacteria | 11878 |
| 250 | Ga0105248_10010289 | 3300009177 | Bacteria | 10297 |
| 251 | Ga0105248_10025773 | 3300009177 | Bacteria | 6540 |
| 252 | Ga0105248_10033272 | 3300009177 | Bacteria | 5758 |
| 253 | Ga0105248_10066871 | 3300009177 | Bacteria | 4035 |
| 254 | Ga0105248_10069483 | 3300009177 | Bacteria | 3954 |
| 255 | Ga0105248_10073388 | 3300009177 | Unclassified | 3846 |
| 256 | Ga0105248_10073651 | 3300009177 | Bacteria | 3838 |
| 257 | Ga0105248_10075284 | 3300009177 | Bacteria | 3794 |
| 258 | Ga0105248_10161866 | 3300009177 | Bacteria | 2524 |
| 259 | Ga0105248_10267912 | 3300009177 | Bacteria | 1923 |
| 260 | Ga0105248_10269576 | 3300009177 | Bacteria | 1917 |
| 261 | Ga0105237_10007213 | 3300009545 | Bacteria | 12201 |
| 262 | Ga0105237_10009782 | 3300009545 | Bacteria | 10252 |
| 263 | Ga0105238_10000657 | 3300009551 | Bacteria | 36213 |
| 264 | Ga0105238_10006697 | 3300009551 | Bacteria | 11494 |
| 265 | Ga0105238_10009153 | 3300009551 | Bacteria | 9915 |
| 266 | Ga0105249_10025755 | 3300009553 | Bacteria | 5297 |
| 267 | Ga0105249_10286885 | 3300009553 | Bacteria | 1646 |
| 268 | Ga0105239_10010212 | 3300010375 | Bacteria | 10519 |
| 269 | Ga0105239_10013868 | 3300010375 | Bacteria | 8943 |
| 270 | Ga0105239_10212518 | 3300010375 | Unclassified | 2168 |
| 271 | Ga0157371_10113183 | 3300013102 | Bacteria | 1927 |
| 272 | Ga0157369_10031690 | 3300013105 | Bacteria | 5818 |
| 273 | Ga0157369_10128190 | 3300013105 | Bacteria | 2689 |
| 274 | Ga0157369_10134210 | 3300013105 | Bacteria | 2621 |
| 275 | Ga0157369_10163394 | 3300013105 | Bacteria | 2349 |
| 276 | Ga0157369_10251569 | 3300013105 | Bacteria | 1844 |
| 277 | Ga0157369_10253723 | 3300013105 | Bacteria | 1835 |
| 278 | Ga0157369_10294993 | 3300013105 | Bacteria | 1687 |
| 279 | Ga0157374_10005560 | 3300013296 | Bacteria | 10612 |
| 280 | Ga0157374_10009039 | 3300013296 | Bacteria | 8543 |
| 281 | Ga0157374_10036420 | 3300013296 | Bacteria | 4507 |
| 282 | Ga0157374_10072706 | 3300013296 | Bacteria | 3245 |
| 283 | Ga0157374_10183090 | 3300013296 | Bacteria | 2047 |
| 284 | Ga0157374_10243686 | 3300013296 | Bacteria | 1768 |
| 285 | Ga0157378_10007412 | 3300013297 | Bacteria | 9584 |
| 286 | Ga0157378_10013370 | 3300013297 | Bacteria | 7173 |
| 287 | Ga0157378_10014829 | 3300013297 | Bacteria | 6821 |
| 288 | Ga0157378_10015600 | 3300013297 | Bacteria | 6653 |
| 289 | Ga0157378_10114680 | 3300013297 | Bacteria | 2475 |
| 290 | Ga0163162_10004597 | 3300013306 | Bacteria | 13296 |
| 291 | Ga0163162_10148861 | 3300013306 | Bacteria | 2458 |
| 292 | Ga0163162_10215887 | 3300013306 | Bacteria | 2048 |
| 293 | Ga0163162_10276676 | 3300013306 | Bacteria | 1811 |
| 294 | Ga0163162_10440142 | 3300013306 | Bacteria | 1436 |
| 295 | Ga0157372_10001132 | 3300013307 | Bacteria | 28947 |
| 296 | Ga0157372_10021218 | 3300013307 | Bacteria | 7017 |
| 297 | Ga0157372_10044476 | 3300013307 | Bacteria | 4921 |
| 298 | Ga0157372_10059882 | 3300013307 | Bacteria | 4261 |
| 299 | Ga0157372_10327434 | 3300013307 | Bacteria | 1784 |
| 300 | Ga0157372_10437784 | 3300013307 | Bacteria | 1524 |
| 301 | Ga0157375_10030460 | 3300013308 | Bacteria | 5088 |
| 302 | Ga0157375_10056413 | 3300013308 | Bacteria | 3878 |
| 303 | Ga0157375_10118012 | 3300013308 | Bacteria | 2759 |
| 304 | Ga0157375_10319371 | 3300013308 | Bacteria | 1717 |
| 305 | Ga0157375_10362254 | 3300013308 | Bacteria | 1616 |
| 306 | Ga0163163_10007028 | 3300014325 | Bacteria | 9890 |
| 307 | Ga0163163_10009625 | 3300014325 | Bacteria | 8641 |
| 308 | Ga0163163_10014932 | 3300014325 | Bacteria | 7156 |
| 309 | Ga0163163_10115054 | 3300014325 | Bacteria | 2721 |
| 310 | Ga0163163_10186714 | 3300014325 | Bacteria | 2121 |
| 311 | Ga0163163_10288376 | 3300014325 | Bacteria | 1693 |
| 312 | Ga0157380_10010849 | 3300014326 | Bacteria | 6568 |
| 313 | Ga0157380_10025522 | 3300014326 | Bacteria | 4481 |
| 314 | Ga0157380_10071933 | 3300014326 | Bacteria | 2799 |
| 315 | Ga0157379_10005193 | 3300014968 | Bacteria | 11186 |
| 316 | Ga0157379_10014375 | 3300014968 | Bacteria | 6945 |
| 317 | Ga0157379_10055488 | 3300014968 | Bacteria | 3539 |
| 318 | Ga0157376_10000173 | 3300014969 | Bacteria | 44682 |
| 319 | Ga0157376_10037758 | 3300014969 | Bacteria | 3925 |
| 320 | Ga0157376_10067576 | 3300014969 | Bacteria | 3024 |
| 321 | Ga0157376_10086181 | 3300014969 | Bacteria | 2707 |
| 322 | Ga0157376_10113077 | 3300014969 | Bacteria | 2393 |
| 323 | Ga0157376_10216863 | 3300014969 | Bacteria | 1770 |
| 324 | Ga0157376_10273387 | 3300014969 | Bacteria | 1588 |
| 325 | Ga0157376_10446535 | 3300014969 | Bacteria | 1260 |
| 326 | Ga0163161_10267393 | 3300017792 | Bacteria | 1337 |
| 327 | Ga0213872_10016026 | 3300021361 | Bacteria | 3481 |
| 328 | Ga0213872_10062464 | 3300021361 | Bacteria | 1683 |
| 329 | Ga0207656_10040382 | 3300025321 | Bacteria | 1978 |
| 330 | Ga0207656_10107340 | 3300025321 | Bacteria | 1286 |
| 331 | Ga0207653_10000296 | 3300025885 | Bacteria | 28845 |
| 332 | Ga0207688_10079285 | 3300025901 | Bacteria | 1873 |
| 333 | Ga0207680_10004658 | 3300025903 | Bacteria | 6511 |
| 334 | Ga0207680_10032963 | 3300025903 | Bacteria | 2950 |
| 335 | Ga0207680_10042140 | 3300025903 | Bacteria | 2668 |
| 336 | Ga0207680_10252988 | 3300025903 | Bacteria | 1217 |
| 337 | Ga0207699_10057965 | 3300025906 | Bacteria | 2315 |
| 338 | Ga0207699_10108006 | 3300025906 | Bacteria | 1779 |
| 339 | Ga0207645_10114258 | 3300025907 | Bacteria | 1749 |
| 340 | Ga0207643_10006154 | 3300025908 | Bacteria | 6422 |
| 341 | Ga0207684_10004650 | 3300025910 | Bacteria | 12887 |
| 342 | Ga0207654_10000302 | 3300025911 | Bacteria | 30006 |
| 343 | Ga0207654_10034343 | 3300025911 | Bacteria | 2817 |
| 344 | Ga0207707_10022700 | 3300025912 | Bacteria | 5487 |
| 345 | Ga0207707_10147929 | 3300025912 | Bacteria | 2054 |
| 346 | Ga0207707_10168455 | 3300025912 | Bacteria | 1914 |
| 347 | Ga0207695_10000108 | 3300025913 | Bacteria | 252306 |
| 348 | Ga0207695_10000253 | 3300025913 | Bacteria | 139044 |
| 349 | Ga0207695_10001120 | 3300025913 | Bacteria | 46589 |
| 350 | Ga0207695_10002288 | 3300025913 | Bacteria | 28621 |
| 351 | Ga0207695_10013281 | 3300025913 | Bacteria | 9824 |
| 352 | Ga0207671_10000081 | 3300025914 | Bacteria | 148476 |
| 353 | Ga0207671_10005934 | 3300025914 | Bacteria | 11073 |
| 354 | Ga0207671_10228029 | 3300025914 | Bacteria | 1461 |
| 355 | Ga0207660_10086904 | 3300025917 | Bacteria | 2309 |
| 356 | Ga0207657_10004178 | 3300025919 | Bacteria | 15301 |
| 357 | Ga0207649_10002341 | 3300025920 | Bacteria | 10624 |
| 358 | Ga0207649_10006738 | 3300025920 | Bacteria | 6240 |
| 359 | Ga0207649_10010211 | 3300025920 | Bacteria | 5154 |
| 360 | Ga0207649_10095043 | 3300025920 | Bacteria | 1960 |
| 361 | Ga0207652_10114604 | 3300025921 | Bacteria | 2394 |
| 362 | Ga0207646_10000543 | 3300025922 | Bacteria | 49799 |
| 363 | Ga0207646_10072856 | 3300025922 | Bacteria | 3068 |
| 364 | Ga0207681_10006478 | 3300025923 | Bacteria | 7189 |
| 365 | Ga0207681_10069176 | 3300025923 | Bacteria | 2455 |
| 366 | Ga0207694_10000108 | 3300025924 | Bacteria | 87457 |
| 367 | Ga0207694_10000313 | 3300025924 | Bacteria | 45627 |
| 368 | Ga0207694_10003511 | 3300025924 | Bacteria | 12445 |
| 369 | Ga0207694_10006127 | 3300025924 | Bacteria | 9190 |
| 370 | Ga0207650_10000845 | 3300025925 | Bacteria | 23199 |
| 371 | Ga0207650_10001335 | 3300025925 | Bacteria | 17846 |
| 372 | Ga0207650_10057077 | 3300025925 | Bacteria | 2903 |
| 373 | Ga0207650_10075745 | 3300025925 | Bacteria | 2540 |
| 374 | Ga0207659_10009805 | 3300025926 | Bacteria | 5994 |
| 375 | Ga0207659_10027937 | 3300025926 | Bacteria | 3827 |
| 376 | Ga0207659_10037071 | 3300025926 | Bacteria | 3382 |
| 377 | Ga0207659_10088672 | 3300025926 | Bacteria | 2305 |
| 378 | Ga0207659_10091570 | 3300025926 | Bacteria | 2272 |
| 379 | Ga0207659_10198668 | 3300025926 | Bacteria | 1600 |
| 380 | Ga0207687_10031659 | 3300025927 | Bacteria | 3576 |
| 381 | Ga0207687_10052187 | 3300025927 | Bacteria | 2853 |
| 382 | Ga0207687_10137295 | 3300025927 | Bacteria | 1851 |
| 383 | Ga0207700_10105323 | 3300025928 | Bacteria | 2259 |
| 384 | Ga0207700_10159209 | 3300025928 | Bacteria | 1874 |
| 385 | Ga0207644_10002155 | 3300025931 | Bacteria | 12780 |
| 386 | Ga0207644_10002796 | 3300025931 | Bacteria | 11244 |
| 387 | Ga0207690_10025257 | 3300025932 | Bacteria | 3728 |
| 388 | Ga0207690_10205745 | 3300025932 | Bacteria | 1498 |
| 389 | Ga0207706_10017828 | 3300025933 | Bacteria | 6395 |
| 390 | Ga0207706_10031305 | 3300025933 | Bacteria | 4740 |
| 391 | Ga0207686_10004844 | 3300025934 | Bacteria | 7234 |
| 392 | Ga0207686_10011649 | 3300025934 | Bacteria | 4822 |
| 393 | Ga0207686_10043936 | 3300025934 | Bacteria | 2740 |
| 394 | Ga0207709_10265220 | 3300025935 | Bacteria | 1261 |
| 395 | Ga0207669_10129025 | 3300025937 | Bacteria | 1733 |
| 396 | Ga0207704_10007156 | 3300025938 | Bacteria | 5252 |
| 397 | Ga0207665_10052450 | 3300025939 | Bacteria | 2747 |
| 398 | Ga0207665_10168518 | 3300025939 | Bacteria | 1580 |
| 399 | Ga0207691_10009310 | 3300025940 | Bacteria | 9426 |
| 400 | Ga0207691_10020940 | 3300025940 | Bacteria | 6180 |
| 401 | Ga0207691_10029528 | 3300025940 | Bacteria | 5129 |
| 402 | Ga0207691_10167848 | 3300025940 | Bacteria | 1923 |
| 403 | Ga0207711_10004803 | 3300025941 | Bacteria | 11473 |
| 404 | Ga0207711_10019972 | 3300025941 | Bacteria | 5583 |
| 405 | Ga0207711_10022810 | 3300025941 | Bacteria | 5238 |
| 406 | Ga0207711_10027546 | 3300025941 | Bacteria | 4774 |
| 407 | Ga0207711_10056074 | 3300025941 | Bacteria | 3385 |
| 408 | Ga0207711_10069704 | 3300025941 | Bacteria | 3049 |
| 409 | Ga0207711_10183840 | 3300025941 | Bacteria | 1902 |
| 410 | Ga0207711_10354195 | 3300025941 | Bacteria | 1359 |
| 411 | Ga0207689_10114151 | 3300025942 | Bacteria | 2220 |
| 412 | Ga0207689_10169595 | 3300025942 | Bacteria | 1799 |
| 413 | Ga0207661_10002024 | 3300025944 | Bacteria | 13979 |
| 414 | Ga0207661_10005019 | 3300025944 | Bacteria | 9278 |
| 415 | Ga0207661_10005751 | 3300025944 | Bacteria | 8744 |
| 416 | Ga0207661_10129696 | 3300025944 | Bacteria | 2158 |
| 417 | Ga0207679_10015458 | 3300025945 | Bacteria | 5044 |
