F476636

General Info

Members Datasets Scaffolds Average Seq Length
709 287 709 346

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100076417|Ga0070680_1000764173
Length 330
Sequence VPEGNTSEPFTYAHAGVDIATADRAKERIKFLAQKTFNRNVLGGIGGFGALFRLDLQRWKNPILVSSADGVGTKLKVAFALGLHHTVGADLVNHCVNDIAVQGATPLFFLDYFASGKLDPEVTESVISGLADACRANGCALIGGETAQMPGFYADGEYDLAGFIVGAVDRDKMITGAAIKPGDVLIGLPSTGLHTNGYSLARKLLFEVAGYKPTQYVTAIREKAGAALLKTHRSYLHVIQKLTAGGLTTGMAHAQVEIGSWPVLPIFEHLRDLGHISQDEMMRTFNMGIGLIAAIPAAKFTRAKNLLDRAEEKFYVVGRTVKGERRVQYT

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.23
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000170 3300000546 Bacteria 10703
2 Ga0065712_10006833 3300005290 Bacteria 4704
3 Ga0065712_10122814 3300005290 Bacteria 1636
4 Ga0065715_10119435 3300005293 Bacteria 2274
5 Ga0065707_10084507 3300005295 Bacteria 7130
6 Ga0070658_10013778 3300005327 Bacteria 6489
7 Ga0070683_100000210 3300005329 Bacteria 39660
8 Ga0070683_100000219 3300005329 Bacteria 39225
9 Ga0070683_100008686 3300005329 Bacteria 8637
10 Ga0070683_100052357 3300005329 Bacteria 3781
11 Ga0070683_100160702 3300005329 Bacteria 2131
12 Ga0070670_100002071 3300005331 Bacteria 16420
13 Ga0070670_100005558 3300005331 Bacteria 10636
14 Ga0070670_100021126 3300005331 Bacteria 5599
15 Ga0070670_100047338 3300005331 Bacteria 3700
16 Ga0070670_100120931 3300005331 Bacteria 2259
17 Ga0068869_100000308 3300005334 Bacteria 26106
18 Ga0068869_100012602 3300005334 Bacteria 5592
19 Ga0068869_100155207 3300005334 Bacteria 1778
20 Ga0070666_10007292 3300005335 Bacteria 6812
21 Ga0070666_10078652 3300005335 Bacteria 2251
22 Ga0070666_10150146 3300005335 Bacteria 1626
23 Ga0070680_100076417 3300005336 Bacteria 2757
24 Ga0068868_100000046 3300005338 Bacteria 68441
25 Ga0068868_100000672 3300005338 Bacteria 22916
26 Ga0068868_100004012 3300005338 Bacteria 10279
27 Ga0068868_100020771 3300005338 Bacteria 4940
28 Ga0068868_100026074 3300005338 Bacteria 4451
29 Ga0068868_100138296 3300005338 Bacteria 1998
30 Ga0070660_100017822 3300005339 Bacteria 5180
31 Ga0070689_100017917 3300005340 Bacteria 5207
32 Ga0070661_100003076 3300005344 Bacteria 11480
33 Ga0070661_100008061 3300005344 Bacteria 7270
34 Ga0070661_100019594 3300005344 Bacteria 4822
35 Ga0070669_100040918 3300005353 Bacteria 3369
36 Ga0070669_100097632 3300005353 Bacteria 2212
37 Ga0070669_100220675 3300005353 Bacteria 1499
38 Ga0070675_100027795 3300005354 Bacteria 4548
39 Ga0070675_100041425 3300005354 Bacteria 3762
40 Ga0070675_100138379 3300005354 Bacteria 2079
41 Ga0070675_100157962 3300005354 Bacteria 1948
42 Ga0070675_100230880 3300005354 Bacteria 1614
43 Ga0070671_100006477 3300005355 Bacteria 9362
44 Ga0070671_100093079 3300005355 Bacteria 2526
45 Ga0070671_100301754 3300005355 Bacteria 1364
46 Ga0070674_100010619 3300005356 Bacteria 5576
47 Ga0070674_100075450 3300005356 Bacteria 2395
48 Ga0070674_100291949 3300005356 Bacteria 1296
49 Ga0070674_100361199 3300005356 Bacteria 1176
50 Ga0070673_100000212 3300005364 Bacteria 28926
51 Ga0070673_100008245 3300005364 Bacteria 6918
52 Ga0070673_100062093 3300005364 Bacteria 2967
53 Ga0070673_100066244 3300005364 Bacteria 2885
54 Ga0070673_100249254 3300005364 Bacteria 1547
55 Ga0070688_100086199 3300005365 Bacteria 2043
56 Ga0070659_100015437 3300005366 Bacteria 5721
57 Ga0070667_100000728 3300005367 Bacteria 31585
58 Ga0070667_100023077 3300005367 Bacteria 5161
59 Ga0070667_100157327 3300005367 Bacteria 1999
60 Ga0070703_10000740 3300005406 Bacteria 10913
61 Ga0070709_10098283 3300005434 Bacteria 1945
62 Ga0070713_100127070 3300005436 Bacteria 2244
63 Ga0070711_100074236 3300005439 Bacteria 2405
64 Ga0070705_100000238 3300005440 Bacteria 32601
65 Ga0070700_100319731 3300005441 Bacteria 1140
66 Ga0070663_100019435 3300005455 Bacteria 4478
67 Ga0070678_100102872 3300005456 Bacteria 2218
68 Ga0070678_100128053 3300005456 Bacteria 2013
69 Ga0070662_100231624 3300005457 Bacteria 1478
70 Ga0070681_10001472 3300005458 Bacteria 20780
71 Ga0070681_10023707 3300005458 Bacteria 6176
72 Ga0070681_10140535 3300005458 Bacteria 2345
73 Ga0070681_10398797 3300005458 Bacteria 1287
74 Ga0068867_100040795 3300005459 Bacteria 3390
75 Ga0070706_100000820 3300005467 Bacteria 34294
76 Ga0070707_100000107 3300005468 Bacteria 76101
77 Ga0070698_100000063 3300005471 Bacteria 78062
78 Ga0070698_100074006 3300005471 Bacteria 3412
79 Ga0070698_100131060 3300005471 Bacteria 2463
80 Ga0070698_100292779 3300005471 Bacteria 1559
81 Ga0070698_100392952 3300005471 Bacteria 1320
82 Ga0070699_100017361 3300005518 Bacteria 6179
83 Ga0070679_100027214 3300005530 Bacteria 5625
84 Ga0070679_100364344 3300005530 Bacteria 1393
85 Ga0070684_100001658 3300005535 Bacteria 16158
86 Ga0070684_100003273 3300005535 Bacteria 12129
87 Ga0070684_100004177 3300005535 Bacteria 10942
88 Ga0070697_100044328 3300005536 Bacteria 3602
89 Ga0068853_100005020 3300005539 Bacteria 10318
90 Ga0070672_100003190 3300005543 Bacteria 10614
91 Ga0070672_100003279 3300005543 Bacteria 10478
92 Ga0070686_100011648 3300005544 Bacteria 4995
93 Ga0070686_100088003 3300005544 Bacteria 2072
94 Ga0070696_100000011 3300005546 Bacteria 82210
95 Ga0070665_100011352 3300005548 Bacteria 9007
96 Ga0070665_100023727 3300005548 Bacteria 6178
97 Ga0070665_100101186 3300005548 Bacteria 2886
98 Ga0070665_100205549 3300005548 Bacteria 1970
99 Ga0068855_100009510 3300005563 Bacteria 11739
100 Ga0068855_100025821 3300005563 Bacteria 7025
101 Ga0068855_100155676 3300005563 Bacteria 2596
102 Ga0068855_100218230 3300005563 Bacteria 2140
103 Ga0068855_100243156 3300005563 Bacteria 2010
104 Ga0070664_100001996 3300005564 Bacteria 16362
105 Ga0070664_100005403 3300005564 Bacteria 10256
106 Ga0070664_100093085 3300005564 Bacteria 2611
107 Ga0068857_100000448 3300005577 Bacteria 29339
108 Ga0068857_100032648 3300005577 Bacteria 4603
109 Ga0068857_100084925 3300005577 Bacteria 2829
110 Ga0068856_100010522 3300005614 Bacteria 8982
111 Ga0068856_100018092 3300005614 Bacteria 6832
112 Ga0068856_100028116 3300005614 Bacteria 5489
113 Ga0068852_100002149 3300005616 Bacteria 13529
114 Ga0068852_100011908 3300005616 Bacteria 6577
115 Ga0068852_100044710 3300005616 Bacteria 3764
116 Ga0068852_100097860 3300005616 Bacteria 2640
117 Ga0068859_100013491 3300005617 Bacteria 8194
118 Ga0068859_100028738 3300005617 Bacteria 5574
119 Ga0068859_100033089 3300005617 Bacteria 5193
120 Ga0068859_100050677 3300005617 Bacteria 4170
121 Ga0068859_100079735 3300005617 Bacteria 3314
122 Ga0068859_100308187 3300005617 Bacteria 1677
123 Ga0068859_100399926 3300005617 Bacteria 1469
124 Ga0068864_100001251 3300005618 Bacteria 21104
125 Ga0068864_100006868 3300005618 Bacteria 9324
126 Ga0068864_100013647 3300005618 Bacteria 6735
127 Ga0068864_100095356 3300005618 Bacteria 2631
128 Ga0068866_10001191 3300005718 Bacteria 11349
129 Ga0068861_100258453 3300005719 Bacteria 1490
130 Ga0068851_10008480 3300005834 Bacteria 4753
131 Ga0068851_10056819 3300005834 Bacteria 1997
132 Ga0068851_10064677 3300005834 Bacteria 1880
133 Ga0068851_10074448 3300005834 Bacteria 1763
134 Ga0068870_10029783 3300005840 Bacteria 2753
135 Ga0068863_100022882 3300005841 Bacteria 5972
136 Ga0068863_100023057 3300005841 Bacteria 5948
137 Ga0068863_100049767 3300005841 Bacteria 3973
138 Ga0068863_100372639 3300005841 Bacteria 1393
139 Ga0068858_100009818 3300005842 Bacteria 9107
140 Ga0068858_100010536 3300005842 Bacteria 8755
141 Ga0068858_100034388 3300005842 Bacteria 4701
142 Ga0068858_100051993 3300005842 Bacteria 3791
143 Ga0068858_100135852 3300005842 Bacteria 2308
144 Ga0068858_100215491 3300005842 Bacteria 1818
145 Ga0068860_100001032 3300005843 Bacteria 30687
146 Ga0068860_100074397 3300005843 Bacteria 3230
147 Ga0068860_100179456 3300005843 Bacteria 2047
148 Ga0068860_100304871 3300005843 Bacteria 1561
149 Ga0068862_100008314 3300005844 Bacteria 8587
150 Ga0081455_10021838 3300005937 Bacteria 5995
151 Ga0081455_10099872 3300005937 Bacteria 2333
152 Ga0081540_1007130 3300005983 Bacteria 8019
153 Ga0081539_10024630 3300005985 Bacteria 3898
154 Ga0070717_10007402 3300006028 Bacteria 8151
155 Ga0070717_10046772 3300006028 Bacteria 3542
156 Ga0070716_100077051 3300006173 Bacteria 1978
157 Ga0097621_100001657 3300006237 Bacteria 15226
158 Ga0097621_100006730 3300006237 Bacteria 8166
159 Ga0097621_100007914 3300006237 Bacteria 7625
160 Ga0097621_100007951 3300006237 Bacteria 7609
161 Ga0097621_100013125 3300006237 Bacteria 6162
162 Ga0097621_100031616 3300006237 Bacteria 4202
163 Ga0097621_100122510 3300006237 Bacteria 2207
164 Ga0097621_100277190 3300006237 Bacteria 1475
165 Ga0068871_100000863 3300006358 Bacteria 20190
166 Ga0068871_100001734 3300006358 Bacteria 14693
167 Ga0068871_100005075 3300006358 Bacteria 9197
168 Ga0068871_100008275 3300006358 Bacteria 7476
169 Ga0068871_100043732 3300006358 Bacteria 3599
170 Ga0068871_100161676 3300006358 Bacteria 1916
171 Ga0068871_100166565 3300006358 Bacteria 1887
172 Ga0075428_100000364 3300006844 Bacteria 44975
173 Ga0075428_100070245 3300006844 Bacteria 3828
174 Ga0075428_100089480 3300006844 Bacteria 3358
175 Ga0075428_100259575 3300006844 Bacteria 1871
176 Ga0075430_100000555 3300006846 Bacteria 28350
177 Ga0075431_100020182 3300006847 Bacteria 6805
178 Ga0075431_100034207 3300006847 Bacteria 5236
179 Ga0075433_10031264 3300006852 Bacteria 4550
180 Ga0075433_10141572 3300006852 Bacteria 2137
181 Ga0075434_100003240 3300006871 Bacteria 14532
182 Ga0075434_100005959 3300006871 Bacteria 11157
183 Ga0075434_100014805 3300006871 Bacteria 7465
184 Ga0075434_100029208 3300006871 Bacteria 5422
185 Ga0075434_100048927 3300006871 Bacteria 4196
186 Ga0075434_100171329 3300006871 Bacteria 2191
187 Ga0075434_100258295 3300006871 Bacteria 1761
188 Ga0075429_100008602 3300006880 Bacteria 8878
189 Ga0075429_100033840 3300006880 Bacteria 4440
190 Ga0068865_100004795 3300006881 Bacteria 8179
191 Ga0068865_100078750 3300006881 Bacteria 2358
192 Ga0068865_100127798 3300006881 Bacteria 1900
193 Ga0075436_100000002 3300006914 Bacteria 475522