| 418 | Ga0207679_10063021 | 3300025945 | Bacteria | 2766 |
| 419 | Ga0207679_10080000 | 3300025945 | Bacteria | 2494 |
| 420 | Ga0207667_10000934 | 3300025949 | Bacteria | 37249 |
| 421 | Ga0207651_10000458 | 3300025960 | Bacteria | 17210 |
| 422 | Ga0207651_10004258 | 3300025960 | Bacteria | 7182 |
| 423 | Ga0207651_10142570 | 3300025960 | Bacteria | 1853 |
| 424 | Ga0207712_10097210 | 3300025961 | Bacteria | 2181 |
| 425 | Ga0207658_10000416 | 3300025986 | Bacteria | 40419 |
| 426 | Ga0207658_10020848 | 3300025986 | Bacteria | 4541 |
| 427 | Ga0207677_10000025 | 3300026023 | Bacteria | 127400 |
| 428 | Ga0207677_10001276 | 3300026023 | Bacteria | 13521 |
| 429 | Ga0207677_10019800 | 3300026023 | Bacteria | 4073 |
| 430 | Ga0207677_10038732 | 3300026023 | Bacteria | 3128 |
| 431 | Ga0207677_10074822 | 3300026023 | Bacteria | 2405 |
| 432 | Ga0207703_10013597 | 3300026035 | Bacteria | 6343 |
| 433 | Ga0207703_10026803 | 3300026035 | Bacteria | 4540 |
| 434 | Ga0207703_10045454 | 3300026035 | Bacteria | 3532 |
| 435 | Ga0207703_10052897 | 3300026035 | Bacteria | 3299 |
| 436 | Ga0207703_10054904 | 3300026035 | Bacteria | 3241 |
| 437 | Ga0207703_10147339 | 3300026035 | Bacteria | 2049 |
| 438 | Ga0207703_10175334 | 3300026035 | Bacteria | 1889 |
| 439 | Ga0207703_10187849 | 3300026035 | Bacteria | 1828 |
| 440 | Ga0207639_10000055 | 3300026041 | Bacteria | 110260 |
| 441 | Ga0207639_10004182 | 3300026041 | Bacteria | 9720 |
| 442 | Ga0207708_10114066 | 3300026075 | Bacteria | 2100 |
| 443 | Ga0207702_10002856 | 3300026078 | Bacteria | 16153 |
| 444 | Ga0207702_10177152 | 3300026078 | Bacteria | 1960 |
| 445 | Ga0207702_10321670 | 3300026078 | Unclassified | 1473 |
| 446 | Ga0207641_10003438 | 3300026088 | Bacteria | 14020 |
| 447 | Ga0207641_10010405 | 3300026088 | Bacteria | 7644 |
| 448 | Ga0207641_10053618 | 3300026088 | Bacteria | 3419 |
| 449 | Ga0207641_10167637 | 3300026088 | Unclassified | 2002 |
| 450 | Ga0207648_10027066 | 3300026089 | Bacteria | 5093 |
| 451 | Ga0207648_10048204 | 3300026089 | Bacteria | 3730 |
| 452 | Ga0207648_10297556 | 3300026089 | Bacteria | 1446 |
| 453 | Ga0207676_10000597 | 3300026095 | Bacteria | 29656 |
| 454 | Ga0207676_10002620 | 3300026095 | Bacteria | 12828 |
| 455 | Ga0207676_10012097 | 3300026095 | Bacteria | 6176 |
| 456 | Ga0207676_10090997 | 3300026095 | Bacteria | 2505 |
| 457 | Ga0207674_10001459 | 3300026116 | Bacteria | 30559 |
| 458 | Ga0207674_10064007 | 3300026116 | Bacteria | 3710 |
| 459 | Ga0207674_10135888 | 3300026116 | Bacteria | 2421 |
| 460 | Ga0207674_10186955 | 3300026116 | Bacteria | 2022 |
| 461 | Ga0207675_100073741 | 3300026118 | Bacteria | 3193 |
| 462 | Ga0207675_100107490 | 3300026118 | Bacteria | 2631 |
| 463 | Ga0207683_10003208 | 3300026121 | Bacteria | 14272 |
| 464 | Ga0207683_10032747 | 3300026121 | Bacteria | 4515 |
| 465 | Ga0207683_10093026 | 3300026121 | Bacteria | 2687 |
| 466 | Ga0207698_10029371 | 3300026142 | Bacteria | 3937 |
| 467 | Ga0207698_10071935 | 3300026142 | Bacteria | 2746 |
| 468 | Ga0207428_10001780 | 3300027907 | Bacteria | 22062 |
| 469 | Ga0207428_10022551 | 3300027907 | Bacteria | 5310 |
| 470 | Ga0207428_10023970 | 3300027907 | Bacteria | 5125 |
| 471 | Ga0268266_10022544 | 3300028379 | Bacteria | 5364 |
| 472 | Ga0268265_10072698 | 3300028380 | Bacteria | 2683 |
| 473 | Ga0268264_10000920 | 3300028381 | Bacteria | 30745 |
| 474 | Ga0268264_10033695 | 3300028381 | Bacteria | 4210 |
| 475 | Ga0268264_10122673 | 3300028381 | Unclassified | 2292 |
| 476 | Ga0268264_10139070 | 3300028381 | Bacteria | 2163 |
| 477 | Ga0268264_10323779 | 3300028381 | Bacteria | 1458 |
| 478 | Ga0268264_10370826 | 3300028381 | Bacteria | 1368 |
| 479 | Ga0265336_10002136 | 3300028666 | Bacteria | 8364 |
| 480 | Ga0265338_10003779 | 3300028800 | Bacteria | 21040 |
| 481 | Ga0265338_10004819 | 3300028800 | Bacteria | 18037 |
| 482 | Ga0265338_10012773 | 3300028800 | Bacteria | 9552 |
| 483 | Ga0265330_10000852 | 3300031235 | Bacteria | 19100 |
| 484 | Ga0265330_10010994 | 3300031235 | Bacteria | 4249 |
| 485 | Ga0265332_10023877 | 3300031238 | Bacteria | 2694 |
| 486 | Ga0265332_10036136 | 3300031238 | Bacteria | 2145 |
| 487 | Ga0265332_10065466 | 3300031238 | Bacteria | 1552 |
| 488 | Ga0265328_10045676 | 3300031239 | Bacteria | 1610 |
| 489 | Ga0265320_10018906 | 3300031240 | Bacteria | 3780 |
| 490 | Ga0265320_10037191 | 3300031240 | Bacteria | 2453 |
| 491 | Ga0265325_10002033 | 3300031241 | Bacteria | 13905 |
| 492 | Ga0265325_10010585 | 3300031241 | Bacteria | 5335 |
| 493 | Ga0265325_10067769 | 3300031241 | Bacteria | 1797 |
| 494 | Ga0265339_10000029 | 3300031249 | Bacteria | 139089 |
| 495 | Ga0265339_10000204 | 3300031249 | Bacteria | 48602 |
| 496 | Ga0265339_10004335 | 3300031249 | Bacteria | 9688 |
| 497 | Ga0265339_10007186 | 3300031249 | Bacteria | 7219 |
| 498 | Ga0265339_10016804 | 3300031249 | Bacteria | 4352 |
| 499 | Ga0265331_10081078 | 3300031250 | Bacteria | 1507 |
| 500 | Ga0265316_10002998 | 3300031344 | Bacteria | 17267 |
| 501 | Ga0265316_10010127 | 3300031344 | Bacteria | 8607 |
| 502 | Ga0265316_10048099 | 3300031344 | Bacteria | 3370 |
| 503 | Ga0265316_10072395 | 3300031344 | Bacteria | 2655 |
| 504 | Ga0265313_10001614 | 3300031595 | Bacteria | 20940 |
| 505 | Ga0265313_10082546 | 3300031595 | Archaea | 1456 |
| 506 | Ga0316575_10052205 | 3300031665 | Bacteria | 1628 |
| 507 | Ga0265314_10000139 | 3300031711 | Bacteria | 108861 |
| 508 | Ga0265314_10002635 | 3300031711 | Bacteria | 18083 |
| 509 | Ga0265314_10038367 | 3300031711 | Bacteria | 3461 |
| 510 | Ga0265314_10201278 | 3300031711 | Bacteria | 1177 |
| 511 | Ga0265342_10001268 | 3300031712 | Bacteria | 23772 |
| 512 | Ga0265342_10001906 | 3300031712 | Bacteria | 18762 |
| 513 | Ga0265342_10002378 | 3300031712 | Bacteria | 16291 |
| 514 | Ga0265342_10009601 | 3300031712 | Bacteria | 6795 |
| 515 | Ga0265342_10019600 | 3300031712 | Bacteria | 4357 |
| 516 | Ga0316576_10005853 | 3300031727 | Bacteria | 7582 |
| 517 | Ga0307405_10084624 | 3300031731 | Unclassified | 2082 |
| 518 | Ga0307405_10130308 | 3300031731 | Bacteria | 1737 |
| 519 | Ga0307412_10187716 | 3300031911 | Bacteria | 1560 |
| 520 | Ga0307409_100094124 | 3300031995 | Bacteria | 2464 |
| 521 | Ga0307409_100187555 | 3300031995 | Bacteria | 1837 |
| 522 | Ga0307409_100474587 | 3300031995 | Bacteria | 1212 |
| 523 | Ga0307416_100006624 | 3300032002 | Bacteria | 7270 |
| 524 | Ga0307416_100013904 | 3300032002 | Bacteria | 5489 |
| 525 | Ga0307411_10026713 | 3300032005 | Bacteria | 3480 |
| 526 | Ga0307411_10061367 | 3300032005 | Bacteria | 2502 |
| 527 | Ga0307415_100034503 | 3300032126 | Bacteria | 3295 |
| 528 | Ga0316583_10000278 | 3300032133 | Bacteria | 14246 |
| 529 | Ga0316585_10002014 | 3300032137 | Bacteria | 5437 |
| 530 | Ga0373930_0005342 | 3300034816 | Bacteria | 2132 |
| 531 | Ga0373948_0009173 | 3300034817 | Bacteria | 1701 |
| 532 | Ga0373950_0000985 | 3300034818 | Bacteria | 3607 |
| 533 | Ga0373938_0002908 | 3300034957 | Bacteria | 2767 |
| 534 | Ga0373929_0000163 | 3300035085 | Bacteria | 11608 |
| 535 | Ga0373940_0000203 | 3300035088 | Bacteria | 8256 |
| 536 | Ga0373949_0001328 | 3300035090 | Bacteria | 7130 |
| 537 | Ga0373951_0000732 | 3300035091 | Bacteria | 9021 |
| 538 | Ga0373952_0003388 | 3300035092 | Bacteria | 2877 |
| 539 | Ga0373932_0000277 | 3300035112 | Bacteria | 15406 |
| 540 | Ga0373939_0001054 | 3300035114 | Bacteria | 6792 |
| 541 | Ga0373957_0016697 | 3300035120 | Bacteria | 2546 |
| 542 | Ga0373960_0001680 | 3300035121 | Bacteria | 4951 |
| 543 | Ga0373946_0002728 | 3300035171 | Bacteria | 6241 |
| 544 | Ga0373955_0048692 | 3300035172 | Bacteria | 2299 |
| 545 | Ga0373962_0001306 | 3300035242 | Bacteria | 5857 |
| 546 | Ga0373962_0012884 | 3300035242 | Bacteria | 2111 |
| 547 | Ga0373935_0159388 | 3300035692 | Bacteria | 1537 |
| 548 | Ga0373947_0139286 | 3300035725 | Bacteria | 1555 |
| 549 | Ga0373947_0190887 | 3300035725 | Bacteria | 1337 |
| 550 | Ga0373937_0002195 | 3300036401 | Bacteria | 16312 |
| 551 | Ga0373937_0013603 | 3300036401 | Bacteria | 7170 |
| 552 | Ga0373937_0026531 | 3300036401 | Bacteria | 5234 |
| 553 | Ga0373937_0080256 | 3300036401 | Bacteria | 3017 |
| 554 | Ga0373937_0091727 | 3300036401 | Bacteria | 2815 |
| 555 | Ga0373937_0208778 | 3300036401 | Bacteria | 1837 |
| 556 | Ga0373937_0335613 | 3300036401 | Unclassified | 1431 |
| 557 | Ga0316582_0037884 | 3300036647 | Bacteria | 2993 |
| 558 | Ga0316584_0070788 | 3300036712 | Bacteria | 2613 |
| 559 | Ga0373925_0028280 | 3300037068 | Bacteria | 4107 |
| 560 | Ga0395898_0083408 | 3300037466 | Bacteria | 3081 |
| 561 | Ga0436360_1224841 | 3300039438 | Bacteria | 2090 |
| 562 | Ga0436361_0224417 | 3300039447 | Bacteria | 20492 |
| 563 | Ga0436361_1193508 | 3300039447 | Bacteria | 3382 |
| 564 | Ga0439446_0001344 | 3300042156 | Bacteria | 5544 |
| 565 | Ga0439434_0008285 | 3300042435 | Bacteria | 3048 |
| 566 | Ga0451577_0002197 | 3300042876 | Bacteria | 23772 |
| 567 | Ga0466961_0146027 | 3300044693 | Bacteria | 1479 |
| 568 | Ga0466963_0011541 | 3300044694 | Bacteria | 5380 |
| 569 | Ga0453684_0000809 | 3300044712 | Bacteria | 106510 |
| 570 | Ga0466959_0055610 | 3300045049 | Bacteria | 2889 |
| 571 | Ga0451576_0040199 | 3300045051 | Bacteria | 4951 |
| 572 | Ga0466958_0158302 | 3300045836 | Bacteria | 1430 |
| 573 | Ga0466967_0108084 | 3300045976 | Bacteria | 2552 |
| 574 | Ga0466967_0406711 | 3300045976 | Bacteria | 1325 |
| 575 | Ga0495592_0012152 | 3300046454 | Bacteria | 6533 |
| 576 | Ga0495629_0048272 | 3300046459 | Bacteria | 2985 |
| 577 | Ga0495629_0064427 | 3300046459 | Bacteria | 2559 |
| 578 | Ga0495653_0123680 | 3300046463 | Bacteria | 1840 |
| 579 | Ga0495653_0163278 | 3300046463 | Bacteria | 1545 |
| 580 | Ga0495580_0144140 | 3300046472 | Bacteria | 1651 |
| 581 | Ga0495664_0142574 | 3300046477 | Bacteria | 1453 |
| 582 | Ga0495608_0038100 | 3300046511 | Bacteria | 3231 |
| 583 | Ga0495618_0028265 | 3300046514 | Bacteria | 3495 |
| 584 | Ga0495628_0101905 | 3300046516 | Bacteria | 2215 |
| 585 | Ga0495630_0023677 | 3300046517 | Bacteria | 4540 |
| 586 | Ga0495630_0293842 | 3300046517 | Bacteria | 1242 |