194 Ga0075436_100014436 3300006914 Bacteria 5410
195 Ga0075436_100038172 3300006914 Bacteria 3315
196 Ga0075436_100122792 3300006914 Bacteria 1818
197 Ga0075436_100134116 3300006914 Bacteria 1738
198 Ga0075436_100141285 3300006914 Bacteria 1692
199 Ga0097620_100013490 3300006931 Bacteria 8194
200 Ga0097620_100028740 3300006931 Bacteria 5574
201 Ga0097620_100033089 3300006931 Bacteria 5193
202 Ga0097620_100050677 3300006931 Bacteria 4170
203 Ga0097620_100079736 3300006931 Bacteria 3314
204 Ga0097620_100105786 3300006931 Bacteria 2873
205 Ga0097620_100308169 3300006931 Bacteria 1677
206 Ga0097620_100399918 3300006931 Bacteria 1469
207 Ga0075435_100000346 3300007076 Bacteria 28639
208 Ga0075435_100002191 3300007076 Bacteria 12888
209 Ga0075435_100005602 3300007076 Bacteria 8793
210 Ga0075435_100010740 3300007076 Bacteria 6706
211 Ga0075435_100015759 3300007076 Bacteria 5687
212 Ga0075435_100033922 3300007076 Bacteria 4040
213 Ga0105240_10000663 3300009093 Bacteria 63262
214 Ga0105240_10010389 3300009093 Bacteria 13085
215 Ga0105240_10019935 3300009093 Bacteria 8955
216 Ga0105240_10058841 3300009093 Bacteria 4797
217 Ga0105240_10102912 3300009093 Bacteria 3470
218 Ga0111539_10004361 3300009094 Bacteria 18532
219 Ga0111539_10011681 3300009094 Bacteria 11017
220 Ga0111539_10026321 3300009094 Bacteria 7112
221 Ga0111539_10049947 3300009094 Bacteria 4985
222 Ga0111539_10111128 3300009094 Bacteria 3216
223 Ga0111539_10441776 3300009094 Bacteria 1515
224 Ga0105245_10002815 3300009098 Bacteria 15638
225 Ga0105245_10010419 3300009098 Bacteria 8096
226 Ga0105245_10018240 3300009098 Bacteria 6136
227 Ga0105245_10037780 3300009098 Bacteria 4293
228 Ga0105245_10058454 3300009098 Bacteria 3471
229 Ga0105245_10094137 3300009098 Bacteria 2761
230 Ga0105247_10004217 3300009101 Bacteria 9218
231 Ga0105247_10173739 3300009101 Bacteria 1434
232 Ga0114129_10013084 3300009147 Bacteria 11820
233 Ga0114129_10014211 3300009147 Bacteria 11343
234 Ga0114129_10014362 3300009147 Bacteria 11288
235 Ga0114129_10021276 3300009147 Bacteria 9210
236 Ga0114129_10039725 3300009147 Bacteria 6636
237 Ga0114129_10047663 3300009147 Bacteria 6021
238 Ga0114129_10048489 3300009147 Bacteria 5968
239 Ga0114129_10104363 3300009147 Bacteria 3917
240 Ga0114129_10229445 3300009147 Bacteria 2501
241 Ga0105243_10149516 3300009148 Bacteria 2002
242 Ga0105243_10422857 3300009148 Bacteria 1243
243 Ga0105241_10003115 3300009174 Bacteria 12345
244 Ga0105241_10005170 3300009174 Bacteria 9627
245 Ga0105241_10014948 3300009174 Bacteria 5683
246 Ga0105241_10068995 3300009174 Bacteria 2740
247 Ga0105242_10006628 3300009176 Bacteria 8927
248 Ga0105248_10005114 3300009177 Bacteria 14471
249 Ga0105248_10007643 3300009177 Bacteria 11878
250 Ga0105248_10010289 3300009177 Bacteria 10297
251 Ga0105248_10025773 3300009177 Bacteria 6540
252 Ga0105248_10033272 3300009177 Bacteria 5758
253 Ga0105248_10066871 3300009177 Bacteria 4035
254 Ga0105248_10069483 3300009177 Bacteria 3954
255 Ga0105248_10073388 3300009177 Unclassified 3846
256 Ga0105248_10073651 3300009177 Bacteria 3838
257 Ga0105248_10075284 3300009177 Bacteria 3794
258 Ga0105248_10161866 3300009177 Bacteria 2524
259 Ga0105248_10267912 3300009177 Bacteria 1923
260 Ga0105248_10269576 3300009177 Bacteria 1917
261 Ga0105237_10007213 3300009545 Bacteria 12201
262 Ga0105237_10009782 3300009545 Bacteria 10252
263 Ga0105238_10000657 3300009551 Bacteria 36213
264 Ga0105238_10006697 3300009551 Bacteria 11494
265 Ga0105238_10009153 3300009551 Bacteria 9915
266 Ga0105249_10025755 3300009553 Bacteria 5297
267 Ga0105249_10286885 3300009553 Bacteria 1646
268 Ga0105239_10010212 3300010375 Bacteria 10519
269 Ga0105239_10013868 3300010375 Bacteria 8943
270 Ga0105239_10212518 3300010375 Unclassified 2168
271 Ga0157371_10113183 3300013102 Bacteria 1927
272 Ga0157369_10031690 3300013105 Bacteria 5818
273 Ga0157369_10128190 3300013105 Bacteria 2689
274 Ga0157369_10134210 3300013105 Bacteria 2621
275 Ga0157369_10163394 3300013105 Bacteria 2349
276 Ga0157369_10251569 3300013105 Bacteria 1844
277 Ga0157369_10253723 3300013105 Bacteria 1835
278 Ga0157369_10294993 3300013105 Bacteria 1687
279 Ga0157374_10005560 3300013296 Bacteria 10612
280 Ga0157374_10009039 3300013296 Bacteria 8543
281 Ga0157374_10036420 3300013296 Bacteria 4507
282 Ga0157374_10072706 3300013296 Bacteria 3245
283 Ga0157374_10183090 3300013296 Bacteria 2047
284 Ga0157374_10243686 3300013296 Bacteria 1768
285 Ga0157378_10007412 3300013297 Bacteria 9584
286 Ga0157378_10013370 3300013297 Bacteria 7173
287 Ga0157378_10014829 3300013297 Bacteria 6821
288 Ga0157378_10015600 3300013297 Bacteria 6653
289 Ga0157378_10114680 3300013297 Bacteria 2475
290 Ga0163162_10004597 3300013306 Bacteria 13296
291 Ga0163162_10148861 3300013306 Bacteria 2458
292 Ga0163162_10215887 3300013306 Bacteria 2048
293 Ga0163162_10276676 3300013306 Bacteria 1811
294 Ga0163162_10440142 3300013306 Bacteria 1436
295 Ga0157372_10001132 3300013307 Bacteria 28947
296 Ga0157372_10021218 3300013307 Bacteria 7017
297 Ga0157372_10044476 3300013307 Bacteria 4921
298 Ga0157372_10059882 3300013307 Bacteria 4261
299 Ga0157372_10327434 3300013307 Bacteria 1784
300 Ga0157372_10437784 3300013307 Bacteria 1524
301 Ga0157375_10030460 3300013308 Bacteria 5088
302 Ga0157375_10056413 3300013308 Bacteria 3878
303 Ga0157375_10118012 3300013308 Bacteria 2759
304 Ga0157375_10319371 3300013308 Bacteria 1717
305 Ga0157375_10362254 3300013308 Bacteria 1616
306 Ga0163163_10007028 3300014325 Bacteria 9890
307 Ga0163163_10009625 3300014325 Bacteria 8641
308 Ga0163163_10014932 3300014325 Bacteria 7156
309 Ga0163163_10115054 3300014325 Bacteria 2721
310 Ga0163163_10186714 3300014325 Bacteria 2121
311 Ga0163163_10288376 3300014325 Bacteria 1693
312 Ga0157380_10010849 3300014326 Bacteria 6568
313 Ga0157380_10025522 3300014326 Bacteria 4481
314 Ga0157380_10071933 3300014326 Bacteria 2799
315 Ga0157379_10005193 3300014968 Bacteria 11186
316 Ga0157379_10014375 3300014968 Bacteria 6945
317 Ga0157379_10055488 3300014968 Bacteria 3539
318 Ga0157376_10000173 3300014969 Bacteria 44682
319 Ga0157376_10037758 3300014969 Bacteria 3925
320 Ga0157376_10067576 3300014969 Bacteria 3024
321 Ga0157376_10086181 3300014969 Bacteria 2707
322 Ga0157376_10113077 3300014969 Bacteria 2393
323 Ga0157376_10216863 3300014969 Bacteria 1770
324 Ga0157376_10273387 3300014969 Bacteria 1588
325 Ga0157376_10446535 3300014969 Bacteria 1260
326 Ga0163161_10267393 3300017792 Bacteria 1337
327 Ga0213872_10016026 3300021361 Bacteria 3481
328 Ga0213872_10062464 3300021361 Bacteria 1683
329 Ga0207656_10040382 3300025321 Bacteria 1978
330 Ga0207656_10107340 3300025321 Bacteria 1286
331 Ga0207653_10000296 3300025885 Bacteria 28845
332 Ga0207688_10079285 3300025901 Bacteria 1873
333 Ga0207680_10004658 3300025903 Bacteria 6511
334 Ga0207680_10032963 3300025903 Bacteria 2950
335 Ga0207680_10042140 3300025903 Bacteria 2668
336 Ga0207680_10252988 3300025903 Bacteria 1217
337 Ga0207699_10057965 3300025906 Bacteria 2315
338 Ga0207699_10108006 3300025906 Bacteria 1779
339 Ga0207645_10114258 3300025907 Bacteria 1749
340 Ga0207643_10006154 3300025908 Bacteria 6422
341 Ga0207684_10004650 3300025910 Bacteria 12887
342 Ga0207654_10000302 3300025911 Bacteria 30006
343 Ga0207654_10034343 3300025911 Bacteria 2817
344 Ga0207707_10022700 3300025912 Bacteria 5487
345 Ga0207707_10147929 3300025912 Bacteria 2054
346 Ga0207707_10168455 3300025912 Bacteria 1914
347 Ga0207695_10000108 3300025913 Bacteria 252306
348 Ga0207695_10000253 3300025913 Bacteria 139044
349 Ga0207695_10001120 3300025913 Bacteria 46589
350 Ga0207695_10002288 3300025913 Bacteria 28621
351 Ga0207695_10013281 3300025913 Bacteria 9824
352 Ga0207671_10000081 3300025914 Bacteria 148476
353 Ga0207671_10005934 3300025914 Bacteria 11073
354 Ga0207671_10228029 3300025914 Bacteria 1461
355 Ga0207660_10086904 3300025917 Bacteria 2309
356 Ga0207657_10004178 3300025919 Bacteria 15301
357 Ga0207649_10002341 3300025920 Bacteria 10624
358 Ga0207649_10006738 3300025920 Bacteria 6240
359 Ga0207649_10010211 3300025920 Bacteria 5154
360 Ga0207649_10095043 3300025920 Bacteria 1960
361 Ga0207652_10114604 3300025921 Bacteria 2394
362 Ga0207646_10000543 3300025922 Bacteria 49799
363 Ga0207646_10072856 3300025922 Bacteria 3068
364 Ga0207681_10006478 3300025923 Bacteria 7189
365 Ga0207681_10069176 3300025923 Bacteria 2455
366 Ga0207694_10000108 3300025924 Bacteria 87457
367 Ga0207694_10000313 3300025924 Bacteria 45627
368 Ga0207694_10003511 3300025924 Bacteria 12445
369 Ga0207694_10006127 3300025924 Bacteria 9190
370 Ga0207650_10000845 3300025925 Bacteria 23199
371 Ga0207650_10001335 3300025925 Bacteria 17846
372 Ga0207650_10057077 3300025925 Bacteria 2903
373 Ga0207650_10075745 3300025925 Bacteria 2540
374 Ga0207659_10009805 3300025926 Bacteria 5994
375 Ga0207659_10027937 3300025926 Bacteria 3827
376 Ga0207659_10037071 3300025926 Bacteria 3382
377 Ga0207659_10088672 3300025926 Bacteria 2305
378 Ga0207659_10091570 3300025926 Bacteria 2272
379 Ga0207659_10198668 3300025926 Bacteria 1600
380 Ga0207687_10031659 3300025927 Bacteria 3576
381 Ga0207687_10052187 3300025927 Bacteria 2853
382 Ga0207687_10137295 3300025927 Bacteria 1851
383 Ga0207700_10105323 3300025928 Bacteria 2259
384 Ga0207700_10159209 3300025928 Bacteria 1874
385 Ga0207644_10002155 3300025931 Bacteria 12780
386 Ga0207644_10002796 3300025931 Bacteria 11244
387 Ga0207690_10025257 3300025932 Bacteria 3728
388 Ga0207690_10205745 3300025932 Bacteria 1498
389 Ga0207706_10017828 3300025933 Bacteria 6395
390 Ga0207706_10031305 3300025933 Bacteria 4740
391 Ga0207686_10004844 3300025934 Bacteria 7234
392 Ga0207686_10011649 3300025934 Bacteria 4822
393 Ga0207686_10043936 3300025934 Bacteria 2740
394 Ga0207709_10265220 3300025935 Bacteria 1261
395 Ga0207669_10129025 3300025937 Bacteria 1733
396 Ga0207704_10007156 3300025938 Bacteria 5252
397 Ga0207665_10052450 3300025939 Bacteria 2747
398 Ga0207665_10168518 3300025939 Bacteria 1580
399 Ga0207691_10009310 3300025940 Bacteria 9426