| 587 | Ga0495652_0021671 | 3300046529 | Bacteria | 5711 |
| 588 | Ga0495640_0145776 | 3300046533 | Bacteria | 1523 |
| 589 | Ga0495586_0074284 | 3300046535 | Bacteria | 1861 |
| 590 | Ga0495587_0004453 | 3300046536 | Bacteria | 9230 |
| 591 | Ga0495645_0001171 | 3300046543 | Bacteria | 17849 |
| 592 | Ga0495645_0009063 | 3300046543 | Bacteria | 6951 |
| 593 | Ga0495667_0006730 | 3300046559 | Bacteria | 7797 |
| 594 | Ga0495625_0111003 | 3300046660 | Bacteria | 1874 |
| 595 | Ga0495659_0021962 | 3300046664 | Unclassified | 2154 |
| 596 | Ga0495657_0011406 | 3300046675 | Bacteria | 6645 |
| 597 | Ga0495599_0108896 | 3300046678 | Bacteria | 1726 |
| 598 | Ga0495647_0018577 | 3300046681 | Bacteria | 2478 |
| 599 | Ga0495647_0048193 | 3300046681 | Bacteria | 1647 |
| 600 | Ga0495658_0020183 | 3300046683 | Bacteria | 3493 |
| 601 | Ga0495658_0042361 | 3300046683 | Bacteria | 2542 |
| 602 | Ga0495658_0064983 | 3300046683 | Bacteria | 2104 |
| 603 | Ga0495658_0090000 | 3300046683 | Bacteria | 1816 |
| 604 | Ga0495669_0000860 | 3300046684 | Bacteria | 12848 |
| 605 | Ga0495669_0051264 | 3300046684 | Bacteria | 1852 |
| 606 | Ga0495613_0014767 | 3300046689 | Bacteria | 5796 |
| 607 | Ga0495613_0015595 | 3300046689 | Bacteria | 5653 |
| 608 | Ga0495613_0155324 | 3300046689 | Bacteria | 1630 |
| 609 | Ga0495600_0015924 | 3300046809 | Bacteria | 4764 |
| 610 | Ga0495604_0068058 | 3300047317 | Bacteria | 2704 |
| 611 | Ga0495674_0013025 | 3300047319 | Bacteria | 7828 |
| 612 | Ga0495674_0046843 | 3300047319 | Bacteria | 3837 |
| 613 | Ga0495674_0294039 | 3300047319 | Bacteria | 1328 |
| 614 | Ga0495684_0000549 | 3300047471 | Bacteria | 30432 |
| 615 | Ga0495684_0128657 | 3300047471 | Bacteria | 1903 |
| 616 | Ga0495686_0000382 | 3300047472 | Bacteria | 70847 |
| 617 | Ga0495602_0078220 | 3300048088 | Bacteria | 2794 |
| 618 | Ga0495602_0172286 | 3300048088 | Bacteria | 1679 |
| 619 | Ga0496101_0008114 | 3300048904 | Bacteria | 6850 |
| 620 | Ga0496101_0187028 | 3300048904 | Bacteria | 1597 |
| 621 | Ga0496102_0269264 | 3300048905 | Bacteria | 1606 |
| 622 | Ga0496104_0012179 | 3300048907 | Bacteria | 7725 |
| 623 | Ga0496104_0021109 | 3300048907 | Bacteria | 5975 |
| 624 | Ga0496104_0102223 | 3300048907 | Bacteria | 2745 |
| 625 | Ga0496104_0103189 | 3300048907 | Bacteria | 2732 |
| 626 | Ga0496104_0133652 | 3300048907 | Bacteria | 2383 |
| 627 | Ga0496104_0143115 | 3300048907 | Bacteria | 2297 |
| 628 | Ga0496105_0010021 | 3300048908 | Bacteria | 7436 |
| 629 | Ga0496106_0032282 | 3300048909 | Bacteria | 3904 |
| 630 | Ga0496106_0061878 | 3300048909 | Bacteria | 2841 |
| 631 | Ga0496107_0023872 | 3300048910 | Bacteria | 4322 |
| 632 | Ga0496108_0001066 | 3300048911 | Bacteria | 21388 |
| 633 | Ga0496109_0000525 | 3300048912 | Bacteria | 32426 |
| 634 | Ga0496109_0070364 | 3300048912 | Bacteria | 3211 |
| 635 | Ga0496109_0138565 | 3300048912 | Bacteria | 2275 |
| 636 | Ga0496109_0292021 | 3300048912 | Bacteria | 1537 |
| 637 | Ga0496110_0001750 | 3300048913 | Bacteria | 16012 |
| 638 | Ga0496110_0340171 | 3300048913 | Bacteria | 1367 |
| 639 | Ga0496111_0000267 | 3300048914 | Bacteria | 25489 |
| 640 | Ga0496112_0004758 | 3300048915 | Bacteria | 11577 |
| 641 | Ga0496112_0034440 | 3300048915 | Bacteria | 4928 |
| 642 | Ga0496112_0086626 | 3300048915 | Bacteria | 3099 |
| 643 | Ga0496113_0019024 | 3300048916 | Bacteria | 4797 |
| 644 | Ga0496113_0071872 | 3300048916 | Bacteria | 2632 |
| 645 | Ga0496114_0015720 | 3300048917 | Bacteria | 6089 |
| 646 | Ga0496114_0043177 | 3300048917 | Bacteria | 3739 |
| 647 | Ga0496115_0116364 | 3300048918 | Bacteria | 2199 |
| 648 | Ga0496115_0136729 | 3300048918 | Bacteria | 2021 |
| 649 | Ga0496126_0003640 | 3300048929 | Bacteria | 19252 |
| 650 | Ga0496126_0004803 | 3300048929 | Bacteria | 15878 |
| 651 | Ga0501037_0181393 | 3300049573 | Bacteria | 1493 |
| 652 | Ga0501041_0121308 | 3300049577 | Bacteria | 1625 |
| 653 | Ga0501046_0160385 | 3300049580 | Bacteria | 1692 |
| 654 | Ga0501067_0019332 | 3300049583 | Bacteria | 3770 |
| 655 | Ga0501071_0150453 | 3300049587 | Bacteria | 1736 |
| 656 | Ga0501073_0003486 | 3300049589 | Bacteria | 11817 |
| 657 | Ga0501074_0086925 | 3300049590 | Bacteria | 2240 |
| 658 | Ga0501079_0150413 | 3300049741 | Bacteria | 1815 |
| 659 | Ga0501081_0133817 | 3300049743 | Bacteria | 1773 |
| 660 | Ga0501044_0029063 | 3300049823 | Bacteria | 5830 |
| 661 | nmdc:mga05p37_10494_c2 | 3300050507 | Bacteria | 9476 |
| 662 | nmdc:mga05p37_151399_c1 | 3300050507 | Bacteria | 2837 |
| 663 | nmdc:mga05p37_253830_c1 | 3300050507 | Bacteria | 2108 |
| 664 | nmdc:mga05p37_26723_c1 | 3300050507 | Bacteria | 7019 |
| 665 | nmdc:mga05p37_31291_c1 | 3300050507 | Bacteria | 6500 |
| 666 | nmdc:mga05p37_35468_c1 | 3300050507 | Bacteria | 6116 |
| 667 | nmdc:mga05p37_4536_c1 | 3300050507 | Bacteria | 16231 |
| 668 | nmdc:mga05p37_4747_c1 | 3300050507 | Bacteria | 15879 |
| 669 | nmdc:mga05p37_60298_c1 | 3300050507 | Bacteria | 4672 |
| 670 | nmdc:mga09592_14874_c1 | 3300050508 | Bacteria | 6355 |
| 671 | nmdc:mga09592_20467_c1 | 3300050508 | Bacteria | 5440 |
| 672 | nmdc:mga09592_312631_c1 | 3300050508 | Bacteria | 1361 |
| 673 | nmdc:mga09592_57792_c1 | 3300050508 | Bacteria | 3279 |
| 674 | nmdc:mga0qj67_1124_c1 | 3300050509 | Bacteria | 18545 |
| 675 | nmdc:mga0qj67_1773_c1 | 3300050509 | Bacteria | 15254 |
| 676 | nmdc:mga06r32_217277_c1 | 3300050510 | Bacteria | 1899 |
| 677 | nmdc:mga06r32_26504_c1 | 3300050510 | Bacteria | 5405 |
| 678 | nmdc:mga06r32_30833_c1 | 3300050510 | Bacteria | 5032 |
| 679 | nmdc:mga06r32_96180_c1 | 3300050510 | Bacteria | 2900 |
| 680 | nmdc:mga08y16_18874_c1 | 3300050511 | Bacteria | 7264 |
| 681 | nmdc:mga08y16_312777_c1 | 3300050511 | Bacteria | 1618 |
| 682 | nmdc:mga08y16_8367_c1 | 3300050511 | Bacteria | 10822 |
| 683 | nmdc:mga0n895_119105_c1 | 3300050512 | Bacteria | 2661 |
| 684 | nmdc:mga0n895_12795_c1 | 3300050512 | Bacteria | 7536 |
| 685 | nmdc:mga0n895_35_c1 | 3300050512 | Bacteria | 79696 |
| 686 | nmdc:mga0n895_62939_c1 | 3300050512 | Bacteria | 3668 |
| 687 | nmdc:mga0n895_9176_c1 | 3300050512 | Bacteria | 8638 |
| 688 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 689 | nmdc:mga0rr50_20239_c1 | 3300050513 | Bacteria | 4512 |
| 690 | nmdc:mga0rr50_3767_c1 | 3300050513 | Bacteria | 8793 |
| 691 | nmdc:mga0rr50_7096_c1 | 3300050513 | Bacteria | 6880 |
| 692 | nmdc:mga0rr50_85727_c1 | 3300050513 | Bacteria | 2441 |
| 693 | nmdc:mga08x19_123564_c1 | 3300050514 | Bacteria | 1737 |
| 694 | nmdc:mga08x19_755_c1 | 3300050514 | Bacteria | 20656 |
| 695 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 696 | nmdc:mga0a205_137170_c1 | 3300050515 | Bacteria | 2347 |
| 697 | nmdc:mga0a205_37588_c1 | 3300050515 | Bacteria | 4655 |
| 698 | Ga0495601_0009859 | 3300053077 | Bacteria | 5656 |
| 699 | Ga0495601_0030691 | 3300053077 | Bacteria | 3339 |
| 700 | Ga0495601_0193033 | 3300053077 | Bacteria | 1331 |
| 701 | Ga0495619_0003759 | 3300053085 | Bacteria | 9772 |
| 702 | Ga0495619_0035218 | 3300053085 | Bacteria | 3256 |
| 703 | Ga0500555_026418 | 3300053103 | Bacteria | 1659 |
| 704 | Ga0590071_001581 | 3300059421 | Bacteria | 5958 |
| 705 | Ga0590075_000627 | 3300059424 | Bacteria | 9451 |
| 706 | Ga0590075_028840 | 3300059424 | Bacteria | 1402 |
| 707 | Ga0590077_000498 | 3300059426 | Bacteria | 10968 |
| 708 | Ga0590077_011713 | 3300059426 | Bacteria | 1812 |
| 709 | Ga0501082_0234020 | 3300060353 | Bacteria | 1599 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025903 | Ga0207680_10252988 | Ga0207680_102529882 | 322 |
| 2 | 3300046477 | Ga0495664_0142574 | Ga0495664_0142574_285_1307 | 324 |
| 3 | 3300009147 | Ga0114129_10048489 | Ga0114129_100484894 | 328 |
| 4 | 3300050507 | nmdc:mga05p37_151399_c1 | nmdc:mga05p37_151399_c1_1131_2126 | 328 |
| 5 | 3300005336 | Ga0070680_100076417 | Ga0070680_1000764173 | 329 |
| 6 | 3300005354 | Ga0070675_100157962 | Ga0070675_1001579621 | 331 |
| 7 | 3300006844 | Ga0075428_100000364 | Ga0075428_10000036444 | 331 |
| 8 | 3300047472 | Ga0495686_0000382 | Ga0495686_0000382_66942_68045 | 331 |
| 9 | 3300035725 | Ga0373947_0139286 | Ga0373947_0139286_367_1365 | 332 |
| 10 | 3300013102 | Ga0157371_10113183 | Ga0157371_101131832 | 333 |
| 11 | 3300013296 | Ga0157374_10009039 | Ga0157374_100090398 | 333 |
| 12 | 3300013307 | Ga0157372_10001132 | Ga0157372_1000113228 | 333 |
| 13 | 3300048929 | Ga0496126_0004803 | Ga0496126_0004803_4390_5391 | 333 |
| 14 | 3300005356 | Ga0070674_100010619 | Ga0070674_1000106193 | 334 |
| 15 | 3300005456 | Ga0070678_100102872 | Ga0070678_1001028722 | 334 |
| 16 | 3300005459 | Ga0068867_100040795 | Ga0068867_1000407954 | 334 |
| 17 | 3300006880 | Ga0075429_100033840 | Ga0075429_1000338405 | 334 |
| 18 | 3300009094 | Ga0111539_10049947 | Ga0111539_100499472 | 334 |
| 19 | 3300009147 | Ga0114129_10229445 | Ga0114129_102294452 | 334 |
| 20 | 3300026089 | Ga0207648_10048204 | Ga0207648_100482042 | 334 |
| 21 | 3300026121 | Ga0207683_10093026 | Ga0207683_100930263 | 334 |
| 22 | 3300050507 | nmdc:mga05p37_253830_c1 | nmdc:mga05p37_253830_c1_941_1948 | 334 |
| 23 | 3300050508 | nmdc:mga09592_14874_c1 | nmdc:mga09592_14874_c1_956_1963 | 334 |
| 24 | 3300050509 | nmdc:mga0qj67_1773_c1 | nmdc:mga0qj67_1773_c1_9537_10544 | 334 |
| 25 | 3300050510 | nmdc:mga06r32_217277_c1 | nmdc:mga06r32_217277_c1_385_1392 | 334 |
| 26 | 3300050510 | nmdc:mga06r32_30833_c1 | nmdc:mga06r32_30833_c1_3574_4581 | 334 |
| 27 | 3300005290 | Ga0065712_10006833 | Ga0065712_100068334 | 335 |
| 28 | 3300005293 | Ga0065715_10119435 | Ga0065715_101194352 | 335 |
| 29 | 3300005331 | Ga0070670_100047338 | Ga0070670_1000473383 | 335 |
| 30 | 3300005334 | Ga0068869_100012602 | Ga0068869_1000126023 | 335 |
| 31 | 3300005335 | Ga0070666_10150146 | Ga0070666_101501462 | 335 |
| 32 | 3300005353 | Ga0070669_100040918 | Ga0070669_1000409182 | 335 |
| 33 | 3300005354 | Ga0070675_100027795 | Ga0070675_1000277954 | 335 |
| 34 | 3300005354 | Ga0070675_100138379 | Ga0070675_1001383792 | 335 |
| 35 | 3300005356 | Ga0070674_100291949 | Ga0070674_1002919491 | 335 |
| 36 | 3300005364 | Ga0070673_100062093 | Ga0070673_1000620933 | 335 |
| 37 | 3300005365 | Ga0070688_100086199 | Ga0070688_1000861992 | 335 |