400 Ga0207691_10020940 3300025940 Bacteria 6180
401 Ga0207691_10029528 3300025940 Bacteria 5129
402 Ga0207691_10167848 3300025940 Bacteria 1923
403 Ga0207711_10004803 3300025941 Bacteria 11473
404 Ga0207711_10019972 3300025941 Bacteria 5583
405 Ga0207711_10022810 3300025941 Bacteria 5238
406 Ga0207711_10027546 3300025941 Bacteria 4774
407 Ga0207711_10056074 3300025941 Bacteria 3385
408 Ga0207711_10069704 3300025941 Bacteria 3049
409 Ga0207711_10183840 3300025941 Bacteria 1902
410 Ga0207711_10354195 3300025941 Bacteria 1359
411 Ga0207689_10114151 3300025942 Bacteria 2220
412 Ga0207689_10169595 3300025942 Bacteria 1799
413 Ga0207661_10002024 3300025944 Bacteria 13979
414 Ga0207661_10005019 3300025944 Bacteria 9278
415 Ga0207661_10005751 3300025944 Bacteria 8744
416 Ga0207661_10129696 3300025944 Bacteria 2158
417 Ga0207679_10015458 3300025945 Bacteria 5044
418 Ga0207679_10063021 3300025945 Bacteria 2766
419 Ga0207679_10080000 3300025945 Bacteria 2494
420 Ga0207667_10000934 3300025949 Bacteria 37249
421 Ga0207651_10000458 3300025960 Bacteria 17210
422 Ga0207651_10004258 3300025960 Bacteria 7182
423 Ga0207651_10142570 3300025960 Bacteria 1853
424 Ga0207712_10097210 3300025961 Bacteria 2181
425 Ga0207658_10000416 3300025986 Bacteria 40419
426 Ga0207658_10020848 3300025986 Bacteria 4541
427 Ga0207677_10000025 3300026023 Bacteria 127400
428 Ga0207677_10001276 3300026023 Bacteria 13521
429 Ga0207677_10019800 3300026023 Bacteria 4073
430 Ga0207677_10038732 3300026023 Bacteria 3128
431 Ga0207677_10074822 3300026023 Bacteria 2405
432 Ga0207703_10013597 3300026035 Bacteria 6343
433 Ga0207703_10026803 3300026035 Bacteria 4540
434 Ga0207703_10045454 3300026035 Bacteria 3532
435 Ga0207703_10052897 3300026035 Bacteria 3299
436 Ga0207703_10054904 3300026035 Bacteria 3241
437 Ga0207703_10147339 3300026035 Bacteria 2049
438 Ga0207703_10175334 3300026035 Bacteria 1889
439 Ga0207703_10187849 3300026035 Bacteria 1828
440 Ga0207639_10000055 3300026041 Bacteria 110260
441 Ga0207639_10004182 3300026041 Bacteria 9720
442 Ga0207708_10114066 3300026075 Bacteria 2100
443 Ga0207702_10002856 3300026078 Bacteria 16153
444 Ga0207702_10177152 3300026078 Bacteria 1960
445 Ga0207702_10321670 3300026078 Unclassified 1473
446 Ga0207641_10003438 3300026088 Bacteria 14020
447 Ga0207641_10010405 3300026088 Bacteria 7644
448 Ga0207641_10053618 3300026088 Bacteria 3419
449 Ga0207641_10167637 3300026088 Unclassified 2002
450 Ga0207648_10027066 3300026089 Bacteria 5093
451 Ga0207648_10048204 3300026089 Bacteria 3730
452 Ga0207648_10297556 3300026089 Bacteria 1446
453 Ga0207676_10000597 3300026095 Bacteria 29656
454 Ga0207676_10002620 3300026095 Bacteria 12828
455 Ga0207676_10012097 3300026095 Bacteria 6176
456 Ga0207676_10090997 3300026095 Bacteria 2505
457 Ga0207674_10001459 3300026116 Bacteria 30559
458 Ga0207674_10064007 3300026116 Bacteria 3710
459 Ga0207674_10135888 3300026116 Bacteria 2421
460 Ga0207674_10186955 3300026116 Bacteria 2022
461 Ga0207675_100073741 3300026118 Bacteria 3193
462 Ga0207675_100107490 3300026118 Bacteria 2631
463 Ga0207683_10003208 3300026121 Bacteria 14272
464 Ga0207683_10032747 3300026121 Bacteria 4515
465 Ga0207683_10093026 3300026121 Bacteria 2687
466 Ga0207698_10029371 3300026142 Bacteria 3937
467 Ga0207698_10071935 3300026142 Bacteria 2746
468 Ga0207428_10001780 3300027907 Bacteria 22062
469 Ga0207428_10022551 3300027907 Bacteria 5310
470 Ga0207428_10023970 3300027907 Bacteria 5125
471 Ga0268266_10022544 3300028379 Bacteria 5364
472 Ga0268265_10072698 3300028380 Bacteria 2683
473 Ga0268264_10000920 3300028381 Bacteria 30745
474 Ga0268264_10033695 3300028381 Bacteria 4210
475 Ga0268264_10122673 3300028381 Unclassified 2292
476 Ga0268264_10139070 3300028381 Bacteria 2163
477 Ga0268264_10323779 3300028381 Bacteria 1458
478 Ga0268264_10370826 3300028381 Bacteria 1368
479 Ga0265336_10002136 3300028666 Bacteria 8364
480 Ga0265338_10003779 3300028800 Bacteria 21040
481 Ga0265338_10004819 3300028800 Bacteria 18037
482 Ga0265338_10012773 3300028800 Bacteria 9552
483 Ga0265330_10000852 3300031235 Bacteria 19100
484 Ga0265330_10010994 3300031235 Bacteria 4249
485 Ga0265332_10023877 3300031238 Bacteria 2694
486 Ga0265332_10036136 3300031238 Bacteria 2145
487 Ga0265332_10065466 3300031238 Bacteria 1552
488 Ga0265328_10045676 3300031239 Bacteria 1610
489 Ga0265320_10018906 3300031240 Bacteria 3780
490 Ga0265320_10037191 3300031240 Bacteria 2453
491 Ga0265325_10002033 3300031241 Bacteria 13905
492 Ga0265325_10010585 3300031241 Bacteria 5335
493 Ga0265325_10067769 3300031241 Bacteria 1797
494 Ga0265339_10000029 3300031249 Bacteria 139089
495 Ga0265339_10000204 3300031249 Bacteria 48602
496 Ga0265339_10004335 3300031249 Bacteria 9688
497 Ga0265339_10007186 3300031249 Bacteria 7219
498 Ga0265339_10016804 3300031249 Bacteria 4352
499 Ga0265331_10081078 3300031250 Bacteria 1507
500 Ga0265316_10002998 3300031344 Bacteria 17267
501 Ga0265316_10010127 3300031344 Bacteria 8607
502 Ga0265316_10048099 3300031344 Bacteria 3370
503 Ga0265316_10072395 3300031344 Bacteria 2655
504 Ga0265313_10001614 3300031595 Bacteria 20940
505 Ga0265313_10082546 3300031595 Archaea 1456
506 Ga0316575_10052205 3300031665 Bacteria 1628
507 Ga0265314_10000139 3300031711 Bacteria 108861
508 Ga0265314_10002635 3300031711 Bacteria 18083
509 Ga0265314_10038367 3300031711 Bacteria 3461
510 Ga0265314_10201278 3300031711 Bacteria 1177
511 Ga0265342_10001268 3300031712 Bacteria 23772
512 Ga0265342_10001906 3300031712 Bacteria 18762
513 Ga0265342_10002378 3300031712 Bacteria 16291
514 Ga0265342_10009601 3300031712 Bacteria 6795
515 Ga0265342_10019600 3300031712 Bacteria 4357
516 Ga0316576_10005853 3300031727 Bacteria 7582
517 Ga0307405_10084624 3300031731 Unclassified 2082
518 Ga0307405_10130308 3300031731 Bacteria 1737
519 Ga0307412_10187716 3300031911 Bacteria 1560
520 Ga0307409_100094124 3300031995 Bacteria 2464
521 Ga0307409_100187555 3300031995 Bacteria 1837
522 Ga0307409_100474587 3300031995 Bacteria 1212
523 Ga0307416_100006624 3300032002 Bacteria 7270
524 Ga0307416_100013904 3300032002 Bacteria 5489
525 Ga0307411_10026713 3300032005 Bacteria 3480
526 Ga0307411_10061367 3300032005 Bacteria 2502
527 Ga0307415_100034503 3300032126 Bacteria 3295
528 Ga0316583_10000278 3300032133 Bacteria 14246
529 Ga0316585_10002014 3300032137 Bacteria 5437
530 Ga0373930_0005342 3300034816 Bacteria 2132
531 Ga0373948_0009173 3300034817 Bacteria 1701
532 Ga0373950_0000985 3300034818 Bacteria 3607
533 Ga0373938_0002908 3300034957 Bacteria 2767
534 Ga0373929_0000163 3300035085 Bacteria 11608
535 Ga0373940_0000203 3300035088 Bacteria 8256
536 Ga0373949_0001328 3300035090 Bacteria 7130
537 Ga0373951_0000732 3300035091 Bacteria 9021
538 Ga0373952_0003388 3300035092 Bacteria 2877
539 Ga0373932_0000277 3300035112 Bacteria 15406
540 Ga0373939_0001054 3300035114 Bacteria 6792
541 Ga0373957_0016697 3300035120 Bacteria 2546
542 Ga0373960_0001680 3300035121 Bacteria 4951
543 Ga0373946_0002728 3300035171 Bacteria 6241
544 Ga0373955_0048692 3300035172 Bacteria 2299
545 Ga0373962_0001306 3300035242 Bacteria 5857
546 Ga0373962_0012884 3300035242 Bacteria 2111
547 Ga0373935_0159388 3300035692 Bacteria 1537
548 Ga0373947_0139286 3300035725 Bacteria 1555
549 Ga0373947_0190887 3300035725 Bacteria 1337
550 Ga0373937_0002195 3300036401 Bacteria 16312
551 Ga0373937_0013603 3300036401 Bacteria 7170
552 Ga0373937_0026531 3300036401 Bacteria 5234
553 Ga0373937_0080256 3300036401 Bacteria 3017
554 Ga0373937_0091727 3300036401 Bacteria 2815
555 Ga0373937_0208778 3300036401 Bacteria 1837
556 Ga0373937_0335613 3300036401 Unclassified 1431
557 Ga0316582_0037884 3300036647 Bacteria 2993
558 Ga0316584_0070788 3300036712 Bacteria 2613
559 Ga0373925_0028280 3300037068 Bacteria 4107
560 Ga0395898_0083408 3300037466 Bacteria 3081
561 Ga0436360_1224841 3300039438 Bacteria 2090
562 Ga0436361_0224417 3300039447 Bacteria 20492
563 Ga0436361_1193508 3300039447 Bacteria 3382
564 Ga0439446_0001344 3300042156 Bacteria 5544
565 Ga0439434_0008285 3300042435 Bacteria 3048
566 Ga0451577_0002197 3300042876 Bacteria 23772
567 Ga0466961_0146027 3300044693 Bacteria 1479
568 Ga0466963_0011541 3300044694 Bacteria 5380
569 Ga0453684_0000809 3300044712 Bacteria 106510
570 Ga0466959_0055610 3300045049 Bacteria 2889
571 Ga0451576_0040199 3300045051 Bacteria 4951
572 Ga0466958_0158302 3300045836 Bacteria 1430
573 Ga0466967_0108084 3300045976 Bacteria 2552
574 Ga0466967_0406711 3300045976 Bacteria 1325
575 Ga0495592_0012152 3300046454 Bacteria 6533
576 Ga0495629_0048272 3300046459 Bacteria 2985
577 Ga0495629_0064427 3300046459 Bacteria 2559
578 Ga0495653_0123680 3300046463 Bacteria 1840
579 Ga0495653_0163278 3300046463 Bacteria 1545
580 Ga0495580_0144140 3300046472 Bacteria 1651
581 Ga0495664_0142574 3300046477 Bacteria 1453
582 Ga0495608_0038100 3300046511 Bacteria 3231
583 Ga0495618_0028265 3300046514 Bacteria 3495
584 Ga0495628_0101905 3300046516 Bacteria 2215
585 Ga0495630_0023677 3300046517 Bacteria 4540
586 Ga0495630_0293842 3300046517 Bacteria 1242
587 Ga0495652_0021671 3300046529 Bacteria 5711
588 Ga0495640_0145776 3300046533 Bacteria 1523
589 Ga0495586_0074284 3300046535 Bacteria 1861
590 Ga0495587_0004453 3300046536 Bacteria 9230
591 Ga0495645_0001171 3300046543 Bacteria 17849
592 Ga0495645_0009063 3300046543 Bacteria 6951
593 Ga0495667_0006730 3300046559 Bacteria 7797
594 Ga0495625_0111003 3300046660 Bacteria 1874
595 Ga0495659_0021962 3300046664 Unclassified 2154
596 Ga0495657_0011406 3300046675 Bacteria 6645
597 Ga0495599_0108896 3300046678 Bacteria 1726
598 Ga0495647_0018577 3300046681 Bacteria 2478
599 Ga0495647_0048193 3300046681 Bacteria 1647
600 Ga0495658_0020183 3300046683 Bacteria 3493
601 Ga0495658_0042361 3300046683 Bacteria 2542
602 Ga0495658_0064983 3300046683 Bacteria 2104
603 Ga0495658_0090000 3300046683 Bacteria 1816
604 Ga0495669_0000860 3300046684 Bacteria 12848
605 Ga0495669_0051264 3300046684 Bacteria 1852
606 Ga0495613_0014767 3300046689 Bacteria 5796
607 Ga0495613_0015595 3300046689 Bacteria 5653
608 Ga0495613_0155324 3300046689 Bacteria 1630
609 Ga0495600_0015924 3300046809 Bacteria 4764
610 Ga0495604_0068058 3300047317 Bacteria 2704
611 Ga0495674_0013025 3300047319 Bacteria 7828
612 Ga0495674_0046843 3300047319 Bacteria 3837
613 Ga0495674_0294039 3300047319 Bacteria 1328
614 Ga0495684_0000549 3300047471 Bacteria 30432
615 Ga0495684_0128657 3300047471 Bacteria 1903
616 Ga0495686_0000382 3300047472 Bacteria 70847
617 Ga0495602_0078220 3300048088 Bacteria 2794
618 Ga0495602_0172286 3300048088 Bacteria 1679
619 Ga0496101_0008114 3300048904 Bacteria 6850
620 Ga0496101_0187028 3300048904 Bacteria 1597
621 Ga0496102_0269264 3300048905 Bacteria 1606
622 Ga0496104_0012179 3300048907 Bacteria 7725
623 Ga0496104_0021109 3300048907 Bacteria 5975
624 Ga0496104_0102223 3300048907 Bacteria 2745
625 Ga0496104_0103189 3300048907 Bacteria 2732
626 Ga0496104_0133652 3300048907 Bacteria 2383
627 Ga0496104_0143115 3300048907 Bacteria 2297
628 Ga0496105_0010021 3300048908 Bacteria 7436
629 Ga0496106_0032282 3300048909 Bacteria 3904
630 Ga0496106_0061878 3300048909 Bacteria 2841
631 Ga0496107_0023872 3300048910 Bacteria 4322
632 Ga0496108_0001066 3300048911 Bacteria 21388
633 Ga0496109_0000525 3300048912 Bacteria 32426
634 Ga0496109_0070364 3300048912 Bacteria 3211
635 Ga0496109_0138565 3300048912 Bacteria 2275
636 Ga0496109_0292021 3300048912 Bacteria 1537
637 Ga0496110_0001750 3300048913 Bacteria 16012
638 Ga0496110_0340171 3300048913 Bacteria 1367
639 Ga0496111_0000267 3300048914 Bacteria 25489
640 Ga0496112_0004758 3300048915 Bacteria 11577
641 Ga0496112_0034440 3300048915 Bacteria 4928
642 Ga0496112_0086626 3300048915 Bacteria 3099
643 Ga0496113_0019024 3300048916 Bacteria 4797
644 Ga0496113_0071872 3300048916 Bacteria 2632
645 Ga0496114_0015720 3300048917 Bacteria 6089
646 Ga0496114_0043177 3300048917 Bacteria 3739
647 Ga0496115_0116364 3300048918 Bacteria 2199
648 Ga0496115_0136729 3300048918 Bacteria 2021
649 Ga0496126_0003640 3300048929 Bacteria 19252
650 Ga0496126_0004803 3300048929 Bacteria 15878
651 Ga0501037_0181393 3300049573 Bacteria 1493
652 Ga0501041_0121308 3300049577 Bacteria 1625
653 Ga0501046_0160385 3300049580 Bacteria 1692
654 Ga0501067_0019332 3300049583 Bacteria 3770
655 Ga0501071_0150453 3300049587 Bacteria 1736
656 Ga0501073_0003486 3300049589 Bacteria 11817
657 Ga0501074_0086925 3300049590 Bacteria 2240
658 Ga0501079_0150413 3300049741 Bacteria 1815
659 Ga0501081_0133817 3300049743 Bacteria 1773
660 Ga0501044_0029063 3300049823 Bacteria 5830
661 nmdc:mga05p37_10494_c2 3300050507 Bacteria 9476
662 nmdc:mga05p37_151399_c1 3300050507 Bacteria 2837
663 nmdc:mga05p37_253830_c1 3300050507 Bacteria 2108
664 nmdc:mga05p37_26723_c1 3300050507 Bacteria 7019
665 nmdc:mga05p37_31291_c1 3300050507 Bacteria 6500
666 nmdc:mga05p37_35468_c1 3300050507 Bacteria 6116
667 nmdc:mga05p37_4536_c1 3300050507 Bacteria 16231
668 nmdc:mga05p37_4747_c1 3300050507 Bacteria 15879
669 nmdc:mga05p37_60298_c1 3300050507 Bacteria 4672
670 nmdc:mga09592_14874_c1 3300050508 Bacteria 6355
671 nmdc:mga09592_20467_c1 3300050508 Bacteria 5440
672 nmdc:mga09592_312631_c1 3300050508 Bacteria 1361
673 nmdc:mga09592_57792_c1 3300050508 Bacteria 3279
674 nmdc:mga0qj67_1124_c1 3300050509 Bacteria 18545
675 nmdc:mga0qj67_1773_c1 3300050509 Bacteria 15254
676 nmdc:mga06r32_217277_c1 3300050510 Bacteria 1899
677 nmdc:mga06r32_26504_c1 3300050510 Bacteria 5405
678 nmdc:mga06r32_30833_c1 3300050510 Bacteria 5032
679 nmdc:mga06r32_96180_c1 3300050510 Bacteria 2900
680 nmdc:mga08y16_18874_c1 3300050511 Bacteria 7264
681 nmdc:mga08y16_312777_c1 3300050511 Bacteria 1618
682 nmdc:mga08y16_8367_c1 3300050511 Bacteria 10822
683 nmdc:mga0n895_119105_c1 3300050512 Bacteria 2661
684 nmdc:mga0n895_12795_c1 3300050512 Bacteria 7536
685 nmdc:mga0n895_35_c1 3300050512 Bacteria 79696
686 nmdc:mga0n895_62939_c1 3300050512 Bacteria 3668
687 nmdc:mga0n895_9176_c1 3300050512 Bacteria 8638
688 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
689 nmdc:mga0rr50_20239_c1 3300050513 Bacteria 4512
690 nmdc:mga0rr50_3767_c1 3300050513 Bacteria 8793
691 nmdc:mga0rr50_7096_c1 3300050513 Bacteria 6880
692 nmdc:mga0rr50_85727_c1 3300050513 Bacteria 2441
693 nmdc:mga08x19_123564_c1 3300050514 Bacteria 1737
694 nmdc:mga08x19_755_c1 3300050514 Bacteria 20656
695 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
696 nmdc:mga0a205_137170_c1 3300050515 Bacteria 2347
697 nmdc:mga0a205_37588_c1 3300050515 Bacteria 4655
698 Ga0495601_0009859 3300053077 Bacteria 5656
699 Ga0495601_0030691 3300053077 Bacteria 3339
700 Ga0495601_0193033 3300053077 Bacteria 1331
701 Ga0495619_0003759 3300053085 Bacteria 9772
702 Ga0495619_0035218 3300053085 Bacteria 3256
703 Ga0500555_026418 3300053103 Bacteria 1659
704 Ga0590071_001581 3300059421 Bacteria 5958
705 Ga0590075_000627 3300059424 Bacteria 9451
706 Ga0590075_028840 3300059424 Bacteria 1402
707 Ga0590077_000498 3300059426 Bacteria 10968
708 Ga0590077_011713 3300059426 Bacteria 1812
709 Ga0501082_0234020 3300060353 Bacteria 1599

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10252988 Ga0207680_102529882 322
2 3300046477 Ga0495664_0142574 Ga0495664_0142574_285_1307 324
3 3300009147 Ga0114129_10048489 Ga0114129_100484894 328
4 3300050507 nmdc:mga05p37_151399_c1 nmdc:mga05p37_151399_c1_1131_2126 328
5 3300005336 Ga0070680_100076417 Ga0070680_1000764173 329
6 3300005354 Ga0070675_100157962 Ga0070675_1001579621 331
7 3300006844 Ga0075428_100000364 Ga0075428_10000036444 331
8 3300047472 Ga0495686_0000382 Ga0495686_0000382_66942_68045 331
9 3300035725 Ga0373947_0139286 Ga0373947_0139286_367_1365 332
10 3300013102 Ga0157371_10113183 Ga0157371_101131832 333
11 3300013296 Ga0157374_10009039 Ga0157374_100090398 333
12 3300013307 Ga0157372_10001132 Ga0157372_1000113228 333
13 3300048929 Ga0496126_0004803 Ga0496126_0004803_4390_5391 333
14 3300005356 Ga0070674_100010619 Ga0070674_1000106193 334
15 3300005456 Ga0070678_100102872 Ga0070678_1001028722 334
16 3300005459 Ga0068867_100040795 Ga0068867_1000407954 334
17 3300006880 Ga0075429_100033840 Ga0075429_1000338405 334
18 3300009094 Ga0111539_10049947 Ga0111539_100499472 334
19 3300009147 Ga0114129_10229445 Ga0114129_102294452 334
20 3300026089 Ga0207648_10048204 Ga0207648_100482042 334
21 3300026121 Ga0207683_10093026 Ga0207683_100930263 334
22 3300050507 nmdc:mga05p37_253830_c1 nmdc:mga05p37_253830_c1_941_1948 334
23 3300050508 nmdc:mga09592_14874_c1 nmdc:mga09592_14874_c1_956_1963 334
24 3300050509 nmdc:mga0qj67_1773_c1 nmdc:mga0qj67_1773_c1_9537_10544 334
25 3300050510 nmdc:mga06r32_217277_c1 nmdc:mga06r32_217277_c1_385_1392 334
26 3300050510 nmdc:mga06r32_30833_c1 nmdc:mga06r32_30833_c1_3574_4581 334
27 3300005290 Ga0065712_10006833 Ga0065712_100068334 335
28 3300005293 Ga0065715_10119435 Ga0065715_101194352 335
29 3300005331 Ga0070670_100047338 Ga0070670_1000473383 335
30 3300005334 Ga0068869_100012602 Ga0068869_1000126023 335
31 3300005335 Ga0070666_10150146 Ga0070666_101501462 335
32 3300005353 Ga0070669_100040918 Ga0070669_1000409182 335
33 3300005354 Ga0070675_100027795 Ga0070675_1000277954 335
34 3300005354 Ga0070675_100138379 Ga0070675_1001383792 335
35 3300005356 Ga0070674_100291949 Ga0070674_1002919491 335
36 3300005364 Ga0070673_100062093 Ga0070673_1000620933 335
37 3300005365 Ga0070688_100086199 Ga0070688_1000861992 335
38 3300005456 Ga0070678_100128053 Ga0070678_1001280532 335
39 3300005543 Ga0070672_100003190 Ga0070672_1000031907 335
40 3300005577 Ga0068857_100084925 Ga0068857_1000849253 335
41 3300005617 Ga0068859_100079735 Ga0068859_1000797353 335
42 3300005840 Ga0068870_10029783 Ga0068870_100297833 335
43 3300006931 Ga0097620_100079736 Ga0097620_1000797362 335
44 3300014325 Ga0163163_10288376 Ga0163163_102883762 335
45 3300014326 Ga0157380_10025522 Ga0157380_100255222 335
46 3300025901 Ga0207688_10079285 Ga0207688_100792852 335
47 3300025903 Ga0207680_10042140 Ga0207680_100421403 335
48 3300025908 Ga0207643_10006154 Ga0207643_100061544 335
49 3300025923 Ga0207681_10069176 Ga0207681_100691762 335
50 3300025925 Ga0207650_10057077 Ga0207650_100570772 335
51 3300025926 Ga0207659_10027937 Ga0207659_100279373 335
52 3300025926 Ga0207659_10037071 Ga0207659_100370713 335
53 3300025926 Ga0207659_10088672 Ga0207659_100886723 335
54 3300025933 Ga0207706_10017828 Ga0207706_100178283 335
55 3300025940 Ga0207691_10009310 Ga0207691_100093104 335
56 3300025960 Ga0207651_10142570 Ga0207651_101425702 335
57 3300026075 Ga0207708_10114066 Ga0207708_101140661 335
58 3300026116 Ga0207674_10186955 Ga0207674_101869552 335
59 3300026118 Ga0207675_100073741 Ga0207675_1000737414 335
60 3300026118 Ga0207675_100107490 Ga0207675_1001074902 335
61 3300026121 Ga0207683_10032747 Ga0207683_100327472 335
62 3300005331 Ga0070670_100005558 Ga0070670_1000055582 336
63 3300006173 Ga0070716_100077051 Ga0070716_1000770512 336
64 3300006871 Ga0075434_100003240 Ga0075434_1000032407 336
65 3300025939 Ga0207665_10168518 Ga0207665_101685181 336
66 3300025945 Ga0207679_10015458 Ga0207679_100154583 336
67 3300026116 Ga0207674_10135888 Ga0207674_101358882 336
68 3300050512 nmdc:mga0n895_9176_c1 nmdc:mga0n895_9176_c1_4378_5397 336
69 3300049577 Ga0501041_0121308 Ga0501041_0121308_587_1615 337
70 3300005355 Ga0070671_100301754 Ga0070671_1003017542 338
71 3300005458 Ga0070681_10398797 Ga0070681_103987971 338
72 3300007076 Ga0075435_100002191 Ga0075435_1000021917 338
73 3300009147 Ga0114129_10104363 Ga0114129_101043633 338
74 3300034816 Ga0373930_0005342 Ga0373930_0005342_1084_2100 338
75 3300034817 Ga0373948_0009173 Ga0373948_0009173_325_1341 338
76 3300034818 Ga0373950_0000985 Ga0373950_0000985_1672_2688 338
77 3300034957 Ga0373938_0002908 Ga0373938_0002908_226_1242 338
78 3300035085 Ga0373929_0000163 Ga0373929_0000163_5346_6362 338
79 3300035088 Ga0373940_0000203 Ga0373940_0000203_4416_5432 338
80 3300035090 Ga0373949_0001328 Ga0373949_0001328_334_1350 338
81 3300035091 Ga0373951_0000732 Ga0373951_0000732_1135_2151 338
82 3300035092 Ga0373952_0003388 Ga0373952_0003388_1151_2167 338