| 38 | 3300005456 | Ga0070678_100128053 | Ga0070678_1001280532 | 335 |
| 39 | 3300005543 | Ga0070672_100003190 | Ga0070672_1000031907 | 335 |
| 40 | 3300005577 | Ga0068857_100084925 | Ga0068857_1000849253 | 335 |
| 41 | 3300005617 | Ga0068859_100079735 | Ga0068859_1000797353 | 335 |
| 42 | 3300005840 | Ga0068870_10029783 | Ga0068870_100297833 | 335 |
| 43 | 3300006931 | Ga0097620_100079736 | Ga0097620_1000797362 | 335 |
| 44 | 3300014325 | Ga0163163_10288376 | Ga0163163_102883762 | 335 |
| 45 | 3300014326 | Ga0157380_10025522 | Ga0157380_100255222 | 335 |
| 46 | 3300025901 | Ga0207688_10079285 | Ga0207688_100792852 | 335 |
| 47 | 3300025903 | Ga0207680_10042140 | Ga0207680_100421403 | 335 |
| 48 | 3300025908 | Ga0207643_10006154 | Ga0207643_100061544 | 335 |
| 49 | 3300025923 | Ga0207681_10069176 | Ga0207681_100691762 | 335 |
| 50 | 3300025925 | Ga0207650_10057077 | Ga0207650_100570772 | 335 |
| 51 | 3300025926 | Ga0207659_10027937 | Ga0207659_100279373 | 335 |
| 52 | 3300025926 | Ga0207659_10037071 | Ga0207659_100370713 | 335 |
| 53 | 3300025926 | Ga0207659_10088672 | Ga0207659_100886723 | 335 |
| 54 | 3300025933 | Ga0207706_10017828 | Ga0207706_100178283 | 335 |
| 55 | 3300025940 | Ga0207691_10009310 | Ga0207691_100093104 | 335 |
| 56 | 3300025960 | Ga0207651_10142570 | Ga0207651_101425702 | 335 |
| 57 | 3300026075 | Ga0207708_10114066 | Ga0207708_101140661 | 335 |
| 58 | 3300026116 | Ga0207674_10186955 | Ga0207674_101869552 | 335 |
| 59 | 3300026118 | Ga0207675_100073741 | Ga0207675_1000737414 | 335 |
| 60 | 3300026118 | Ga0207675_100107490 | Ga0207675_1001074902 | 335 |
| 61 | 3300026121 | Ga0207683_10032747 | Ga0207683_100327472 | 335 |
| 62 | 3300005331 | Ga0070670_100005558 | Ga0070670_1000055582 | 336 |
| 63 | 3300006173 | Ga0070716_100077051 | Ga0070716_1000770512 | 336 |
| 64 | 3300006871 | Ga0075434_100003240 | Ga0075434_1000032407 | 336 |
| 65 | 3300025939 | Ga0207665_10168518 | Ga0207665_101685181 | 336 |
| 66 | 3300025945 | Ga0207679_10015458 | Ga0207679_100154583 | 336 |
| 67 | 3300026116 | Ga0207674_10135888 | Ga0207674_101358882 | 336 |
| 68 | 3300050512 | nmdc:mga0n895_9176_c1 | nmdc:mga0n895_9176_c1_4378_5397 | 336 |
| 69 | 3300049577 | Ga0501041_0121308 | Ga0501041_0121308_587_1615 | 337 |
| 70 | 3300005355 | Ga0070671_100301754 | Ga0070671_1003017542 | 338 |
| 71 | 3300005458 | Ga0070681_10398797 | Ga0070681_103987971 | 338 |
| 72 | 3300007076 | Ga0075435_100002191 | Ga0075435_1000021917 | 338 |
| 73 | 3300009147 | Ga0114129_10104363 | Ga0114129_101043633 | 338 |
| 74 | 3300034816 | Ga0373930_0005342 | Ga0373930_0005342_1084_2100 | 338 |
| 75 | 3300034817 | Ga0373948_0009173 | Ga0373948_0009173_325_1341 | 338 |
| 76 | 3300034818 | Ga0373950_0000985 | Ga0373950_0000985_1672_2688 | 338 |
| 77 | 3300034957 | Ga0373938_0002908 | Ga0373938_0002908_226_1242 | 338 |
| 78 | 3300035085 | Ga0373929_0000163 | Ga0373929_0000163_5346_6362 | 338 |
| 79 | 3300035088 | Ga0373940_0000203 | Ga0373940_0000203_4416_5432 | 338 |
| 80 | 3300035090 | Ga0373949_0001328 | Ga0373949_0001328_334_1350 | 338 |
| 81 | 3300035091 | Ga0373951_0000732 | Ga0373951_0000732_1135_2151 | 338 |
| 82 | 3300035092 | Ga0373952_0003388 | Ga0373952_0003388_1151_2167 | 338 |
| 83 | 3300035112 | Ga0373932_0000277 | Ga0373932_0000277_9074_10090 | 338 |
| 84 | 3300035114 | Ga0373939_0001054 | Ga0373939_0001054_444_1460 | 338 |
| 85 | 3300035121 | Ga0373960_0001680 | Ga0373960_0001680_3702_4718 | 338 |
| 86 | 3300035242 | Ga0373962_0001306 | Ga0373962_0001306_1281_2297 | 338 |
| 87 | 3300045051 | Ga0451576_0040199 | Ga0451576_0040199_1753_2769 | 338 |
| 88 | 3300048909 | Ga0496106_0032282 | Ga0496106_0032282_2834_3850 | 338 |
| 89 | 3300050513 | nmdc:mga0rr50_7096_c1 | nmdc:mga0rr50_7096_c1_371_1387 | 338 |
| 90 | 3300005295 | Ga0065707_10084507 | Ga0065707_100845076 | 339 |
| 91 | 3300005340 | Ga0070689_100017917 | Ga0070689_1000179175 | 339 |
| 92 | 3300005354 | Ga0070675_100230880 | Ga0070675_1002308801 | 339 |
| 93 | 3300005544 | Ga0070686_100088003 | Ga0070686_1000880033 | 339 |
| 94 | 3300005617 | Ga0068859_100028738 | Ga0068859_1000287384 | 339 |
| 95 | 3300005844 | Ga0068862_100008314 | Ga0068862_1000083146 | 339 |
| 96 | 3300006880 | Ga0075429_100008602 | Ga0075429_1000086027 | 339 |
| 97 | 3300006931 | Ga0097620_100028740 | Ga0097620_1000287404 | 339 |
| 98 | 3300009094 | Ga0111539_10011681 | Ga0111539_1001168111 | 339 |
| 99 | 3300009094 | Ga0111539_10441776 | Ga0111539_104417762 | 339 |
| 100 | 3300009101 | Ga0105247_10173739 | Ga0105247_101737391 | 339 |
| 101 | 3300009147 | Ga0114129_10013084 | Ga0114129_100130846 | 339 |
| 102 | 3300009177 | Ga0105248_10066871 | Ga0105248_100668712 | 339 |
| 103 | 3300009177 | Ga0105248_10073388 | Ga0105248_100733884 | 339 |
| 104 | 3300009177 | Ga0105248_10267912 | Ga0105248_102679121 | 339 |
| 105 | 3300009553 | Ga0105249_10286885 | Ga0105249_102868852 | 339 |
| 106 | 3300014326 | Ga0157380_10010849 | Ga0157380_100108493 | 339 |
| 107 | 3300025926 | Ga0207659_10091570 | Ga0207659_100915702 | 339 |
| 108 | 3300025926 | Ga0207659_10198668 | Ga0207659_101986681 | 339 |
| 109 | 3300025941 | Ga0207711_10069704 | Ga0207711_100697043 | 339 |
| 110 | 3300025942 | Ga0207689_10114151 | Ga0207689_101141512 | 339 |
| 111 | 3300026088 | Ga0207641_10167637 | Ga0207641_101676373 | 339 |
| 112 | 3300027907 | Ga0207428_10001780 | Ga0207428_100017807 | 339 |
| 113 | 3300028380 | Ga0268265_10072698 | Ga0268265_100726982 | 339 |
| 114 | 3300028381 | Ga0268264_10122673 | Ga0268264_101226733 | 339 |
| 115 | 3300031731 | Ga0307405_10130308 | Ga0307405_101303082 | 339 |
| 116 | 3300031995 | Ga0307409_100474587 | Ga0307409_1004745871 | 339 |
| 117 | 3300032002 | Ga0307416_100013904 | Ga0307416_1000139044 | 339 |
| 118 | 3300046664 | Ga0495659_0021962 | Ga0495659_0021962_715_1737 | 339 |
| 119 | 3300048907 | Ga0496104_0021109 | Ga0496104_0021109_2932_3954 | 339 |
| 120 | 3300048915 | Ga0496112_0086626 | Ga0496112_0086626_1506_2528 | 339 |
| 121 | 3300049580 | Ga0501046_0160385 | Ga0501046_0160385_586_1611 | 339 |
| 122 | 3300049587 | Ga0501071_0150453 | Ga0501071_0150453_497_1522 | 339 |
| 123 | 3300049589 | Ga0501073_0003486 | Ga0501073_0003486_7880_8905 | 339 |
| 124 | 3300049590 | Ga0501074_0086925 | Ga0501074_0086925_364_1389 | 339 |
| 125 | 3300050507 | nmdc:mga05p37_4747_c1 | nmdc:mga05p37_4747_c1_3719_4741 | 339 |
| 126 | 3300050508 | nmdc:mga09592_57792_c1 | nmdc:mga09592_57792_c1_210_1232 | 339 |
| 127 | 3300050513 | nmdc:mga0rr50_85727_c1 | nmdc:mga0rr50_85727_c1_468_1496 | 339 |
| 128 | 3300053103 | Ga0500555_026418 | Ga0500555_026418_243_1268 | 339 |
| 129 | 3300059424 | Ga0590075_028840 | Ga0590075_028840_210_1229 | 339 |
| 130 | 3300059426 | Ga0590077_011713 | Ga0590077_011713_74_1096 | 339 |
| 131 | 3300005290 | Ga0065712_10122814 | Ga0065712_101228142 | 340 |
| 132 | 3300005329 | Ga0070683_100000219 | Ga0070683_1000002197 | 340 |
| 133 | 3300005331 | Ga0070670_100021126 | Ga0070670_1000211266 | 340 |
| 134 | 3300005344 | Ga0070661_100019594 | Ga0070661_1000195944 | 340 |
| 135 | 3300005353 | Ga0070669_100097632 | Ga0070669_1000976322 | 340 |
| 136 | 3300005354 | Ga0070675_100041425 | Ga0070675_1000414253 | 340 |
| 137 | 3300005356 | Ga0070674_100361199 | Ga0070674_1003611991 | 340 |
| 138 | 3300005434 | Ga0070709_10098283 | Ga0070709_100982832 | 340 |
| 139 | 3300005436 | Ga0070713_100127070 | Ga0070713_1001270703 | 340 |
| 140 | 3300005455 | Ga0070663_100019435 | Ga0070663_1000194353 | 340 |
| 141 | 3300005471 | Ga0070698_100131060 | Ga0070698_1001310601 | 340 |
| 142 | 3300005471 | Ga0070698_100292779 | Ga0070698_1002927792 | 340 |
| 143 | 3300005518 | Ga0070699_100017361 | Ga0070699_1000173614 | 340 |
| 144 | 3300005535 | Ga0070684_100004177 | Ga0070684_1000041775 | 340 |
| 145 | 3300005564 | Ga0070664_100005403 | Ga0070664_1000054034 | 340 |
| 146 | 3300005617 | Ga0068859_100033089 | Ga0068859_1000330893 | 340 |
| 147 | 3300005617 | Ga0068859_100399926 | Ga0068859_1003999262 | 340 |
| 148 | 3300005618 | Ga0068864_100013647 | Ga0068864_1000136476 | 340 |
| 149 | 3300005618 | Ga0068864_100095356 | Ga0068864_1000953561 | 340 |
| 150 | 3300005718 | Ga0068866_10001191 | Ga0068866_100011917 | 340 |
| 151 | 3300005719 | Ga0068861_100258453 | Ga0068861_1002584532 | 340 |
| 152 | 3300005842 | Ga0068858_100009818 | Ga0068858_1000098186 | 340 |
| 153 | 3300005842 | Ga0068858_100034388 | Ga0068858_1000343885 | 340 |
| 154 | 3300005842 | Ga0068858_100135852 | Ga0068858_1001358522 | 340 |
| 155 | 3300005843 | Ga0068860_100304871 | Ga0068860_1003048712 | 340 |
| 156 | 3300005937 | Ga0081455_10021838 | Ga0081455_100218384 | 340 |
| 157 | 3300005983 | Ga0081540_1007130 | Ga0081540_10071305 | 340 |
| 158 | 3300006028 | Ga0070717_10046772 | Ga0070717_100467722 | 340 |
| 159 | 3300006844 | Ga0075428_100070245 | Ga0075428_1000702453 | 340 |
| 160 | 3300006871 | Ga0075434_100005959 | Ga0075434_1000059597 | 340 |
| 161 | 3300006871 | Ga0075434_100014805 | Ga0075434_1000148053 | 340 |
| 162 | 3300006871 | Ga0075434_100171329 | Ga0075434_1001713292 | 340 |
| 163 | 3300006881 | Ga0068865_100127798 | Ga0068865_1001277982 | 340 |
| 164 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002227 | 340 |
| 165 | 3300006914 | Ga0075436_100014436 | Ga0075436_1000144363 | 340 |
| 166 | 3300006914 | Ga0075436_100038172 | Ga0075436_1000381722 | 340 |
| 167 | 3300006914 | Ga0075436_100122792 | Ga0075436_1001227922 | 340 |
| 168 | 3300006914 | Ga0075436_100141285 | Ga0075436_1001412852 | 340 |
| 169 | 3300006931 | Ga0097620_100033089 | Ga0097620_1000330893 | 340 |
| 170 | 3300006931 | Ga0097620_100399918 | Ga0097620_1003999182 | 340 |
| 171 | 3300007076 | Ga0075435_100000346 | Ga0075435_10000034622 | 340 |
| 172 | 3300007076 | Ga0075435_100005602 | Ga0075435_1000056029 | 340 |
| 173 | 3300007076 | Ga0075435_100015759 | Ga0075435_1000157594 | 340 |
| 174 | 3300009093 | Ga0105240_10010389 | Ga0105240_1001038911 | 340 |
| 175 | 3300009094 | Ga0111539_10111128 | Ga0111539_101111283 | 340 |
| 176 | 3300009098 | Ga0105245_10010419 | Ga0105245_100104194 | 340 |
| 177 | 3300009147 | Ga0114129_10039725 | Ga0114129_100397254 | 340 |
| 178 | 3300009147 | Ga0114129_10047663 | Ga0114129_100476633 | 340 |