83 3300035112 Ga0373932_0000277 Ga0373932_0000277_9074_10090 338
84 3300035114 Ga0373939_0001054 Ga0373939_0001054_444_1460 338
85 3300035121 Ga0373960_0001680 Ga0373960_0001680_3702_4718 338
86 3300035242 Ga0373962_0001306 Ga0373962_0001306_1281_2297 338
87 3300045051 Ga0451576_0040199 Ga0451576_0040199_1753_2769 338
88 3300048909 Ga0496106_0032282 Ga0496106_0032282_2834_3850 338
89 3300050513 nmdc:mga0rr50_7096_c1 nmdc:mga0rr50_7096_c1_371_1387 338
90 3300005295 Ga0065707_10084507 Ga0065707_100845076 339
91 3300005340 Ga0070689_100017917 Ga0070689_1000179175 339
92 3300005354 Ga0070675_100230880 Ga0070675_1002308801 339
93 3300005544 Ga0070686_100088003 Ga0070686_1000880033 339
94 3300005617 Ga0068859_100028738 Ga0068859_1000287384 339
95 3300005844 Ga0068862_100008314 Ga0068862_1000083146 339
96 3300006880 Ga0075429_100008602 Ga0075429_1000086027 339
97 3300006931 Ga0097620_100028740 Ga0097620_1000287404 339
98 3300009094 Ga0111539_10011681 Ga0111539_1001168111 339
99 3300009094 Ga0111539_10441776 Ga0111539_104417762 339
100 3300009101 Ga0105247_10173739 Ga0105247_101737391 339
101 3300009147 Ga0114129_10013084 Ga0114129_100130846 339
102 3300009177 Ga0105248_10066871 Ga0105248_100668712 339
103 3300009177 Ga0105248_10073388 Ga0105248_100733884 339
104 3300009177 Ga0105248_10267912 Ga0105248_102679121 339
105 3300009553 Ga0105249_10286885 Ga0105249_102868852 339
106 3300014326 Ga0157380_10010849 Ga0157380_100108493 339
107 3300025926 Ga0207659_10091570 Ga0207659_100915702 339
108 3300025926 Ga0207659_10198668 Ga0207659_101986681 339
109 3300025941 Ga0207711_10069704 Ga0207711_100697043 339
110 3300025942 Ga0207689_10114151 Ga0207689_101141512 339
111 3300026088 Ga0207641_10167637 Ga0207641_101676373 339
112 3300027907 Ga0207428_10001780 Ga0207428_100017807 339
113 3300028380 Ga0268265_10072698 Ga0268265_100726982 339
114 3300028381 Ga0268264_10122673 Ga0268264_101226733 339
115 3300031731 Ga0307405_10130308 Ga0307405_101303082 339
116 3300031995 Ga0307409_100474587 Ga0307409_1004745871 339
117 3300032002 Ga0307416_100013904 Ga0307416_1000139044 339
118 3300046664 Ga0495659_0021962 Ga0495659_0021962_715_1737 339
119 3300048907 Ga0496104_0021109 Ga0496104_0021109_2932_3954 339
120 3300048915 Ga0496112_0086626 Ga0496112_0086626_1506_2528 339
121 3300049580 Ga0501046_0160385 Ga0501046_0160385_586_1611 339
122 3300049587 Ga0501071_0150453 Ga0501071_0150453_497_1522 339
123 3300049589 Ga0501073_0003486 Ga0501073_0003486_7880_8905 339
124 3300049590 Ga0501074_0086925 Ga0501074_0086925_364_1389 339
125 3300050507 nmdc:mga05p37_4747_c1 nmdc:mga05p37_4747_c1_3719_4741 339
126 3300050508 nmdc:mga09592_57792_c1 nmdc:mga09592_57792_c1_210_1232 339
127 3300050513 nmdc:mga0rr50_85727_c1 nmdc:mga0rr50_85727_c1_468_1496 339
128 3300053103 Ga0500555_026418 Ga0500555_026418_243_1268 339
129 3300059424 Ga0590075_028840 Ga0590075_028840_210_1229 339
130 3300059426 Ga0590077_011713 Ga0590077_011713_74_1096 339
131 3300005290 Ga0065712_10122814 Ga0065712_101228142 340
132 3300005329 Ga0070683_100000219 Ga0070683_1000002197 340
133 3300005331 Ga0070670_100021126 Ga0070670_1000211266 340
134 3300005344 Ga0070661_100019594 Ga0070661_1000195944 340
135 3300005353 Ga0070669_100097632 Ga0070669_1000976322 340
136 3300005354 Ga0070675_100041425 Ga0070675_1000414253 340
137 3300005356 Ga0070674_100361199 Ga0070674_1003611991 340
138 3300005434 Ga0070709_10098283 Ga0070709_100982832 340
139 3300005436 Ga0070713_100127070 Ga0070713_1001270703 340
140 3300005455 Ga0070663_100019435 Ga0070663_1000194353 340
141 3300005471 Ga0070698_100131060 Ga0070698_1001310601 340
142 3300005471 Ga0070698_100292779 Ga0070698_1002927792 340
143 3300005518 Ga0070699_100017361 Ga0070699_1000173614 340
144 3300005535 Ga0070684_100004177 Ga0070684_1000041775 340
145 3300005564 Ga0070664_100005403 Ga0070664_1000054034 340
146 3300005617 Ga0068859_100033089 Ga0068859_1000330893 340
147 3300005617 Ga0068859_100399926 Ga0068859_1003999262 340
148 3300005618 Ga0068864_100013647 Ga0068864_1000136476 340
149 3300005618 Ga0068864_100095356 Ga0068864_1000953561 340
150 3300005718 Ga0068866_10001191 Ga0068866_100011917 340
151 3300005719 Ga0068861_100258453 Ga0068861_1002584532 340
152 3300005842 Ga0068858_100009818 Ga0068858_1000098186 340
153 3300005842 Ga0068858_100034388 Ga0068858_1000343885 340
154 3300005842 Ga0068858_100135852 Ga0068858_1001358522 340
155 3300005843 Ga0068860_100304871 Ga0068860_1003048712 340
156 3300005937 Ga0081455_10021838 Ga0081455_100218384 340
157 3300005983 Ga0081540_1007130 Ga0081540_10071305 340
158 3300006028 Ga0070717_10046772 Ga0070717_100467722 340
159 3300006844 Ga0075428_100070245 Ga0075428_1000702453 340
160 3300006871 Ga0075434_100005959 Ga0075434_1000059597 340
161 3300006871 Ga0075434_100014805 Ga0075434_1000148053 340
162 3300006871 Ga0075434_100171329 Ga0075434_1001713292 340
163 3300006881 Ga0068865_100127798 Ga0068865_1001277982 340
164 3300006914 Ga0075436_100000002 Ga0075436_100000002227 340
165 3300006914 Ga0075436_100014436 Ga0075436_1000144363 340
166 3300006914 Ga0075436_100038172 Ga0075436_1000381722 340
167 3300006914 Ga0075436_100122792 Ga0075436_1001227922 340
168 3300006914 Ga0075436_100141285 Ga0075436_1001412852 340
169 3300006931 Ga0097620_100033089 Ga0097620_1000330893 340
170 3300006931 Ga0097620_100399918 Ga0097620_1003999182 340
171 3300007076 Ga0075435_100000346 Ga0075435_10000034622 340
172 3300007076 Ga0075435_100005602 Ga0075435_1000056029 340
173 3300007076 Ga0075435_100015759 Ga0075435_1000157594 340
174 3300009093 Ga0105240_10010389 Ga0105240_1001038911 340
175 3300009094 Ga0111539_10111128 Ga0111539_101111283 340
176 3300009098 Ga0105245_10010419 Ga0105245_100104194 340
177 3300009147 Ga0114129_10039725 Ga0114129_100397254 340
178 3300009147 Ga0114129_10047663 Ga0114129_100476633 340
179 3300009177 Ga0105248_10005114 Ga0105248_100051148 340
180 3300009177 Ga0105248_10025773 Ga0105248_100257734 340
181 3300009177 Ga0105248_10161866 Ga0105248_101618663 340
182 3300013296 Ga0157374_10072706 Ga0157374_100727063 340
183 3300013296 Ga0157374_10183090 Ga0157374_101830903 340
184 3300013306 Ga0163162_10215887 Ga0163162_102158872 340
185 3300013308 Ga0157375_10118012 Ga0157375_101180122 340
186 3300013308 Ga0157375_10319371 Ga0157375_103193712 340
187 3300014325 Ga0163163_10014932 Ga0163163_100149326 340
188 3300014969 Ga0157376_10086181 Ga0157376_100861814 340
189 3300014969 Ga0157376_10273387 Ga0157376_102733872 340
190 3300025903 Ga0207680_10032963 Ga0207680_100329633 340
191 3300025906 Ga0207699_10057965 Ga0207699_100579652 340
192 3300025906 Ga0207699_10108006 Ga0207699_101080062 340
193 3300025907 Ga0207645_10114258 Ga0207645_101142582 340
194 3300025920 Ga0207649_10006738 Ga0207649_100067384 340
195 3300025923 Ga0207681_10006478 Ga0207681_100064782 340
196 3300025925 Ga0207650_10075745 Ga0207650_100757453 340
197 3300025927 Ga0207687_10031659 Ga0207687_100316592 340
198 3300025928 Ga0207700_10105323 Ga0207700_101053232 340
199 3300025932 Ga0207690_10025257 Ga0207690_100252573 340
200 3300025939 Ga0207665_10052450 Ga0207665_100524502 340
201 3300025940 Ga0207691_10167848 Ga0207691_101678482 340
202 3300025941 Ga0207711_10022810 Ga0207711_100228102 340
203 3300025941 Ga0207711_10354195 Ga0207711_103541952 340
204 3300025942 Ga0207689_10169595 Ga0207689_101695952 340
205 3300025944 Ga0207661_10005019 Ga0207661_100050197 340
206 3300025945 Ga0207679_10080000 Ga0207679_100800002 340
207 3300025961 Ga0207712_10097210 Ga0207712_100972102 340
208 3300026035 Ga0207703_10026803 Ga0207703_100268032 340
209 3300026035 Ga0207703_10045454 Ga0207703_100454543 340
210 3300026095 Ga0207676_10012097 Ga0207676_100120972 340
211 3300026095 Ga0207676_10090997 Ga0207676_100909971 340
212 3300027907 Ga0207428_10023970 Ga0207428_100239703 340
213 3300028379 Ga0268266_10022544 Ga0268266_100225442 340
214 3300028381 Ga0268264_10139070 Ga0268264_101390702 340
215 3300028381 Ga0268264_10323779 Ga0268264_103237791 340
216 3300028381 Ga0268264_10370826 Ga0268264_103708261 340
217 3300031238 Ga0265332_10065466 Ga0265332_100654661 340
218 3300031249 Ga0265339_10016804 Ga0265339_100168046 340
219 3300031731 Ga0307405_10084624 Ga0307405_100846242 340
220 3300031911 Ga0307412_10187716 Ga0307412_101877161 340
221 3300031995 Ga0307409_100094124 Ga0307409_1000941243 340
222 3300031995 Ga0307409_100187555 Ga0307409_1001875552 340
223 3300032002 Ga0307416_100006624 Ga0307416_1000066242 340
224 3300032005 Ga0307411_10026713 Ga0307411_100267132 340
225 3300032005 Ga0307411_10061367 Ga0307411_100613673 340
226 3300032126 Ga0307415_100034503 Ga0307415_1000345033 340
227 3300035171 Ga0373946_0002728 Ga0373946_0002728_2095_3117 340
228 3300036401 Ga0373937_0002195 Ga0373937_0002195_6312_7334 340
229 3300036401 Ga0373937_0208778 Ga0373937_0208778_129_1151 340
230 3300036401 Ga0373937_0335613 Ga0373937_0335613_231_1253 340
231 3300045976 Ga0466967_0406711 Ga0466967_0406711_216_1241 340
232 3300046463 Ga0495653_0163278 Ga0495653_0163278_154_1179 340
233 3300046472 Ga0495580_0144140 Ga0495580_0144140_201_1223 340
234 3300046516 Ga0495628_0101905 Ga0495628_0101905_461_1483 340
235 3300046517 Ga0495630_0023677 Ga0495630_0023677_602_1624 340
236 3300046543 Ga0495645_0009063 Ga0495645_0009063_5379_6401 340
237 3300046683 Ga0495658_0064983 Ga0495658_0064983_205_1230 340
238 3300046684 Ga0495669_0000860 Ga0495669_0000860_1725_2747 340
239 3300046689 Ga0495613_0014767 Ga0495613_0014767_4701_5723 340
240 3300047317 Ga0495604_0068058 Ga0495604_0068058_592_1614 340
241 3300047319 Ga0495674_0046843 Ga0495674_0046843_1377_2399 340
242 3300047471 Ga0495684_0000549 Ga0495684_0000549_1702_2724 340
243 3300048088 Ga0495602_0172286 Ga0495602_0172286_614_1636 340
244 3300048907 Ga0496104_0012179 Ga0496104_0012179_1984_3015 340
245 3300048907 Ga0496104_0102223 Ga0496104_0102223_732_1757 340
246 3300048907 Ga0496104_0143115 Ga0496104_0143115_676_1701 340
247 3300048908 Ga0496105_0010021 Ga0496105_0010021_2864_3895 340
248 3300048911 Ga0496108_0001066 Ga0496108_0001066_4014_5045 340
249 3300048912 Ga0496109_0000525 Ga0496109_0000525_4467_5498 340
250 3300048913 Ga0496110_0001750 Ga0496110_0001750_1120_2151 340
251 3300048914 Ga0496111_0000267 Ga0496111_0000267_5016_6047 340
252 3300048915 Ga0496112_0004758 Ga0496112_0004758_6048_7079 340
253 3300048915 Ga0496112_0034440 Ga0496112_0034440_3671_4696 340
254 3300048916 Ga0496113_0019024 Ga0496113_0019024_2115_3140 340
255 3300048916 Ga0496113_0071872 Ga0496113_0071872_1322_2353 340
256 3300049573 Ga0501037_0181393 Ga0501037_0181393_360_1385 340
257 3300049583 Ga0501067_0019332 Ga0501067_0019332_292_1329 340
258 3300049823 Ga0501044_0029063 Ga0501044_0029063_768_1793 340
259 3300050507 nmdc:mga05p37_10494_c2 nmdc:mga05p37_10494_c2_5578_6603 340
260 3300050507 nmdc:mga05p37_31291_c1 nmdc:mga05p37_31291_c1_4772_5797 340
261 3300050507 nmdc:mga05p37_60298_c1 nmdc:mga05p37_60298_c1_206_1231 340
262 3300050508 nmdc:mga09592_312631_c1 nmdc:mga09592_312631_c1_52_1077 340
263 3300050510 nmdc:mga06r32_96180_c1 nmdc:mga06r32_96180_c1_867_1895 340
264 3300050511 nmdc:mga08y16_312777_c1 nmdc:mga08y16_312777_c1_61_1086 340
265 3300050512 nmdc:mga0n895_119105_c1 nmdc:mga0n895_119105_c1_1187_2212 340
266 3300050512 nmdc:mga0n895_35_c1 nmdc:mga0n895_35_c1_5267_6292 340
267 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_5267_6292 340
268 3300050513 nmdc:mga0rr50_3767_c1 nmdc:mga0rr50_3767_c1_6109_7134 340
269 3300050514 nmdc:mga08x19_755_c1 nmdc:mga08x19_755_c1_14393_15418 340
270 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_152993_154018 340
271 3300053085 Ga0495619_0003759 Ga0495619_0003759_8455_9477 340
272 3300053085 Ga0495619_0035218 Ga0495619_0035218_1151_2176 340
273 3300059421 Ga0590071_001581 Ga0590071_001581_3058_4089 340
274 3300059424 Ga0590075_000627 Ga0590075_000627_407_1438 340
275 3300059426 Ga0590077_000498 Ga0590077_000498_4517_5548 340
276 3300005331 Ga0070670_100120931 Ga0070670_1001209312 341
277 3300005335 Ga0070666_10007292 Ga0070666_100072926 341
278 3300005335 Ga0070666_10078652 Ga0070666_100786522 341
279 3300005338 Ga0068868_100000672 Ga0068868_10000067216 341
280 3300005338 Ga0068868_100020771 Ga0068868_1000207712 341
281 3300005338 Ga0068868_100138296 Ga0068868_1001382962 341
282 3300005344 Ga0070661_100008061 Ga0070661_1000080617 341
283 3300005353 Ga0070669_100220675 Ga0070669_1002206752 341
284 3300005356 Ga0070674_100075450 Ga0070674_1000754502 341
285 3300005364 Ga0070673_100008245 Ga0070673_1000082454 341
286 3300005364 Ga0070673_100066244 Ga0070673_1000662443 341
287 3300005364 Ga0070673_100249254 Ga0070673_1002492541 341
288 3300005366 Ga0070659_100015437 Ga0070659_1000154374 341
289 3300005367 Ga0070667_100023077 Ga0070667_1000230772 341
290 3300005441 Ga0070700_100319731 Ga0070700_1003197311 341
291 3300005458 Ga0070681_10023707 Ga0070681_100237073 341
292 3300005458 Ga0070681_10140535 Ga0070681_101405352 341
293 3300005543 Ga0070672_100003279 Ga0070672_10000327910 341
294 3300005544 Ga0070686_100011648 Ga0070686_1000116485 341
295 3300005548 Ga0070665_100011352 Ga0070665_1000113526 341
296 3300005548 Ga0070665_100023727 Ga0070665_1000237273 341
297 3300005563 Ga0068855_100243156 Ga0068855_1002431562 341
298 3300005564 Ga0070664_100001996 Ga0070664_1000019963 341
299 3300005617 Ga0068859_100050677 Ga0068859_1000506773 341
300 3300005617 Ga0068859_100308187 Ga0068859_1003081872 341
301 3300005618 Ga0068864_100001251 Ga0068864_10000125116 341
302 3300005618 Ga0068864_100006868 Ga0068864_1000068685 341
303 3300005834 Ga0068851_10064677 Ga0068851_100646772 341
304 3300005841 Ga0068863_100023057 Ga0068863_1000230573 341
305 3300005841 Ga0068863_100049767 Ga0068863_1000497672 341
306 3300005841 Ga0068863_100372639 Ga0068863_1003726392 341
307 3300005842 Ga0068858_100051993 Ga0068858_1000519933 341
308 3300005842 Ga0068858_100215491 Ga0068858_1002154912 341
309 3300005985 Ga0081539_10024630 Ga0081539_100246303 341
310 3300006237 Ga0097621_100007914 Ga0097621_1000079147 341
311 3300006237 Ga0097621_100007951 Ga0097621_1000079516 341
312 3300006237 Ga0097621_100013125 Ga0097621_1000131254 341
313 3300006237 Ga0097621_100031616 Ga0097621_1000316162 341
314 3300006358 Ga0068871_100000863 Ga0068871_1000008636 341
315 3300006358 Ga0068871_100008275 Ga0068871_1000082754 341
316 3300006358 Ga0068871_100043732 Ga0068871_1000437324 341
317 3300006358 Ga0068871_100161676 Ga0068871_1001616763 341
318 3300006358 Ga0068871_100166565 Ga0068871_1001665652 341
319 3300006846 Ga0075430_100000555 Ga0075430_1000005554 341
320 3300006847 Ga0075431_100020182 Ga0075431_1000201823 341
321 3300006847 Ga0075431_100034207 Ga0075431_1000342075 341
322 3300006852 Ga0075433_10031264 Ga0075433_100312644 341
323 3300006871 Ga0075434_100029208 Ga0075434_1000292083 341
324 3300006871 Ga0075434_100048927 Ga0075434_1000489272 341
325 3300006871 Ga0075434_100258295 Ga0075434_1002582951 341
326 3300006881 Ga0068865_100004795 Ga0068865_1000047954 341
327 3300006881 Ga0068865_100078750 Ga0068865_1000787503 341
328 3300006914 Ga0075436_100134116 Ga0075436_1001341162 341
329 3300006931 Ga0097620_100050677 Ga0097620_1000506773 341
330 3300006931 Ga0097620_100308169 Ga0097620_1003081692 341
331 3300007076 Ga0075435_100010740 Ga0075435_1000107404 341
332 3300007076 Ga0075435_100033922 Ga0075435_1000339224 341
333 3300009094 Ga0111539_10004361 Ga0111539_100043616 341
334 3300009094 Ga0111539_10026321 Ga0111539_100263213 341
335 3300009098 Ga0105245_10018240 Ga0105245_100182404 341
336 3300009098 Ga0105245_10094137 Ga0105245_100941373 341
337 3300009147 Ga0114129_10014211 Ga0114129_100142117 341
338 3300009148 Ga0105243_10422857 Ga0105243_104228572 341
339 3300009176 Ga0105242_10006628 Ga0105242_100066284 341
340 3300009177 Ga0105248_10033272 Ga0105248_100332723 341
341 3300009177 Ga0105248_10069483 Ga0105248_100694834 341
342 3300009177 Ga0105248_10073651 Ga0105248_100736512 341
343 3300009177 Ga0105248_10075284 Ga0105248_100752843 341
344 3300009177 Ga0105248_10269576 Ga0105248_102695762 341
345 3300013105 Ga0157369_10294993 Ga0157369_102949931 341
346 3300013297 Ga0157378_10015600 Ga0157378_100156005 341
347 3300013306 Ga0163162_10004597 Ga0163162_100045977 341
348 3300013306 Ga0163162_10148861 Ga0163162_101488611 341
349 3300013306 Ga0163162_10440142 Ga0163162_104401422 341
350 3300013307 Ga0157372_10327434 Ga0157372_103274342 341
351 3300013307 Ga0157372_10437784 Ga0157372_104377842 341
352 3300013308 Ga0157375_10030460 Ga0157375_100304602 341
353 3300013308 Ga0157375_10056413 Ga0157375_100564132 341
354 3300013308 Ga0157375_10362254 Ga0157375_103622542 341
355 3300014325 Ga0163163_10007028 Ga0163163_100070284 341
356 3300014325 Ga0163163_10115054 Ga0163163_101150543 341
357 3300014325 Ga0163163_10186714 Ga0163163_101867142 341
358 3300014326 Ga0157380_10071933 Ga0157380_100719332 341
359 3300014969 Ga0157376_10037758 Ga0157376_100377584 341
360 3300014969 Ga0157376_10113077 Ga0157376_101130772 341
361 3300014969 Ga0157376_10216863 Ga0157376_102168632 341
362 3300014969 Ga0157376_10446535 Ga0157376_104465351 341
363 3300017792 Ga0163161_10267393 Ga0163161_102673932 341
364 3300025903 Ga0207680_10004658 Ga0207680_100046582 341
365 3300025912 Ga0207707_10168455 Ga0207707_101684551 341
366 3300025920 Ga0207649_10010211 Ga0207649_100102113 341
367 3300025922 Ga0207646_10072856 Ga0207646_100728563 341
368 3300025925 Ga0207650_10000845 Ga0207650_1000084510 341
369 3300025926 Ga0207659_10009805 Ga0207659_100098054 341
370 3300025927 Ga0207687_10052187 Ga0207687_100521872 341
371 3300025931 Ga0207644_10002155 Ga0207644_1000215511 341
372 3300025932 Ga0207690_10205745 Ga0207690_102057452 341
373 3300025934 Ga0207686_10004844 Ga0207686_100048445 341
374 3300025934 Ga0207686_10011649 Ga0207686_100116492 341
375 3300025934 Ga0207686_10043936 Ga0207686_100439362 341
376 3300025935 Ga0207709_10265220 Ga0207709_102652202 341
377 3300025937 Ga0207669_10129025 Ga0207669_101290251 341
378 3300025938 Ga0207704_10007156 Ga0207704_100071562 341
379 3300025940 Ga0207691_10020940 Ga0207691_100209403 341
380 3300025940 Ga0207691_10029528 Ga0207691_100295283 341
381 3300025941 Ga0207711_10019972 Ga0207711_100199723 341
382 3300025941 Ga0207711_10027546 Ga0207711_100275462 341
383 3300025941 Ga0207711_10056074 Ga0207711_100560743 341
384 3300025960 Ga0207651_10004258 Ga0207651_100042587 341
385 3300025986 Ga0207658_10020848 Ga0207658_100208483 341
386 3300026023 Ga0207677_10001276 Ga0207677_100012767 341
387 3300026023 Ga0207677_10038732 Ga0207677_100387322 341
388 3300026023 Ga0207677_10074822 Ga0207677_100748222 341
389 3300026035 Ga0207703_10052897 Ga0207703_100528973 341
390 3300026035 Ga0207703_10147339 Ga0207703_101473392 341
391 3300026035 Ga0207703_10175334 Ga0207703_101753342 341
392 3300026035 Ga0207703_10187849 Ga0207703_101878492 341
393 3300026088 Ga0207641_10003438 Ga0207641_100034385 341
394 3300026088 Ga0207641_10053618 Ga0207641_100536183 341
395 3300026089 Ga0207648_10027066 Ga0207648_100270664 341
396 3300026089 Ga0207648_10297556 Ga0207648_102975562 341
397 3300026095 Ga0207676_10000597 Ga0207676_1000059715 341
398 3300027907 Ga0207428_10022551 Ga0207428_100225514 341
399 3300035120 Ga0373957_0016697 Ga0373957_0016697_1088_2119 341
400 3300035172 Ga0373955_0048692 Ga0373955_0048692_200_1231 341
401 3300035242 Ga0373962_0012884 Ga0373962_0012884_105_1133 341
402 3300036401 Ga0373937_0026531 Ga0373937_0026531_2492_3523 341
403 3300036401 Ga0373937_0080256 Ga0373937_0080256_842_1870 341
404 3300042156 Ga0439446_0001344 Ga0439446_0001344_1547_2578 341
405 3300042435 Ga0439434_0008285 Ga0439434_0008285_1374_2405 341
406 3300046454 Ga0495592_0012152 Ga0495592_0012152_3597_4628 341
407 3300046459 Ga0495629_0048272 Ga0495629_0048272_1792_2823 341
408 3300046459 Ga0495629_0064427 Ga0495629_0064427_1316_2347 341
409 3300046463 Ga0495653_0123680 Ga0495653_0123680_540_1571 341
410 3300046511 Ga0495608_0038100 Ga0495608_0038100_180_1211 341
411 3300046514 Ga0495618_0028265 Ga0495618_0028265_1730_2761 341