| 179 | 3300009177 | Ga0105248_10005114 | Ga0105248_100051148 | 340 |
| 180 | 3300009177 | Ga0105248_10025773 | Ga0105248_100257734 | 340 |
| 181 | 3300009177 | Ga0105248_10161866 | Ga0105248_101618663 | 340 |
| 182 | 3300013296 | Ga0157374_10072706 | Ga0157374_100727063 | 340 |
| 183 | 3300013296 | Ga0157374_10183090 | Ga0157374_101830903 | 340 |
| 184 | 3300013306 | Ga0163162_10215887 | Ga0163162_102158872 | 340 |
| 185 | 3300013308 | Ga0157375_10118012 | Ga0157375_101180122 | 340 |
| 186 | 3300013308 | Ga0157375_10319371 | Ga0157375_103193712 | 340 |
| 187 | 3300014325 | Ga0163163_10014932 | Ga0163163_100149326 | 340 |
| 188 | 3300014969 | Ga0157376_10086181 | Ga0157376_100861814 | 340 |
| 189 | 3300014969 | Ga0157376_10273387 | Ga0157376_102733872 | 340 |
| 190 | 3300025903 | Ga0207680_10032963 | Ga0207680_100329633 | 340 |
| 191 | 3300025906 | Ga0207699_10057965 | Ga0207699_100579652 | 340 |
| 192 | 3300025906 | Ga0207699_10108006 | Ga0207699_101080062 | 340 |
| 193 | 3300025907 | Ga0207645_10114258 | Ga0207645_101142582 | 340 |
| 194 | 3300025920 | Ga0207649_10006738 | Ga0207649_100067384 | 340 |
| 195 | 3300025923 | Ga0207681_10006478 | Ga0207681_100064782 | 340 |
| 196 | 3300025925 | Ga0207650_10075745 | Ga0207650_100757453 | 340 |
| 197 | 3300025927 | Ga0207687_10031659 | Ga0207687_100316592 | 340 |
| 198 | 3300025928 | Ga0207700_10105323 | Ga0207700_101053232 | 340 |
| 199 | 3300025932 | Ga0207690_10025257 | Ga0207690_100252573 | 340 |
| 200 | 3300025939 | Ga0207665_10052450 | Ga0207665_100524502 | 340 |
| 201 | 3300025940 | Ga0207691_10167848 | Ga0207691_101678482 | 340 |
| 202 | 3300025941 | Ga0207711_10022810 | Ga0207711_100228102 | 340 |
| 203 | 3300025941 | Ga0207711_10354195 | Ga0207711_103541952 | 340 |
| 204 | 3300025942 | Ga0207689_10169595 | Ga0207689_101695952 | 340 |
| 205 | 3300025944 | Ga0207661_10005019 | Ga0207661_100050197 | 340 |
| 206 | 3300025945 | Ga0207679_10080000 | Ga0207679_100800002 | 340 |
| 207 | 3300025961 | Ga0207712_10097210 | Ga0207712_100972102 | 340 |
| 208 | 3300026035 | Ga0207703_10026803 | Ga0207703_100268032 | 340 |
| 209 | 3300026035 | Ga0207703_10045454 | Ga0207703_100454543 | 340 |
| 210 | 3300026095 | Ga0207676_10012097 | Ga0207676_100120972 | 340 |
| 211 | 3300026095 | Ga0207676_10090997 | Ga0207676_100909971 | 340 |
| 212 | 3300027907 | Ga0207428_10023970 | Ga0207428_100239703 | 340 |
| 213 | 3300028379 | Ga0268266_10022544 | Ga0268266_100225442 | 340 |
| 214 | 3300028381 | Ga0268264_10139070 | Ga0268264_101390702 | 340 |
| 215 | 3300028381 | Ga0268264_10323779 | Ga0268264_103237791 | 340 |
| 216 | 3300028381 | Ga0268264_10370826 | Ga0268264_103708261 | 340 |
| 217 | 3300031238 | Ga0265332_10065466 | Ga0265332_100654661 | 340 |
| 218 | 3300031249 | Ga0265339_10016804 | Ga0265339_100168046 | 340 |
| 219 | 3300031731 | Ga0307405_10084624 | Ga0307405_100846242 | 340 |
| 220 | 3300031911 | Ga0307412_10187716 | Ga0307412_101877161 | 340 |
| 221 | 3300031995 | Ga0307409_100094124 | Ga0307409_1000941243 | 340 |
| 222 | 3300031995 | Ga0307409_100187555 | Ga0307409_1001875552 | 340 |
| 223 | 3300032002 | Ga0307416_100006624 | Ga0307416_1000066242 | 340 |
| 224 | 3300032005 | Ga0307411_10026713 | Ga0307411_100267132 | 340 |
| 225 | 3300032005 | Ga0307411_10061367 | Ga0307411_100613673 | 340 |
| 226 | 3300032126 | Ga0307415_100034503 | Ga0307415_1000345033 | 340 |
| 227 | 3300035171 | Ga0373946_0002728 | Ga0373946_0002728_2095_3117 | 340 |
| 228 | 3300036401 | Ga0373937_0002195 | Ga0373937_0002195_6312_7334 | 340 |
| 229 | 3300036401 | Ga0373937_0208778 | Ga0373937_0208778_129_1151 | 340 |
| 230 | 3300036401 | Ga0373937_0335613 | Ga0373937_0335613_231_1253 | 340 |
| 231 | 3300045976 | Ga0466967_0406711 | Ga0466967_0406711_216_1241 | 340 |
| 232 | 3300046463 | Ga0495653_0163278 | Ga0495653_0163278_154_1179 | 340 |
| 233 | 3300046472 | Ga0495580_0144140 | Ga0495580_0144140_201_1223 | 340 |
| 234 | 3300046516 | Ga0495628_0101905 | Ga0495628_0101905_461_1483 | 340 |
| 235 | 3300046517 | Ga0495630_0023677 | Ga0495630_0023677_602_1624 | 340 |
| 236 | 3300046543 | Ga0495645_0009063 | Ga0495645_0009063_5379_6401 | 340 |
| 237 | 3300046683 | Ga0495658_0064983 | Ga0495658_0064983_205_1230 | 340 |
| 238 | 3300046684 | Ga0495669_0000860 | Ga0495669_0000860_1725_2747 | 340 |
| 239 | 3300046689 | Ga0495613_0014767 | Ga0495613_0014767_4701_5723 | 340 |
| 240 | 3300047317 | Ga0495604_0068058 | Ga0495604_0068058_592_1614 | 340 |
| 241 | 3300047319 | Ga0495674_0046843 | Ga0495674_0046843_1377_2399 | 340 |
| 242 | 3300047471 | Ga0495684_0000549 | Ga0495684_0000549_1702_2724 | 340 |
| 243 | 3300048088 | Ga0495602_0172286 | Ga0495602_0172286_614_1636 | 340 |
| 244 | 3300048907 | Ga0496104_0012179 | Ga0496104_0012179_1984_3015 | 340 |
| 245 | 3300048907 | Ga0496104_0102223 | Ga0496104_0102223_732_1757 | 340 |
| 246 | 3300048907 | Ga0496104_0143115 | Ga0496104_0143115_676_1701 | 340 |
| 247 | 3300048908 | Ga0496105_0010021 | Ga0496105_0010021_2864_3895 | 340 |
| 248 | 3300048911 | Ga0496108_0001066 | Ga0496108_0001066_4014_5045 | 340 |
| 249 | 3300048912 | Ga0496109_0000525 | Ga0496109_0000525_4467_5498 | 340 |
| 250 | 3300048913 | Ga0496110_0001750 | Ga0496110_0001750_1120_2151 | 340 |
| 251 | 3300048914 | Ga0496111_0000267 | Ga0496111_0000267_5016_6047 | 340 |
| 252 | 3300048915 | Ga0496112_0004758 | Ga0496112_0004758_6048_7079 | 340 |
| 253 | 3300048915 | Ga0496112_0034440 | Ga0496112_0034440_3671_4696 | 340 |
| 254 | 3300048916 | Ga0496113_0019024 | Ga0496113_0019024_2115_3140 | 340 |
| 255 | 3300048916 | Ga0496113_0071872 | Ga0496113_0071872_1322_2353 | 340 |
| 256 | 3300049573 | Ga0501037_0181393 | Ga0501037_0181393_360_1385 | 340 |
| 257 | 3300049583 | Ga0501067_0019332 | Ga0501067_0019332_292_1329 | 340 |
| 258 | 3300049823 | Ga0501044_0029063 | Ga0501044_0029063_768_1793 | 340 |
| 259 | 3300050507 | nmdc:mga05p37_10494_c2 | nmdc:mga05p37_10494_c2_5578_6603 | 340 |
| 260 | 3300050507 | nmdc:mga05p37_31291_c1 | nmdc:mga05p37_31291_c1_4772_5797 | 340 |
| 261 | 3300050507 | nmdc:mga05p37_60298_c1 | nmdc:mga05p37_60298_c1_206_1231 | 340 |
| 262 | 3300050508 | nmdc:mga09592_312631_c1 | nmdc:mga09592_312631_c1_52_1077 | 340 |
| 263 | 3300050510 | nmdc:mga06r32_96180_c1 | nmdc:mga06r32_96180_c1_867_1895 | 340 |
| 264 | 3300050511 | nmdc:mga08y16_312777_c1 | nmdc:mga08y16_312777_c1_61_1086 | 340 |
| 265 | 3300050512 | nmdc:mga0n895_119105_c1 | nmdc:mga0n895_119105_c1_1187_2212 | 340 |
| 266 | 3300050512 | nmdc:mga0n895_35_c1 | nmdc:mga0n895_35_c1_5267_6292 | 340 |
| 267 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_5267_6292 | 340 |
| 268 | 3300050513 | nmdc:mga0rr50_3767_c1 | nmdc:mga0rr50_3767_c1_6109_7134 | 340 |
| 269 | 3300050514 | nmdc:mga08x19_755_c1 | nmdc:mga08x19_755_c1_14393_15418 | 340 |
| 270 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_152993_154018 | 340 |
| 271 | 3300053085 | Ga0495619_0003759 | Ga0495619_0003759_8455_9477 | 340 |
| 272 | 3300053085 | Ga0495619_0035218 | Ga0495619_0035218_1151_2176 | 340 |
| 273 | 3300059421 | Ga0590071_001581 | Ga0590071_001581_3058_4089 | 340 |
| 274 | 3300059424 | Ga0590075_000627 | Ga0590075_000627_407_1438 | 340 |
| 275 | 3300059426 | Ga0590077_000498 | Ga0590077_000498_4517_5548 | 340 |
| 276 | 3300005331 | Ga0070670_100120931 | Ga0070670_1001209312 | 341 |
| 277 | 3300005335 | Ga0070666_10007292 | Ga0070666_100072926 | 341 |
| 278 | 3300005335 | Ga0070666_10078652 | Ga0070666_100786522 | 341 |
| 279 | 3300005338 | Ga0068868_100000672 | Ga0068868_10000067216 | 341 |
| 280 | 3300005338 | Ga0068868_100020771 | Ga0068868_1000207712 | 341 |
| 281 | 3300005338 | Ga0068868_100138296 | Ga0068868_1001382962 | 341 |
| 282 | 3300005344 | Ga0070661_100008061 | Ga0070661_1000080617 | 341 |
| 283 | 3300005353 | Ga0070669_100220675 | Ga0070669_1002206752 | 341 |
| 284 | 3300005356 | Ga0070674_100075450 | Ga0070674_1000754502 | 341 |
| 285 | 3300005364 | Ga0070673_100008245 | Ga0070673_1000082454 | 341 |
| 286 | 3300005364 | Ga0070673_100066244 | Ga0070673_1000662443 | 341 |
| 287 | 3300005364 | Ga0070673_100249254 | Ga0070673_1002492541 | 341 |
| 288 | 3300005366 | Ga0070659_100015437 | Ga0070659_1000154374 | 341 |
| 289 | 3300005367 | Ga0070667_100023077 | Ga0070667_1000230772 | 341 |
| 290 | 3300005441 | Ga0070700_100319731 | Ga0070700_1003197311 | 341 |
| 291 | 3300005458 | Ga0070681_10023707 | Ga0070681_100237073 | 341 |
| 292 | 3300005458 | Ga0070681_10140535 | Ga0070681_101405352 | 341 |
| 293 | 3300005543 | Ga0070672_100003279 | Ga0070672_10000327910 | 341 |
| 294 | 3300005544 | Ga0070686_100011648 | Ga0070686_1000116485 | 341 |
| 295 | 3300005548 | Ga0070665_100011352 | Ga0070665_1000113526 | 341 |
| 296 | 3300005548 | Ga0070665_100023727 | Ga0070665_1000237273 | 341 |
| 297 | 3300005563 | Ga0068855_100243156 | Ga0068855_1002431562 | 341 |
| 298 | 3300005564 | Ga0070664_100001996 | Ga0070664_1000019963 | 341 |
| 299 | 3300005617 | Ga0068859_100050677 | Ga0068859_1000506773 | 341 |
| 300 | 3300005617 | Ga0068859_100308187 | Ga0068859_1003081872 | 341 |
| 301 | 3300005618 | Ga0068864_100001251 | Ga0068864_10000125116 | 341 |
| 302 | 3300005618 | Ga0068864_100006868 | Ga0068864_1000068685 | 341 |
| 303 | 3300005834 | Ga0068851_10064677 | Ga0068851_100646772 | 341 |
| 304 | 3300005841 | Ga0068863_100023057 | Ga0068863_1000230573 | 341 |
| 305 | 3300005841 | Ga0068863_100049767 | Ga0068863_1000497672 | 341 |
| 306 | 3300005841 | Ga0068863_100372639 | Ga0068863_1003726392 | 341 |
| 307 | 3300005842 | Ga0068858_100051993 | Ga0068858_1000519933 | 341 |
| 308 | 3300005842 | Ga0068858_100215491 | Ga0068858_1002154912 | 341 |
| 309 | 3300005985 | Ga0081539_10024630 | Ga0081539_100246303 | 341 |
| 310 | 3300006237 | Ga0097621_100007914 | Ga0097621_1000079147 | 341 |
| 311 | 3300006237 | Ga0097621_100007951 | Ga0097621_1000079516 | 341 |
| 312 | 3300006237 | Ga0097621_100013125 | Ga0097621_1000131254 | 341 |
| 313 | 3300006237 | Ga0097621_100031616 | Ga0097621_1000316162 | 341 |
| 314 | 3300006358 | Ga0068871_100000863 | Ga0068871_1000008636 | 341 |
| 315 | 3300006358 | Ga0068871_100008275 | Ga0068871_1000082754 | 341 |
| 316 | 3300006358 | Ga0068871_100043732 | Ga0068871_1000437324 | 341 |