412 3300046517 Ga0495630_0293842 Ga0495630_0293842_163_1194 341
413 3300046533 Ga0495640_0145776 Ga0495640_0145776_370_1401 341
414 3300046535 Ga0495586_0074284 Ga0495586_0074284_490_1521 341
415 3300046559 Ga0495667_0006730 Ga0495667_0006730_1938_2969 341
416 3300046675 Ga0495657_0011406 Ga0495657_0011406_1907_2938 341
417 3300046681 Ga0495647_0018577 Ga0495647_0018577_734_1762 341
418 3300046681 Ga0495647_0048193 Ga0495647_0048193_550_1575 341
419 3300046683 Ga0495658_0020183 Ga0495658_0020183_1789_2820 341
420 3300046683 Ga0495658_0042361 Ga0495658_0042361_881_1909 341
421 3300046689 Ga0495613_0155324 Ga0495613_0155324_543_1574 341
422 3300047319 Ga0495674_0013025 Ga0495674_0013025_3040_4071 341
423 3300047471 Ga0495684_0128657 Ga0495684_0128657_547_1578 341
424 3300048904 Ga0496101_0008114 Ga0496101_0008114_3492_4517 341
425 3300048905 Ga0496102_0269264 Ga0496102_0269264_527_1555 341
426 3300048907 Ga0496104_0103189 Ga0496104_0103189_1083_2114 341
427 3300048909 Ga0496106_0061878 Ga0496106_0061878_1175_2200 341
428 3300048910 Ga0496107_0023872 Ga0496107_0023872_2148_3173 341
429 3300048912 Ga0496109_0070364 Ga0496109_0070364_696_1724 341
430 3300048912 Ga0496109_0292021 Ga0496109_0292021_453_1481 341
431 3300048917 Ga0496114_0015720 Ga0496114_0015720_2477_3502 341
432 3300048917 Ga0496114_0043177 Ga0496114_0043177_2327_3355 341
433 3300050507 nmdc:mga05p37_4536_c1 nmdc:mga05p37_4536_c1_1003_2031 341
434 3300050508 nmdc:mga09592_20467_c1 nmdc:mga09592_20467_c1_736_1773 341
435 3300050509 nmdc:mga0qj67_1124_c1 nmdc:mga0qj67_1124_c1_6474_7511 341
436 3300050510 nmdc:mga06r32_26504_c1 nmdc:mga06r32_26504_c1_585_1622 341
437 3300050511 nmdc:mga08y16_18874_c1 nmdc:mga08y16_18874_c1_3725_4753 341
438 3300050511 nmdc:mga08y16_8367_c1 nmdc:mga08y16_8367_c1_5341_6369 341
439 3300050512 nmdc:mga0n895_12795_c1 nmdc:mga0n895_12795_c1_1047_2078 341
440 3300050512 nmdc:mga0n895_62939_c1 nmdc:mga0n895_62939_c1_672_1697 341
441 3300050513 nmdc:mga0rr50_20239_c1 nmdc:mga0rr50_20239_c1_522_1547 341
442 3300050514 nmdc:mga08x19_123564_c1 nmdc:mga08x19_123564_c1_594_1625 341
443 3300050515 nmdc:mga0a205_137170_c1 nmdc:mga0a205_137170_c1_480_1511 341
444 3300053077 Ga0495601_0030691 Ga0495601_0030691_1080_2108 341
445 3300053077 Ga0495601_0193033 Ga0495601_0193033_88_1116 341
446 3300005329 Ga0070683_100052357 Ga0070683_1000523573 342
447 3300005471 Ga0070698_100392952 Ga0070698_1003929522 342
448 3300005937 Ga0081455_10099872 Ga0081455_100998722 342
449 3300006237 Ga0097621_100001657 Ga0097621_10000165713 342
450 3300006237 Ga0097621_100122510 Ga0097621_1001225102 342
451 3300006358 Ga0068871_100001734 Ga0068871_10000173415 342
452 3300013297 Ga0157378_10007412 Ga0157378_100074129 342
453 3300014969 Ga0157376_10067576 Ga0157376_100675762 342
454 3300028800 Ga0265338_10003779 Ga0265338_100037792 342
455 3300031238 Ga0265332_10023877 Ga0265332_100238773 342
456 3300031239 Ga0265328_10045676 Ga0265328_100456762 342
457 3300031249 Ga0265339_10000204 Ga0265339_1000020417 342
458 3300031250 Ga0265331_10081078 Ga0265331_100810782 342
459 3300031344 Ga0265316_10048099 Ga0265316_100480993 342
460 3300031665 Ga0316575_10052205 Ga0316575_100522051 342
461 3300031711 Ga0265314_10002635 Ga0265314_1000263516 342
462 3300031712 Ga0265342_10019600 Ga0265342_100196003 342
463 3300031727 Ga0316576_10005853 Ga0316576_100058532 342
464 3300032137 Ga0316585_10002014 Ga0316585_100020142 342
465 3300035692 Ga0373935_0159388 Ga0373935_0159388_105_1145 342
466 3300035725 Ga0373947_0190887 Ga0373947_0190887_35_1075 342
467 3300036401 Ga0373937_0013603 Ga0373937_0013603_276_1316 342
468 3300036647 Ga0316582_0037884 Ga0316582_0037884_1747_2805 342
469 3300036712 Ga0316584_0070788 Ga0316584_0070788_1050_2108 342
470 3300037068 Ga0373925_0028280 Ga0373925_0028280_817_1857 342
471 3300049741 Ga0501079_0150413 Ga0501079_0150413_67_1098 342
472 3300049743 Ga0501081_0133817 Ga0501081_0133817_610_1644 342
473 3300005334 Ga0068869_100155207 Ga0068869_1001552072 343
474 3300005364 Ga0070673_100000212 Ga0070673_10000021212 343
475 3300005406 Ga0070703_10000740 Ga0070703_100007408 343
476 3300005467 Ga0070706_100000820 Ga0070706_1000008208 343
477 3300005471 Ga0070698_100000063 Ga0070698_10000006324 343
478 3300005471 Ga0070698_100074006 Ga0070698_1000740062 343
479 3300005536 Ga0070697_100044328 Ga0070697_1000443281 343
480 3300025885 Ga0207653_10000296 Ga0207653_1000029625 343
481 3300025910 Ga0207684_10004650 Ga0207684_100046508 343
482 3300025960 Ga0207651_10000458 Ga0207651_100004585 343
483 3300005440 Ga0070705_100000238 Ga0070705_10000023825 344
484 3300005468 Ga0070707_100000107 Ga0070707_10000010762 344
485 3300005842 Ga0068858_100010536 Ga0068858_1000105364 344
486 3300005843 Ga0068860_100074397 Ga0068860_1000743973 344
487 3300006844 Ga0075428_100259575 Ga0075428_1002595752 344
488 3300006852 Ga0075433_10141572 Ga0075433_101415722 344
489 3300006931 Ga0097620_100105786 Ga0097620_1001057864 344
490 3300009147 Ga0114129_10014362 Ga0114129_100143625 344
491 3300009177 Ga0105248_10007643 Ga0105248_100076432 344
492 3300014968 Ga0157379_10014375 Ga0157379_100143753 344
493 3300025922 Ga0207646_10000543 Ga0207646_1000054320 344
494 3300025941 Ga0207711_10183840 Ga0207711_101838402 344
495 3300026035 Ga0207703_10013597 Ga0207703_100135972 344
496 3300028381 Ga0268264_10033695 Ga0268264_100336953 344
497 3300042876 Ga0451577_0002197 Ga0451577_0002197_21978_23030 344
498 3300044712 Ga0453684_0000809 Ga0453684_0000809_99487_100539 344
499 3300050507 nmdc:mga05p37_35468_c1 nmdc:mga05p37_35468_c1_1194_2261 344
500 3300050515 nmdc:mga0a205_37588_c1 nmdc:mga0a205_37588_c1_2947_3984 344
501 3300060353 Ga0501082_0234020 Ga0501082_0234020_97_1155 344
502 3300005327 Ga0070658_10013778 Ga0070658_100137784 345
503 3300006844 Ga0075428_100089480 Ga0075428_1000894802 345
504 3300009147 Ga0114129_10021276 Ga0114129_100212764 345
505 3300009148 Ga0105243_10149516 Ga0105243_101495162 345
506 3300025912 Ga0207707_10147929 Ga0207707_101479292 345
507 3300032133 Ga0316583_10000278 Ga0316583_100002786 345
508 3300046683 Ga0495658_0090000 Ga0495658_0090000_629_1711 345
509 3300050507 nmdc:mga05p37_26723_c1 nmdc:mga05p37_26723_c1_3976_5046 345
510 3300005329 Ga0070683_100160702 Ga0070683_1001607022 346
511 3300005344 Ga0070661_100003076 Ga0070661_1000030769 346
512 3300005539 Ga0068853_100005020 Ga0068853_1000050209 346
513 3300005563 Ga0068855_100009510 Ga0068855_1000095102 346
514 3300005614 Ga0068856_100018092 Ga0068856_1000180923 346
515 3300005616 Ga0068852_100002149 Ga0068852_10000214910 346
516 3300009093 Ga0105240_10058841 Ga0105240_100588414 346
517 3300009174 Ga0105241_10003115 Ga0105241_1000311510 346
518 3300009545 Ga0105237_10009782 Ga0105237_100097829 346
519 3300009551 Ga0105238_10006697 Ga0105238_100066973 346
520 3300010375 Ga0105239_10013868 Ga0105239_100138681 346
521 3300010375 Ga0105239_10212518 Ga0105239_102125182 346
522 3300013105 Ga0157369_10163394 Ga0157369_101633942 346
523 3300013105 Ga0157369_10253723 Ga0157369_102537232 346
524 3300025913 Ga0207695_10001120 Ga0207695_1000112034 346
525 3300025914 Ga0207671_10005934 Ga0207671_100059343 346
526 3300025920 Ga0207649_10002341 Ga0207649_100023413 346
527 3300025924 Ga0207694_10000313 Ga0207694_1000031334 346
528 3300025944 Ga0207661_10129696 Ga0207661_101296962 346
529 3300026041 Ga0207639_10000055 Ga0207639_100000553 346
530 3300026078 Ga0207702_10002856 Ga0207702_100028562 346
531 3300005530 Ga0070679_100364344 Ga0070679_1003643442 347
532 3300005546 Ga0070696_100000011 Ga0070696_10000001131 347
533 3300005563 Ga0068855_100155676 Ga0068855_1001556764 347
534 3300013105 Ga0157369_10134210 Ga0157369_101342102 347
535 3300025917 Ga0207660_10086904 Ga0207660_100869043 347
536 3300037466 Ga0395898_0083408 Ga0395898_0083408_1957_3009 347
537 3300045049 Ga0466959_0055610 Ga0466959_0055610_1471_2580 347
538 3300045976 Ga0466967_0108084 Ga0466967_0108084_1401_2510 347
539 3300048918 Ga0496115_0116364 Ga0496115_0116364_69_1157 347
540 3300005329 Ga0070683_100000210 Ga0070683_10000021014 348
541 3300005329 Ga0070683_100008686 Ga0070683_1000086863 348
542 3300005331 Ga0070670_100002071 Ga0070670_10000207113 348
543 3300005334 Ga0068869_100000308 Ga0068869_10000030819 348
544 3300005338 Ga0068868_100000046 Ga0068868_10000004622 348
545 3300005338 Ga0068868_100004012 Ga0068868_1000040124 348
546 3300005338 Ga0068868_100026074 Ga0068868_1000260742 348
547 3300005339 Ga0070660_100017822 Ga0070660_1000178223 348
548 3300005355 Ga0070671_100006477 Ga0070671_10000647710 348
549 3300005355 Ga0070671_100093079 Ga0070671_1000930793 348
550 3300005367 Ga0070667_100000728 Ga0070667_10000072810 348
551 3300005367 Ga0070667_100157327 Ga0070667_1001573272 348
552 3300005457 Ga0070662_100231624 Ga0070662_1002316242 348
553 3300005458 Ga0070681_10001472 Ga0070681_1000147222 348
554 3300005530 Ga0070679_100027214 Ga0070679_1000272145 348
555 3300005535 Ga0070684_100001658 Ga0070684_10000165816 348
556 3300005535 Ga0070684_100003273 Ga0070684_1000032732 348
557 3300005548 Ga0070665_100205549 Ga0070665_1002055492 348
558 3300005563 Ga0068855_100025821 Ga0068855_1000258214 348
559 3300005563 Ga0068855_100218230 Ga0068855_1002182302 348
560 3300005564 Ga0070664_100093085 Ga0070664_1000930852 348
561 3300005577 Ga0068857_100000448 Ga0068857_10000044818 348
562 3300005577 Ga0068857_100032648 Ga0068857_1000326485 348
563 3300005614 Ga0068856_100010522 Ga0068856_1000105226 348
564 3300005614 Ga0068856_100028116 Ga0068856_1000281165 348
565 3300005616 Ga0068852_100011908 Ga0068852_1000119084 348
566 3300005616 Ga0068852_100044710 Ga0068852_1000447102 348
567 3300005616 Ga0068852_100097860 Ga0068852_1000978603 348
568 3300005617 Ga0068859_100013491 Ga0068859_1000134918 348
569 3300005834 Ga0068851_10008480 Ga0068851_100084804 348
570 3300005834 Ga0068851_10056819 Ga0068851_100568192 348
571 3300005834 Ga0068851_10074448 Ga0068851_100744481 348
572 3300005841 Ga0068863_100022882 Ga0068863_1000228823 348
573 3300005843 Ga0068860_100001032 Ga0068860_10000103222 348
574 3300005843 Ga0068860_100179456 Ga0068860_1001794562 348
575 3300006028 Ga0070717_10007402 Ga0070717_100074026 348
576 3300006237 Ga0097621_100006730 Ga0097621_1000067305 348
577 3300006237 Ga0097621_100277190 Ga0097621_1002771902 348
578 3300006358 Ga0068871_100005075 Ga0068871_1000050754 348
579 3300006931 Ga0097620_100013490 Ga0097620_1000134908 348
580 3300009093 Ga0105240_10000663 Ga0105240_1000066312 348
581 3300009093 Ga0105240_10019935 Ga0105240_100199356 348
582 3300009093 Ga0105240_10102912 Ga0105240_101029121 348
583 3300009098 Ga0105245_10002815 Ga0105245_1000281510 348
584 3300009098 Ga0105245_10037780 Ga0105245_100377804 348
585 3300009098 Ga0105245_10058454 Ga0105245_100584543 348
586 3300009101 Ga0105247_10004217 Ga0105247_100042173 348
587 3300009174 Ga0105241_10005170 Ga0105241_100051708 348
588 3300009174 Ga0105241_10014948 Ga0105241_100149485 348
589 3300009174 Ga0105241_10068995 Ga0105241_100689952 348
590 3300009177 Ga0105248_10010289 Ga0105248_1001028912 348
591 3300009545 Ga0105237_10007213 Ga0105237_100072139 348
592 3300009551 Ga0105238_10000657 Ga0105238_1000065713 348
593 3300009551 Ga0105238_10009153 Ga0105238_100091532 348
594 3300009553 Ga0105249_10025755 Ga0105249_100257552 348
595 3300010375 Ga0105239_10010212 Ga0105239_1001021210 348
596 3300013105 Ga0157369_10031690 Ga0157369_100316905 348
597 3300013105 Ga0157369_10128190 Ga0157369_101281902 348
598 3300013296 Ga0157374_10005560 Ga0157374_100055605 348
599 3300013296 Ga0157374_10036420 Ga0157374_100364202 348
600 3300013296 Ga0157374_10243686 Ga0157374_102436862 348
601 3300013297 Ga0157378_10013370 Ga0157378_100133705 348
602 3300013297 Ga0157378_10014829 Ga0157378_100148293 348
603 3300013297 Ga0157378_10114680 Ga0157378_101146802 348
604 3300013306 Ga0163162_10276676 Ga0163162_102766762 348
605 3300013307 Ga0157372_10021218 Ga0157372_100212185 348
606 3300013307 Ga0157372_10044476 Ga0157372_100444766 348
607 3300013307 Ga0157372_10059882 Ga0157372_100598823 348
608 3300014325 Ga0163163_10009625 Ga0163163_100096252 348
609 3300014968 Ga0157379_10005193 Ga0157379_100051934 348
610 3300014968 Ga0157379_10055488 Ga0157379_100554882 348
611 3300014969 Ga0157376_10000173 Ga0157376_1000017330 348
612 3300021361 Ga0213872_10016026 Ga0213872_100160262 348
613 3300021361 Ga0213872_10062464 Ga0213872_100624642 348
614 3300025321 Ga0207656_10040382 Ga0207656_100403821 348
615 3300025321 Ga0207656_10107340 Ga0207656_101073401 348
616 3300025911 Ga0207654_10000302 Ga0207654_100003023 348
617 3300025911 Ga0207654_10034343 Ga0207654_100343433 348
618 3300025912 Ga0207707_10022700 Ga0207707_100227004 348
619 3300025913 Ga0207695_10000108 Ga0207695_1000010886 348
620 3300025913 Ga0207695_10000253 Ga0207695_1000025337 348
621 3300025913 Ga0207695_10002288 Ga0207695_1000228812 348
622 3300025913 Ga0207695_10013281 Ga0207695_100132814 348
623 3300025914 Ga0207671_10000081 Ga0207671_1000008176 348
624 3300025914 Ga0207671_10228029 Ga0207671_102280292 348
625 3300025919 Ga0207657_10004178 Ga0207657_100041786 348
626 3300025920 Ga0207649_10095043 Ga0207649_100950431 348
627 3300025921 Ga0207652_10114604 Ga0207652_101146041 348
628 3300025924 Ga0207694_10000108 Ga0207694_1000010841 348
629 3300025924 Ga0207694_10003511 Ga0207694_100035116 348
630 3300025924 Ga0207694_10006127 Ga0207694_100061278 348
631 3300025925 Ga0207650_10001335 Ga0207650_1000133514 348
632 3300025927 Ga0207687_10137295 Ga0207687_101372951 348
633 3300025928 Ga0207700_10159209 Ga0207700_101592092 348
634 3300025931 Ga0207644_10002796 Ga0207644_100027969 348
635 3300025933 Ga0207706_10031305 Ga0207706_100313051 348
636 3300025941 Ga0207711_10004803 Ga0207711_100048034 348
637 3300025944 Ga0207661_10002024 Ga0207661_1000202414 348
638 3300025944 Ga0207661_10005751 Ga0207661_100057513 348
639 3300025945 Ga0207679_10063021 Ga0207679_100630212 348
640 3300025949 Ga0207667_10000934 Ga0207667_1000093411 348
641 3300025986 Ga0207658_10000416 Ga0207658_1000041621 348
642 3300026023 Ga0207677_10000025 Ga0207677_1000002541 348
643 3300026023 Ga0207677_10019800 Ga0207677_100198002 348
644 3300026035 Ga0207703_10054904 Ga0207703_100549043 348
645 3300026041 Ga0207639_10004182 Ga0207639_100041827 348
646 3300026078 Ga0207702_10177152 Ga0207702_101771521 348
647 3300026078 Ga0207702_10321670 Ga0207702_103216702 348
648 3300026088 Ga0207641_10010405 Ga0207641_1001040510 348
649 3300026095 Ga0207676_10002620 Ga0207676_100026205 348
650 3300026116 Ga0207674_10001459 Ga0207674_1000145923 348
651 3300026116 Ga0207674_10064007 Ga0207674_100640073 348
652 3300026121 Ga0207683_10003208 Ga0207683_100032082 348
653 3300026142 Ga0207698_10029371 Ga0207698_100293714 348
654 3300026142 Ga0207698_10071935 Ga0207698_100719351 348
655 3300028381 Ga0268264_10000920 Ga0268264_100009204 348
656 3300028666 Ga0265336_10002136 Ga0265336_100021363 348
657 3300028800 Ga0265338_10004819 Ga0265338_1000481919 348
658 3300028800 Ga0265338_10012773 Ga0265338_100127734 348
659 3300031235 Ga0265330_10000852 Ga0265330_1000085217 348
660 3300031235 Ga0265330_10010994 Ga0265330_100109943 348
661 3300031238 Ga0265332_10036136 Ga0265332_100361364 348
662 3300031240 Ga0265320_10018906 Ga0265320_100189063 348
663 3300031240 Ga0265320_10037191 Ga0265320_100371912 348
664 3300031241 Ga0265325_10002033 Ga0265325_100020339 348
665 3300031241 Ga0265325_10010585 Ga0265325_100105855 348
666 3300031241 Ga0265325_10067769 Ga0265325_100677692 348
667 3300031249 Ga0265339_10000029 Ga0265339_10000029118 348
668 3300031249 Ga0265339_10004335 Ga0265339_100043359 348
669 3300031249 Ga0265339_10007186 Ga0265339_1000718610 348
670 3300031344 Ga0265316_10002998 Ga0265316_1000299813 348
671 3300031344 Ga0265316_10010127 Ga0265316_100101279 348
672 3300031344 Ga0265316_10072395 Ga0265316_100723952 348
673 3300031595 Ga0265313_10001614 Ga0265313_1000161414 348
674 3300031595 Ga0265313_10082546 Ga0265313_100825462 348
675 3300031711 Ga0265314_10000139 Ga0265314_1000013969 348
676 3300031711 Ga0265314_10038367 Ga0265314_100383673 348
677 3300031711 Ga0265314_10201278 Ga0265314_102012781 348
678 3300031712 Ga0265342_10001268 Ga0265342_100012685 348
679 3300031712 Ga0265342_10001906 Ga0265342_100019068 348
680 3300031712 Ga0265342_10002378 Ga0265342_1000237814 348
681 3300031712 Ga0265342_10009601 Ga0265342_100096013 348
682 3300036401 Ga0373937_0091727 Ga0373937_0091727_289_1338 348
683 3300039438 Ga0436360_1224841 Ga0436360_1224841_459_1547 348
684 3300039447 Ga0436361_0224417 Ga0436361_0224417_4673_5740 348
685 3300039447 Ga0436361_1193508 Ga0436361_1193508_567_1634 348
686 3300044693 Ga0466961_0146027 Ga0466961_0146027_61_1269 348
687 3300045836 Ga0466958_0158302 Ga0466958_0158302_46_1242 348
688 3300046529 Ga0495652_0021671 Ga0495652_0021671_446_1495 348
689 3300046536 Ga0495587_0004453 Ga0495587_0004453_764_1813 348
690 3300046543 Ga0495645_0001171 Ga0495645_0001171_13271_14320 348
691 3300046678 Ga0495599_0108896 Ga0495599_0108896_275_1324 348
692 3300046689 Ga0495613_0015595 Ga0495613_0015595_1681_2730 348
693 3300046809 Ga0495600_0015924 Ga0495600_0015924_2698_3747 348
694 3300047319 Ga0495674_0294039 Ga0495674_0294039_37_1086 348
695 3300048088 Ga0495602_0078220 Ga0495602_0078220_1388_2437 348
696 3300053077 Ga0495601_0009859 Ga0495601_0009859_4211_5260 348
697 3300000546 LJNas_1000170 LJNas_100017011 349
698 3300005439 Ga0070711_100074236 Ga0070711_1000742362 349
699 3300005548 Ga0070665_100101186 Ga0070665_1001011862 349
700 3300013105 Ga0157369_10251569 Ga0157369_102515693 349
701 3300044694 Ga0466963_0011541 Ga0466963_0011541_4008_5057 349
702 3300046660 Ga0495625_0111003 Ga0495625_0111003_388_1509 349
703 3300046684 Ga0495669_0051264 Ga0495669_0051264_30_1079 349
704 3300048904 Ga0496101_0187028 Ga0496101_0187028_196_1245 349
705 3300048907 Ga0496104_0133652 Ga0496104_0133652_390_1511 349
706 3300048912 Ga0496109_0138565 Ga0496109_0138565_529_1650 349
707 3300048913 Ga0496110_0340171 Ga0496110_0340171_117_1238 349
708 3300048918 Ga0496115_0136729 Ga0496115_0136729_651_1772 349
709 3300048929 Ga0496126_0003640 Ga0496126_0003640_7984_9033 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

50

168

0.95

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

180

329

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9578 23 349
2z01-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus 0.9549 23 349
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9391 20 348
1cli-assembly2.cif.gz_C x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution 0.9384 7 349
2btu-assembly1.cif.gz_A crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution. 0.9361 21 348
ID Description Score Start End Superfamily
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9445 23 173 3.30.1330.10
af_P00967_819_956_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.94 35 172 3.30.1330.10
2z01A01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.938 23 173 3.30.1330.10
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9359 174 348 3.90.650.10
af_G3V918_434_598_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9337 9 170 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A2V7XHW2-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.973 167 348 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A7X9BES8-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9713 89 348 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A355A2Y2-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9702 9 348 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A2V9BNB1-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.97 9 349 GO:0004252
GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0006465
GO:0016020
GO:0046084
AF-A0A7V9UJX9-F1-model_v4 phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (Phosphoribosyl-aminoimidazole synthetase) 0.9644 181 348 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084

Feature Viewer

pLDDT pTM Quality
90.34 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map