| 317 | 3300006358 | Ga0068871_100161676 | Ga0068871_1001616763 | 341 |
| 318 | 3300006358 | Ga0068871_100166565 | Ga0068871_1001665652 | 341 |
| 319 | 3300006846 | Ga0075430_100000555 | Ga0075430_1000005554 | 341 |
| 320 | 3300006847 | Ga0075431_100020182 | Ga0075431_1000201823 | 341 |
| 321 | 3300006847 | Ga0075431_100034207 | Ga0075431_1000342075 | 341 |
| 322 | 3300006852 | Ga0075433_10031264 | Ga0075433_100312644 | 341 |
| 323 | 3300006871 | Ga0075434_100029208 | Ga0075434_1000292083 | 341 |
| 324 | 3300006871 | Ga0075434_100048927 | Ga0075434_1000489272 | 341 |
| 325 | 3300006871 | Ga0075434_100258295 | Ga0075434_1002582951 | 341 |
| 326 | 3300006881 | Ga0068865_100004795 | Ga0068865_1000047954 | 341 |
| 327 | 3300006881 | Ga0068865_100078750 | Ga0068865_1000787503 | 341 |
| 328 | 3300006914 | Ga0075436_100134116 | Ga0075436_1001341162 | 341 |
| 329 | 3300006931 | Ga0097620_100050677 | Ga0097620_1000506773 | 341 |
| 330 | 3300006931 | Ga0097620_100308169 | Ga0097620_1003081692 | 341 |
| 331 | 3300007076 | Ga0075435_100010740 | Ga0075435_1000107404 | 341 |
| 332 | 3300007076 | Ga0075435_100033922 | Ga0075435_1000339224 | 341 |
| 333 | 3300009094 | Ga0111539_10004361 | Ga0111539_100043616 | 341 |
| 334 | 3300009094 | Ga0111539_10026321 | Ga0111539_100263213 | 341 |
| 335 | 3300009098 | Ga0105245_10018240 | Ga0105245_100182404 | 341 |
| 336 | 3300009098 | Ga0105245_10094137 | Ga0105245_100941373 | 341 |
| 337 | 3300009147 | Ga0114129_10014211 | Ga0114129_100142117 | 341 |
| 338 | 3300009148 | Ga0105243_10422857 | Ga0105243_104228572 | 341 |
| 339 | 3300009176 | Ga0105242_10006628 | Ga0105242_100066284 | 341 |
| 340 | 3300009177 | Ga0105248_10033272 | Ga0105248_100332723 | 341 |
| 341 | 3300009177 | Ga0105248_10069483 | Ga0105248_100694834 | 341 |
| 342 | 3300009177 | Ga0105248_10073651 | Ga0105248_100736512 | 341 |
| 343 | 3300009177 | Ga0105248_10075284 | Ga0105248_100752843 | 341 |
| 344 | 3300009177 | Ga0105248_10269576 | Ga0105248_102695762 | 341 |
| 345 | 3300013105 | Ga0157369_10294993 | Ga0157369_102949931 | 341 |
| 346 | 3300013297 | Ga0157378_10015600 | Ga0157378_100156005 | 341 |
| 347 | 3300013306 | Ga0163162_10004597 | Ga0163162_100045977 | 341 |
| 348 | 3300013306 | Ga0163162_10148861 | Ga0163162_101488611 | 341 |
| 349 | 3300013306 | Ga0163162_10440142 | Ga0163162_104401422 | 341 |
| 350 | 3300013307 | Ga0157372_10327434 | Ga0157372_103274342 | 341 |
| 351 | 3300013307 | Ga0157372_10437784 | Ga0157372_104377842 | 341 |
| 352 | 3300013308 | Ga0157375_10030460 | Ga0157375_100304602 | 341 |
| 353 | 3300013308 | Ga0157375_10056413 | Ga0157375_100564132 | 341 |
| 354 | 3300013308 | Ga0157375_10362254 | Ga0157375_103622542 | 341 |
| 355 | 3300014325 | Ga0163163_10007028 | Ga0163163_100070284 | 341 |
| 356 | 3300014325 | Ga0163163_10115054 | Ga0163163_101150543 | 341 |
| 357 | 3300014325 | Ga0163163_10186714 | Ga0163163_101867142 | 341 |
| 358 | 3300014326 | Ga0157380_10071933 | Ga0157380_100719332 | 341 |
| 359 | 3300014969 | Ga0157376_10037758 | Ga0157376_100377584 | 341 |
| 360 | 3300014969 | Ga0157376_10113077 | Ga0157376_101130772 | 341 |
| 361 | 3300014969 | Ga0157376_10216863 | Ga0157376_102168632 | 341 |
| 362 | 3300014969 | Ga0157376_10446535 | Ga0157376_104465351 | 341 |
| 363 | 3300017792 | Ga0163161_10267393 | Ga0163161_102673932 | 341 |
| 364 | 3300025903 | Ga0207680_10004658 | Ga0207680_100046582 | 341 |
| 365 | 3300025912 | Ga0207707_10168455 | Ga0207707_101684551 | 341 |
| 366 | 3300025920 | Ga0207649_10010211 | Ga0207649_100102113 | 341 |
| 367 | 3300025922 | Ga0207646_10072856 | Ga0207646_100728563 | 341 |
| 368 | 3300025925 | Ga0207650_10000845 | Ga0207650_1000084510 | 341 |
| 369 | 3300025926 | Ga0207659_10009805 | Ga0207659_100098054 | 341 |
| 370 | 3300025927 | Ga0207687_10052187 | Ga0207687_100521872 | 341 |
| 371 | 3300025931 | Ga0207644_10002155 | Ga0207644_1000215511 | 341 |
| 372 | 3300025932 | Ga0207690_10205745 | Ga0207690_102057452 | 341 |
| 373 | 3300025934 | Ga0207686_10004844 | Ga0207686_100048445 | 341 |
| 374 | 3300025934 | Ga0207686_10011649 | Ga0207686_100116492 | 341 |
| 375 | 3300025934 | Ga0207686_10043936 | Ga0207686_100439362 | 341 |
| 376 | 3300025935 | Ga0207709_10265220 | Ga0207709_102652202 | 341 |
| 377 | 3300025937 | Ga0207669_10129025 | Ga0207669_101290251 | 341 |
| 378 | 3300025938 | Ga0207704_10007156 | Ga0207704_100071562 | 341 |
| 379 | 3300025940 | Ga0207691_10020940 | Ga0207691_100209403 | 341 |
| 380 | 3300025940 | Ga0207691_10029528 | Ga0207691_100295283 | 341 |
| 381 | 3300025941 | Ga0207711_10019972 | Ga0207711_100199723 | 341 |
| 382 | 3300025941 | Ga0207711_10027546 | Ga0207711_100275462 | 341 |
| 383 | 3300025941 | Ga0207711_10056074 | Ga0207711_100560743 | 341 |
| 384 | 3300025960 | Ga0207651_10004258 | Ga0207651_100042587 | 341 |
| 385 | 3300025986 | Ga0207658_10020848 | Ga0207658_100208483 | 341 |
| 386 | 3300026023 | Ga0207677_10001276 | Ga0207677_100012767 | 341 |
| 387 | 3300026023 | Ga0207677_10038732 | Ga0207677_100387322 | 341 |
| 388 | 3300026023 | Ga0207677_10074822 | Ga0207677_100748222 | 341 |
| 389 | 3300026035 | Ga0207703_10052897 | Ga0207703_100528973 | 341 |
| 390 | 3300026035 | Ga0207703_10147339 | Ga0207703_101473392 | 341 |
| 391 | 3300026035 | Ga0207703_10175334 | Ga0207703_101753342 | 341 |
| 392 | 3300026035 | Ga0207703_10187849 | Ga0207703_101878492 | 341 |
| 393 | 3300026088 | Ga0207641_10003438 | Ga0207641_100034385 | 341 |
| 394 | 3300026088 | Ga0207641_10053618 | Ga0207641_100536183 | 341 |
| 395 | 3300026089 | Ga0207648_10027066 | Ga0207648_100270664 | 341 |
| 396 | 3300026089 | Ga0207648_10297556 | Ga0207648_102975562 | 341 |
| 397 | 3300026095 | Ga0207676_10000597 | Ga0207676_1000059715 | 341 |
| 398 | 3300027907 | Ga0207428_10022551 | Ga0207428_100225514 | 341 |
| 399 | 3300035120 | Ga0373957_0016697 | Ga0373957_0016697_1088_2119 | 341 |
| 400 | 3300035172 | Ga0373955_0048692 | Ga0373955_0048692_200_1231 | 341 |
| 401 | 3300035242 | Ga0373962_0012884 | Ga0373962_0012884_105_1133 | 341 |
| 402 | 3300036401 | Ga0373937_0026531 | Ga0373937_0026531_2492_3523 | 341 |
| 403 | 3300036401 | Ga0373937_0080256 | Ga0373937_0080256_842_1870 | 341 |
| 404 | 3300042156 | Ga0439446_0001344 | Ga0439446_0001344_1547_2578 | 341 |
| 405 | 3300042435 | Ga0439434_0008285 | Ga0439434_0008285_1374_2405 | 341 |
| 406 | 3300046454 | Ga0495592_0012152 | Ga0495592_0012152_3597_4628 | 341 |
| 407 | 3300046459 | Ga0495629_0048272 | Ga0495629_0048272_1792_2823 | 341 |
| 408 | 3300046459 | Ga0495629_0064427 | Ga0495629_0064427_1316_2347 | 341 |
| 409 | 3300046463 | Ga0495653_0123680 | Ga0495653_0123680_540_1571 | 341 |
| 410 | 3300046511 | Ga0495608_0038100 | Ga0495608_0038100_180_1211 | 341 |
| 411 | 3300046514 | Ga0495618_0028265 | Ga0495618_0028265_1730_2761 | 341 |
| 412 | 3300046517 | Ga0495630_0293842 | Ga0495630_0293842_163_1194 | 341 |
| 413 | 3300046533 | Ga0495640_0145776 | Ga0495640_0145776_370_1401 | 341 |
| 414 | 3300046535 | Ga0495586_0074284 | Ga0495586_0074284_490_1521 | 341 |
| 415 | 3300046559 | Ga0495667_0006730 | Ga0495667_0006730_1938_2969 | 341 |
| 416 | 3300046675 | Ga0495657_0011406 | Ga0495657_0011406_1907_2938 | 341 |
| 417 | 3300046681 | Ga0495647_0018577 | Ga0495647_0018577_734_1762 | 341 |
| 418 | 3300046681 | Ga0495647_0048193 | Ga0495647_0048193_550_1575 | 341 |
| 419 | 3300046683 | Ga0495658_0020183 | Ga0495658_0020183_1789_2820 | 341 |
| 420 | 3300046683 | Ga0495658_0042361 | Ga0495658_0042361_881_1909 | 341 |
| 421 | 3300046689 | Ga0495613_0155324 | Ga0495613_0155324_543_1574 | 341 |
| 422 | 3300047319 | Ga0495674_0013025 | Ga0495674_0013025_3040_4071 | 341 |
| 423 | 3300047471 | Ga0495684_0128657 | Ga0495684_0128657_547_1578 | 341 |
| 424 | 3300048904 | Ga0496101_0008114 | Ga0496101_0008114_3492_4517 | 341 |
| 425 | 3300048905 | Ga0496102_0269264 | Ga0496102_0269264_527_1555 | 341 |
| 426 | 3300048907 | Ga0496104_0103189 | Ga0496104_0103189_1083_2114 | 341 |
| 427 | 3300048909 | Ga0496106_0061878 | Ga0496106_0061878_1175_2200 | 341 |
| 428 | 3300048910 | Ga0496107_0023872 | Ga0496107_0023872_2148_3173 | 341 |
| 429 | 3300048912 | Ga0496109_0070364 | Ga0496109_0070364_696_1724 | 341 |
| 430 | 3300048912 | Ga0496109_0292021 | Ga0496109_0292021_453_1481 | 341 |
| 431 | 3300048917 | Ga0496114_0015720 | Ga0496114_0015720_2477_3502 | 341 |
| 432 | 3300048917 | Ga0496114_0043177 | Ga0496114_0043177_2327_3355 | 341 |
| 433 | 3300050507 | nmdc:mga05p37_4536_c1 | nmdc:mga05p37_4536_c1_1003_2031 | 341 |
| 434 | 3300050508 | nmdc:mga09592_20467_c1 | nmdc:mga09592_20467_c1_736_1773 | 341 |
| 435 | 3300050509 | nmdc:mga0qj67_1124_c1 | nmdc:mga0qj67_1124_c1_6474_7511 | 341 |
| 436 | 3300050510 | nmdc:mga06r32_26504_c1 | nmdc:mga06r32_26504_c1_585_1622 | 341 |
| 437 | 3300050511 | nmdc:mga08y16_18874_c1 | nmdc:mga08y16_18874_c1_3725_4753 | 341 |
| 438 | 3300050511 | nmdc:mga08y16_8367_c1 | nmdc:mga08y16_8367_c1_5341_6369 | 341 |
| 439 | 3300050512 | nmdc:mga0n895_12795_c1 | nmdc:mga0n895_12795_c1_1047_2078 | 341 |
| 440 | 3300050512 | nmdc:mga0n895_62939_c1 | nmdc:mga0n895_62939_c1_672_1697 | 341 |
| 441 | 3300050513 | nmdc:mga0rr50_20239_c1 | nmdc:mga0rr50_20239_c1_522_1547 | 341 |
| 442 | 3300050514 | nmdc:mga08x19_123564_c1 | nmdc:mga08x19_123564_c1_594_1625 | 341 |
| 443 | 3300050515 | nmdc:mga0a205_137170_c1 | nmdc:mga0a205_137170_c1_480_1511 | 341 |
| 444 | 3300053077 | Ga0495601_0030691 | Ga0495601_0030691_1080_2108 | 341 |
| 445 | 3300053077 | Ga0495601_0193033 | Ga0495601_0193033_88_1116 | 341 |
| 446 | 3300005329 | Ga0070683_100052357 | Ga0070683_1000523573 | 342 |
| 447 | 3300005471 | Ga0070698_100392952 | Ga0070698_1003929522 | 342 |
| 448 | 3300005937 | Ga0081455_10099872 | Ga0081455_100998722 | 342 |
| 449 | 3300006237 | Ga0097621_100001657 | Ga0097621_10000165713 | 342 |
| 450 | 3300006237 | Ga0097621_100122510 | Ga0097621_1001225102 | 342 |
| 451 | 3300006358 | Ga0068871_100001734 | Ga0068871_10000173415 | 342 |
| 452 | 3300013297 | Ga0157378_10007412 | Ga0157378_100074129 | 342 |
| 453 | 3300014969 | Ga0157376_10067576 | Ga0157376_100675762 | 342 |
| 454 | 3300028800 | Ga0265338_10003779 | Ga0265338_100037792 | 342 |
| 455 | 3300031238 | Ga0265332_10023877 | Ga0265332_100238773 | 342 |
| 456 | 3300031239 | Ga0265328_10045676 | Ga0265328_100456762 | 342 |
| 457 | 3300031249 | Ga0265339_10000204 | Ga0265339_1000020417 | 342 |
| 458 | 3300031250 | Ga0265331_10081078 | Ga0265331_100810782 | 342 |
| 459 | 3300031344 | Ga0265316_10048099 | Ga0265316_100480993 | 342 |
| 460 | 3300031665 | Ga0316575_10052205 | Ga0316575_100522051 | 342 |
| 461 | 3300031711 | Ga0265314_10002635 | Ga0265314_1000263516 | 342 |
| 462 | 3300031712 | Ga0265342_10019600 | Ga0265342_100196003 | 342 |
| 463 | 3300031727 | Ga0316576_10005853 | Ga0316576_100058532 | 342 |
| 464 | 3300032137 | Ga0316585_10002014 | Ga0316585_100020142 | 342 |
| 465 | 3300035692 | Ga0373935_0159388 | Ga0373935_0159388_105_1145 | 342 |
| 466 | 3300035725 | Ga0373947_0190887 | Ga0373947_0190887_35_1075 | 342 |
| 467 | 3300036401 | Ga0373937_0013603 | Ga0373937_0013603_276_1316 | 342 |
| 468 | 3300036647 | Ga0316582_0037884 | Ga0316582_0037884_1747_2805 | 342 |
| 469 | 3300036712 | Ga0316584_0070788 | Ga0316584_0070788_1050_2108 | 342 |
| 470 | 3300037068 | Ga0373925_0028280 | Ga0373925_0028280_817_1857 | 342 |
| 471 | 3300049741 | Ga0501079_0150413 | Ga0501079_0150413_67_1098 | 342 |
| 472 | 3300049743 | Ga0501081_0133817 | Ga0501081_0133817_610_1644 | 342 |
| 473 | 3300005334 | Ga0068869_100155207 | Ga0068869_1001552072 | 343 |
| 474 | 3300005364 | Ga0070673_100000212 | Ga0070673_10000021212 | 343 |
| 475 | 3300005406 | Ga0070703_10000740 | Ga0070703_100007408 | 343 |
| 476 | 3300005467 | Ga0070706_100000820 | Ga0070706_1000008208 | 343 |
| 477 | 3300005471 | Ga0070698_100000063 | Ga0070698_10000006324 | 343 |
| 478 | 3300005471 | Ga0070698_100074006 | Ga0070698_1000740062 | 343 |
| 479 | 3300005536 | Ga0070697_100044328 | Ga0070697_1000443281 | 343 |
| 480 | 3300025885 | Ga0207653_10000296 | Ga0207653_1000029625 | 343 |
| 481 | 3300025910 | Ga0207684_10004650 | Ga0207684_100046508 | 343 |
| 482 | 3300025960 | Ga0207651_10000458 | Ga0207651_100004585 | 343 |
| 483 | 3300005440 | Ga0070705_100000238 | Ga0070705_10000023825 | 344 |
| 484 | 3300005468 | Ga0070707_100000107 | Ga0070707_10000010762 | 344 |
| 485 | 3300005842 | Ga0068858_100010536 | Ga0068858_1000105364 | 344 |
| 486 | 3300005843 | Ga0068860_100074397 | Ga0068860_1000743973 | 344 |
| 487 | 3300006844 | Ga0075428_100259575 | Ga0075428_1002595752 | 344 |
| 488 | 3300006852 | Ga0075433_10141572 | Ga0075433_101415722 | 344 |
| 489 | 3300006931 | Ga0097620_100105786 | Ga0097620_1001057864 | 344 |
| 490 | 3300009147 | Ga0114129_10014362 | Ga0114129_100143625 | 344 |
| 491 | 3300009177 | Ga0105248_10007643 | Ga0105248_100076432 | 344 |
| 492 | 3300014968 | Ga0157379_10014375 | Ga0157379_100143753 | 344 |
| 493 | 3300025922 | Ga0207646_10000543 | Ga0207646_1000054320 | 344 |
| 494 | 3300025941 | Ga0207711_10183840 | Ga0207711_101838402 | 344 |
| 495 | 3300026035 | Ga0207703_10013597 | Ga0207703_100135972 | 344 |
| 496 | 3300028381 | Ga0268264_10033695 | Ga0268264_100336953 | 344 |
| 497 | 3300042876 | Ga0451577_0002197 | Ga0451577_0002197_21978_23030 | 344 |
| 498 | 3300044712 | Ga0453684_0000809 | Ga0453684_0000809_99487_100539 | 344 |
| 499 | 3300050507 | nmdc:mga05p37_35468_c1 | nmdc:mga05p37_35468_c1_1194_2261 | 344 |
| 500 | 3300050515 | nmdc:mga0a205_37588_c1 | nmdc:mga0a205_37588_c1_2947_3984 | 344 |
| 501 | 3300060353 | Ga0501082_0234020 | Ga0501082_0234020_97_1155 | 344 |
| 502 | 3300005327 | Ga0070658_10013778 | Ga0070658_100137784 | 345 |
| 503 | 3300006844 | Ga0075428_100089480 | Ga0075428_1000894802 | 345 |
| 504 | 3300009147 | Ga0114129_10021276 | Ga0114129_100212764 | 345 |
| 505 | 3300009148 | Ga0105243_10149516 | Ga0105243_101495162 | 345 |
| 506 | 3300025912 | Ga0207707_10147929 | Ga0207707_101479292 | 345 |
| 507 | 3300032133 | Ga0316583_10000278 | Ga0316583_100002786 | 345 |
| 508 | 3300046683 | Ga0495658_0090000 | Ga0495658_0090000_629_1711 | 345 |
| 509 | 3300050507 | nmdc:mga05p37_26723_c1 | nmdc:mga05p37_26723_c1_3976_5046 | 345 |
| 510 | 3300005329 | Ga0070683_100160702 | Ga0070683_1001607022 | 346 |
| 511 | 3300005344 | Ga0070661_100003076 | Ga0070661_1000030769 | 346 |
| 512 | 3300005539 | Ga0068853_100005020 | Ga0068853_1000050209 | 346 |
| 513 | 3300005563 | Ga0068855_100009510 | Ga0068855_1000095102 | 346 |
| 514 | 3300005614 | Ga0068856_100018092 | Ga0068856_1000180923 | 346 |
| 515 | 3300005616 | Ga0068852_100002149 | Ga0068852_10000214910 | 346 |
| 516 | 3300009093 | Ga0105240_10058841 | Ga0105240_100588414 | 346 |
| 517 | 3300009174 | Ga0105241_10003115 | Ga0105241_1000311510 | 346 |
| 518 | 3300009545 | Ga0105237_10009782 | Ga0105237_100097829 | 346 |
| 519 | 3300009551 | Ga0105238_10006697 | Ga0105238_100066973 | 346 |
| 520 | 3300010375 | Ga0105239_10013868 | Ga0105239_100138681 | 346 |
| 521 | 3300010375 | Ga0105239_10212518 | Ga0105239_102125182 | 346 |
| 522 | 3300013105 | Ga0157369_10163394 | Ga0157369_101633942 | 346 |
| 523 | 3300013105 | Ga0157369_10253723 | Ga0157369_102537232 | 346 |
| 524 | 3300025913 | Ga0207695_10001120 | Ga0207695_1000112034 | 346 |
| 525 | 3300025914 | Ga0207671_10005934 | Ga0207671_100059343 | 346 |
| 526 | 3300025920 | Ga0207649_10002341 | Ga0207649_100023413 | 346 |
| 527 | 3300025924 | Ga0207694_10000313 | Ga0207694_1000031334 | 346 |
| 528 | 3300025944 | Ga0207661_10129696 | Ga0207661_101296962 | 346 |
| 529 | 3300026041 | Ga0207639_10000055 | Ga0207639_100000553 | 346 |
| 530 | 3300026078 | Ga0207702_10002856 | Ga0207702_100028562 | 346 |
| 531 | 3300005530 | Ga0070679_100364344 | Ga0070679_1003643442 | 347 |
| 532 | 3300005546 | Ga0070696_100000011 | Ga0070696_10000001131 | 347 |
| 533 | 3300005563 | Ga0068855_100155676 | Ga0068855_1001556764 | 347 |
| 534 | 3300013105 | Ga0157369_10134210 | Ga0157369_101342102 | 347 |
| 535 | 3300025917 | Ga0207660_10086904 | Ga0207660_100869043 | 347 |
| 536 | 3300037466 | Ga0395898_0083408 | Ga0395898_0083408_1957_3009 | 347 |
| 537 | 3300045049 | Ga0466959_0055610 | Ga0466959_0055610_1471_2580 | 347 |
| 538 | 3300045976 | Ga0466967_0108084 | Ga0466967_0108084_1401_2510 | 347 |
| 539 | 3300048918 | Ga0496115_0116364 | Ga0496115_0116364_69_1157 | 347 |
| 540 | 3300005329 | Ga0070683_100000210 | Ga0070683_10000021014 | 348 |
| 541 | 3300005329 | Ga0070683_100008686 | Ga0070683_1000086863 | 348 |
| 542 | 3300005331 | Ga0070670_100002071 | Ga0070670_10000207113 | 348 |
| 543 | 3300005334 | Ga0068869_100000308 | Ga0068869_10000030819 | 348 |
| 544 | 3300005338 | Ga0068868_100000046 | Ga0068868_10000004622 | 348 |
| 545 | 3300005338 | Ga0068868_100004012 | Ga0068868_1000040124 | 348 |
| 546 | 3300005338 | Ga0068868_100026074 | Ga0068868_1000260742 | 348 |
| 547 | 3300005339 | Ga0070660_100017822 | Ga0070660_1000178223 | 348 |
| 548 | 3300005355 | Ga0070671_100006477 | Ga0070671_10000647710 | 348 |
| 549 | 3300005355 | Ga0070671_100093079 | Ga0070671_1000930793 | 348 |
| 550 | 3300005367 | Ga0070667_100000728 | Ga0070667_10000072810 | 348 |
| 551 | 3300005367 | Ga0070667_100157327 | Ga0070667_1001573272 | 348 |
| 552 | 3300005457 | Ga0070662_100231624 | Ga0070662_1002316242 | 348 |
| 553 | 3300005458 | Ga0070681_10001472 | Ga0070681_1000147222 | 348 |
| 554 | 3300005530 | Ga0070679_100027214 | Ga0070679_1000272145 | 348 |
| 555 | 3300005535 | Ga0070684_100001658 | Ga0070684_10000165816 | 348 |
| 556 | 3300005535 | Ga0070684_100003273 | Ga0070684_1000032732 | 348 |
| 557 | 3300005548 | Ga0070665_100205549 | Ga0070665_1002055492 | 348 |
| 558 | 3300005563 | Ga0068855_100025821 | Ga0068855_1000258214 | 348 |
| 559 | 3300005563 | Ga0068855_100218230 | Ga0068855_1002182302 | 348 |
| 560 | 3300005564 | Ga0070664_100093085 | Ga0070664_1000930852 | 348 |
| 561 | 3300005577 | Ga0068857_100000448 | Ga0068857_10000044818 | 348 |
| 562 | 3300005577 | Ga0068857_100032648 | Ga0068857_1000326485 | 348 |
| 563 | 3300005614 | Ga0068856_100010522 | Ga0068856_1000105226 | 348 |
| 564 | 3300005614 | Ga0068856_100028116 | Ga0068856_1000281165 | 348 |
| 565 | 3300005616 | Ga0068852_100011908 | Ga0068852_1000119084 | 348 |
| 566 | 3300005616 | Ga0068852_100044710 | Ga0068852_1000447102 | 348 |
| 567 | 3300005616 | Ga0068852_100097860 | Ga0068852_1000978603 | 348 |
| 568 | 3300005617 | Ga0068859_100013491 | Ga0068859_1000134918 | 348 |
| 569 | 3300005834 | Ga0068851_10008480 | Ga0068851_100084804 | 348 |
| 570 | 3300005834 | Ga0068851_10056819 | Ga0068851_100568192 | 348 |
| 571 | 3300005834 | Ga0068851_10074448 | Ga0068851_100744481 | 348 |
| 572 | 3300005841 | Ga0068863_100022882 | Ga0068863_1000228823 | 348 |
| 573 | 3300005843 | Ga0068860_100001032 | Ga0068860_10000103222 | 348 |
| 574 | 3300005843 | Ga0068860_100179456 | Ga0068860_1001794562 | 348 |
| 575 | 3300006028 | Ga0070717_10007402 | Ga0070717_100074026 | 348 |
| 576 | 3300006237 | Ga0097621_100006730 | Ga0097621_1000067305 | 348 |
| 577 | 3300006237 | Ga0097621_100277190 | Ga0097621_1002771902 | 348 |
| 578 | 3300006358 | Ga0068871_100005075 | Ga0068871_1000050754 | 348 |
| 579 | 3300006931 | Ga0097620_100013490 | Ga0097620_1000134908 | 348 |
| 580 | 3300009093 | Ga0105240_10000663 | Ga0105240_1000066312 | 348 |
| 581 | 3300009093 | Ga0105240_10019935 | Ga0105240_100199356 | 348 |
| 582 | 3300009093 | Ga0105240_10102912 | Ga0105240_101029121 | 348 |
| 583 | 3300009098 | Ga0105245_10002815 | Ga0105245_1000281510 | 348 |
| 584 | 3300009098 | Ga0105245_10037780 | Ga0105245_100377804 | 348 |
| 585 | 3300009098 | Ga0105245_10058454 | Ga0105245_100584543 | 348 |
| 586 | 3300009101 | Ga0105247_10004217 | Ga0105247_100042173 | 348 |
| 587 | 3300009174 | Ga0105241_10005170 | Ga0105241_100051708 | 348 |
| 588 | 3300009174 | Ga0105241_10014948 | Ga0105241_100149485 | 348 |
| 589 | 3300009174 | Ga0105241_10068995 | Ga0105241_100689952 | 348 |
| 590 | 3300009177 | Ga0105248_10010289 | Ga0105248_1001028912 | 348 |
| 591 | 3300009545 | Ga0105237_10007213 | Ga0105237_100072139 | 348 |
| 592 | 3300009551 | Ga0105238_10000657 | Ga0105238_1000065713 | 348 |
| 593 | 3300009551 | Ga0105238_10009153 | Ga0105238_100091532 | 348 |
| 594 | 3300009553 | Ga0105249_10025755 | Ga0105249_100257552 | 348 |
| 595 | 3300010375 | Ga0105239_10010212 | Ga0105239_1001021210 | 348 |
| 596 | 3300013105 | Ga0157369_10031690 | Ga0157369_100316905 | 348 |
| 597 | 3300013105 | Ga0157369_10128190 | Ga0157369_101281902 | 348 |
| 598 | 3300013296 | Ga0157374_10005560 | Ga0157374_100055605 | 348 |
| 599 | 3300013296 | Ga0157374_10036420 | Ga0157374_100364202 | 348 |
| 600 | 3300013296 | Ga0157374_10243686 | Ga0157374_102436862 | 348 |
| 601 | 3300013297 | Ga0157378_10013370 | Ga0157378_100133705 | 348 |
| 602 | 3300013297 | Ga0157378_10014829 | Ga0157378_100148293 | 348 |
| 603 | 3300013297 | Ga0157378_10114680 | Ga0157378_101146802 | 348 |
| 604 | 3300013306 | Ga0163162_10276676 | Ga0163162_102766762 | 348 |
| 605 | 3300013307 | Ga0157372_10021218 | Ga0157372_100212185 | 348 |
| 606 | 3300013307 | Ga0157372_10044476 | Ga0157372_100444766 | 348 |
| 607 | 3300013307 | Ga0157372_10059882 | Ga0157372_100598823 | 348 |
| 608 | 3300014325 | Ga0163163_10009625 | Ga0163163_100096252 | 348 |
| 609 | 3300014968 | Ga0157379_10005193 | Ga0157379_100051934 | 348 |
| 610 | 3300014968 | Ga0157379_10055488 | Ga0157379_100554882 | 348 |
| 611 | 3300014969 | Ga0157376_10000173 | Ga0157376_1000017330 | 348 |
| 612 | 3300021361 | Ga0213872_10016026 | Ga0213872_100160262 | 348 |
| 613 | 3300021361 | Ga0213872_10062464 | Ga0213872_100624642 | 348 |
| 614 | 3300025321 | Ga0207656_10040382 | Ga0207656_100403821 | 348 |
| 615 | 3300025321 | Ga0207656_10107340 | Ga0207656_101073401 | 348 |
| 616 | 3300025911 | Ga0207654_10000302 | Ga0207654_100003023 | 348 |
| 617 | 3300025911 | Ga0207654_10034343 | Ga0207654_100343433 | 348 |
| 618 | 3300025912 | Ga0207707_10022700 | Ga0207707_100227004 | 348 |
| 619 | 3300025913 | Ga0207695_10000108 | Ga0207695_1000010886 | 348 |
| 620 | 3300025913 | Ga0207695_10000253 | Ga0207695_1000025337 | 348 |
| 621 | 3300025913 | Ga0207695_10002288 | Ga0207695_1000228812 | 348 |
| 622 | 3300025913 | Ga0207695_10013281 | Ga0207695_100132814 | 348 |
| 623 | 3300025914 | Ga0207671_10000081 | Ga0207671_1000008176 | 348 |
| 624 | 3300025914 | Ga0207671_10228029 | Ga0207671_102280292 | 348 |
| 625 | 3300025919 | Ga0207657_10004178 | Ga0207657_100041786 | 348 |
| 626 | 3300025920 | Ga0207649_10095043 | Ga0207649_100950431 | 348 |
| 627 | 3300025921 | Ga0207652_10114604 | Ga0207652_101146041 | 348 |
| 628 | 3300025924 | Ga0207694_10000108 | Ga0207694_1000010841 | 348 |
| 629 | 3300025924 | Ga0207694_10003511 | Ga0207694_100035116 | 348 |
| 630 | 3300025924 | Ga0207694_10006127 | Ga0207694_100061278 | 348 |
| 631 | 3300025925 | Ga0207650_10001335 | Ga0207650_1000133514 | 348 |
| 632 | 3300025927 | Ga0207687_10137295 | Ga0207687_101372951 | 348 |
| 633 | 3300025928 | Ga0207700_10159209 | Ga0207700_101592092 | 348 |
| 634 | 3300025931 | Ga0207644_10002796 | Ga0207644_100027969 | 348 |
| 635 | 3300025933 | Ga0207706_10031305 | Ga0207706_100313051 | 348 |
| 636 | 3300025941 | Ga0207711_10004803 | Ga0207711_100048034 | 348 |
| 637 | 3300025944 | Ga0207661_10002024 | Ga0207661_1000202414 | 348 |
| 638 | 3300025944 | Ga0207661_10005751 | Ga0207661_100057513 | 348 |
| 639 | 3300025945 | Ga0207679_10063021 | Ga0207679_100630212 | 348 |
| 640 | 3300025949 | Ga0207667_10000934 | Ga0207667_1000093411 | 348 |
| 641 | 3300025986 | Ga0207658_10000416 | Ga0207658_1000041621 | 348 |
| 642 | 3300026023 | Ga0207677_10000025 | Ga0207677_1000002541 | 348 |
| 643 | 3300026023 | Ga0207677_10019800 | Ga0207677_100198002 | 348 |
| 644 | 3300026035 | Ga0207703_10054904 | Ga0207703_100549043 | 348 |
| 645 | 3300026041 | Ga0207639_10004182 | Ga0207639_100041827 | 348 |
| 646 | 3300026078 | Ga0207702_10177152 | Ga0207702_101771521 | 348 |
| 647 | 3300026078 | Ga0207702_10321670 | Ga0207702_103216702 | 348 |
| 648 | 3300026088 | Ga0207641_10010405 | Ga0207641_1001040510 | 348 |
| 649 | 3300026095 | Ga0207676_10002620 | Ga0207676_100026205 | 348 |
| 650 | 3300026116 | Ga0207674_10001459 | Ga0207674_1000145923 | 348 |
| 651 | 3300026116 | Ga0207674_10064007 | Ga0207674_100640073 | 348 |
| 652 | 3300026121 | Ga0207683_10003208 | Ga0207683_100032082 | 348 |
| 653 | 3300026142 | Ga0207698_10029371 | Ga0207698_100293714 | 348 |
| 654 | 3300026142 | Ga0207698_10071935 | Ga0207698_100719351 | 348 |
| 655 | 3300028381 | Ga0268264_10000920 | Ga0268264_100009204 | 348 |
| 656 | 3300028666 | Ga0265336_10002136 | Ga0265336_100021363 | 348 |
| 657 | 3300028800 | Ga0265338_10004819 | Ga0265338_1000481919 | 348 |
| 658 | 3300028800 | Ga0265338_10012773 | Ga0265338_100127734 | 348 |
| 659 | 3300031235 | Ga0265330_10000852 | Ga0265330_1000085217 | 348 |
| 660 | 3300031235 | Ga0265330_10010994 | Ga0265330_100109943 | 348 |
| 661 | 3300031238 | Ga0265332_10036136 | Ga0265332_100361364 | 348 |
| 662 | 3300031240 | Ga0265320_10018906 | Ga0265320_100189063 | 348 |
| 663 | 3300031240 | Ga0265320_10037191 | Ga0265320_100371912 | 348 |
| 664 | 3300031241 | Ga0265325_10002033 | Ga0265325_100020339 | 348 |
| 665 | 3300031241 | Ga0265325_10010585 | Ga0265325_100105855 | 348 |
| 666 | 3300031241 | Ga0265325_10067769 | Ga0265325_100677692 | 348 |
| 667 | 3300031249 | Ga0265339_10000029 | Ga0265339_10000029118 | 348 |
| 668 | 3300031249 | Ga0265339_10004335 | Ga0265339_100043359 | 348 |
| 669 | 3300031249 | Ga0265339_10007186 | Ga0265339_1000718610 | 348 |
| 670 | 3300031344 | Ga0265316_10002998 | Ga0265316_1000299813 | 348 |
| 671 | 3300031344 | Ga0265316_10010127 | Ga0265316_100101279 | 348 |
| 672 | 3300031344 | Ga0265316_10072395 | Ga0265316_100723952 | 348 |
| 673 | 3300031595 | Ga0265313_10001614 | Ga0265313_1000161414 | 348 |
| 674 | 3300031595 | Ga0265313_10082546 | Ga0265313_100825462 | 348 |
| 675 | 3300031711 | Ga0265314_10000139 | Ga0265314_1000013969 | 348 |
| 676 | 3300031711 | Ga0265314_10038367 | Ga0265314_100383673 | 348 |
| 677 | 3300031711 | Ga0265314_10201278 | Ga0265314_102012781 | 348 |
| 678 | 3300031712 | Ga0265342_10001268 | Ga0265342_100012685 | 348 |
| 679 | 3300031712 | Ga0265342_10001906 | Ga0265342_100019068 | 348 |
| 680 | 3300031712 | Ga0265342_10002378 | Ga0265342_1000237814 | 348 |
| 681 | 3300031712 | Ga0265342_10009601 | Ga0265342_100096013 | 348 |
| 682 | 3300036401 | Ga0373937_0091727 | Ga0373937_0091727_289_1338 | 348 |
| 683 | 3300039438 | Ga0436360_1224841 | Ga0436360_1224841_459_1547 | 348 |
| 684 | 3300039447 | Ga0436361_0224417 | Ga0436361_0224417_4673_5740 | 348 |
| 685 | 3300039447 | Ga0436361_1193508 | Ga0436361_1193508_567_1634 | 348 |
| 686 | 3300044693 | Ga0466961_0146027 | Ga0466961_0146027_61_1269 | 348 |
| 687 | 3300045836 | Ga0466958_0158302 | Ga0466958_0158302_46_1242 | 348 |
| 688 | 3300046529 | Ga0495652_0021671 | Ga0495652_0021671_446_1495 | 348 |
| 689 | 3300046536 | Ga0495587_0004453 | Ga0495587_0004453_764_1813 | 348 |
| 690 | 3300046543 | Ga0495645_0001171 | Ga0495645_0001171_13271_14320 | 348 |
| 691 | 3300046678 | Ga0495599_0108896 | Ga0495599_0108896_275_1324 | 348 |
| 692 | 3300046689 | Ga0495613_0015595 | Ga0495613_0015595_1681_2730 | 348 |
| 693 | 3300046809 | Ga0495600_0015924 | Ga0495600_0015924_2698_3747 | 348 |
| 694 | 3300047319 | Ga0495674_0294039 | Ga0495674_0294039_37_1086 | 348 |
| 695 | 3300048088 | Ga0495602_0078220 | Ga0495602_0078220_1388_2437 | 348 |
| 696 | 3300053077 | Ga0495601_0009859 | Ga0495601_0009859_4211_5260 | 348 |
| 697 | 3300000546 | LJNas_1000170 | LJNas_100017011 | 349 |
| 698 | 3300005439 | Ga0070711_100074236 | Ga0070711_1000742362 | 349 |
| 699 | 3300005548 | Ga0070665_100101186 | Ga0070665_1001011862 | 349 |
| 700 | 3300013105 | Ga0157369_10251569 | Ga0157369_102515693 | 349 |
| 701 | 3300044694 | Ga0466963_0011541 | Ga0466963_0011541_4008_5057 | 349 |
| 702 | 3300046660 | Ga0495625_0111003 | Ga0495625_0111003_388_1509 | 349 |
| 703 | 3300046684 | Ga0495669_0051264 | Ga0495669_0051264_30_1079 | 349 |
| 704 | 3300048904 | Ga0496101_0187028 | Ga0496101_0187028_196_1245 | 349 |
| 705 | 3300048907 | Ga0496104_0133652 | Ga0496104_0133652_390_1511 | 349 |
| 706 | 3300048912 | Ga0496109_0138565 | Ga0496109_0138565_529_1650 | 349 |
| 707 | 3300048913 | Ga0496110_0340171 | Ga0496110_0340171_117_1238 | 349 |
| 708 | 3300048918 | Ga0496115_0136729 | Ga0496115_0136729_651_1772 | 349 |
| 709 | 3300048929 | Ga0496126_0003640 | Ga0496126_0003640_7984_9033 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z01-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus | 0.9578 | 23 | 349 |
| 2z01-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus | 0.9549 | 23 | 349 |
| 5vk4-assembly1.cif.gz_A | crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium | 0.9391 | 20 | 348 |
| 1cli-assembly2.cif.gz_C | x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution | 0.9384 | 7 | 349 |
| 2btu-assembly1.cif.gz_A | crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. | 0.9361 | 21 | 348 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z01A01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9445 | 23 | 173 | 3.30.1330.10 |
| af_P00967_819_956_3.30.1330.10 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.94 | 35 | 172 | 3.30.1330.10 |
| 2z01A01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.938 | 23 | 173 | 3.30.1330.10 |
| af_P07244_618_801_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9359 | 174 | 348 | 3.90.650.10 |
| af_G3V918_434_598_3.30.1330.10 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9337 | 9 | 170 | 3.30.1330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7XHW2-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.973 | 167 | 348 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A7X9BES8-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) | 0.9713 | 89 | 348 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A355A2Y2-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) | 0.9702 | 9 | 348 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
| AF-A0A2V9BNB1-F1-model_v4 | Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) | 0.97 | 9 | 349 |
GO:0004252
GO:0004637 GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0006465 GO:0016020 GO:0046084 |
| AF-A0A7V9UJX9-F1-model_v4 | phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) | 0.9644 | 181 | 348 |
GO:0004637
GO:0004641 GO:0005524 GO:0005829 GO:0006189 GO:0046084 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar