F476621
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 434 | 648 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300048916|Ga0496113_0364609|Ga0496113_0364609_195_1055 |
| Length | 286 |
| Sequence | MAKPFNLMPCHAPDTSSIAALMPNEIRQISNRTLSVKFIDRHRKEDTMLDIRKAQHRGNANHGWLHSRHTFSFGHYHDPKQEGFSDLLVINDDRVAPEQGFGTHPHRDMEIMSYVLDGALEHRDSMGTGSVIRPGDVQLMSAGTGVRHSEFNHSKSEPVHFLQIWLVPSVRGAVPRYQQVHFSAAEKRGRLRLIVSPESAQGSLSVHQDARVHAGLFDGAESATLPLAPDRYAYVHVARGSVEVNGERLGQGDGARIRDERTLRFAKGDQAEVLVFDLRPRERPSM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 6 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 7 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 8 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 9 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 10 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 11 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 12 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 13 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 14 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 15 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 18 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 19 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 20 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 21 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 22 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 23 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 24 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 25 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 26 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 27 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 28 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 29 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 30 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 31 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 32 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 33 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 34 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 35 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 36 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 37 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 38 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 39 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 40 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 41 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 42 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 43 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 44 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 45 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 46 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 47 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 48 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 49 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 50 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 51 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 52 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 53 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 54 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 55 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 56 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 57 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 66 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 67 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 83 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 91 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 136 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 137 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 138 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 140 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 142 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 143 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 144 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 145 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 146 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 149 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 150 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 151 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 182 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 260 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 261 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 263 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 264 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 265 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 266 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 267 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 268 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 269 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 271 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 272 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 273 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 274 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 280 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 284 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 292 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 296 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 297 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 298 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 299 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 300 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 301 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 309 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 310 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 386 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 387 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 388 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 391 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 395 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 404 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 405 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 409 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 428 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 429 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 430 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 431 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 432 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 433 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 434 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.82 |
| Metatranscriptomes | 0.71 |
| Isolates | 8.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.84 |
| Nodule | 1.41 |
| Rhizoplane | 3.81 |
| Rhizosphere | 70.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022324 | 3300001979 | Bacteria | 2180 |
| 2 | JGI24739J22299_10001868 | 3300001989 | Bacteria | 8027 |
| 3 | JGI24739J22299_10011512 | 3300001989 | Bacteria | 3264 |
| 4 | JGI24739J22299_10038700 | 3300001989 | Bacteria | 1602 |
| 5 | JGI24735J21928_10006073 | 3300002067 | Bacteria | 3990 |
| 6 | JGI24735J21928_10017531 | 3300002067 | Bacteria | 2214 |
| 7 | JGI24735J21928_10051437 | 3300002067 | Bacteria | 1189 |
| 8 | JGI24735J21928_10118990 | 3300002067 | Bacteria | 760 |
| 9 | JGI25156J39149_1001506 | 3300002705 | Bacteria | 9706 |
| 10 | JGI25156J39149_1004510 | 3300002705 | Bacteria | 4227 |
| 11 | JGI25152J39213_1000073 | 3300002773 | Bacteria | 66515 |
| 12 | JGI25152J39213_1010358 | 3300002773 | Bacteria | 2139 |
| 13 | JGI25150J39212_1000062 | 3300002774 | Bacteria | 64560 |
| 14 | JGI25159J45721_1000212 | 3300002987 | Bacteria | 27374 |
| 15 | JGI25151J46595_10000224 | 3300003187 | Bacteria | 67033 |
| 16 | JGI25151J46595_10000255 | 3300003187 | Bacteria | 62389 |
| 17 | JGI25151J46595_10001680 | 3300003187 | Bacteria | 14497 |
| 18 | JGI25165J46597_1000805 | 3300003214 | Bacteria | 23719 |
| 19 | JGI25153J46596_10000165 | 3300003215 | Bacteria | 66515 |
| 20 | rootL2_10162574 | 3300003322 | Bacteria | 1498 |
| 21 | JGI25160J50197_1000410 | 3300003354 | Bacteria | 27374 |
| 22 | JGI25161J50226_1000688 | 3300003374 | Bacteria | 13295 |
| 23 | Ga0006562J51391_1071781 | 3300003578 | Bacteria | 1011 |
| 24 | Ga0055533_1002359 | 3300003756 | Bacteria | 4325 |
| 25 | Ga0055532_1000036 | 3300003758 | Bacteria | 208233 |
| 26 | Ga0055532_1001534 | 3300003758 | Bacteria | 6247 |
| 27 | Ga0055527_1000022 | 3300003760 | Bacteria | 208676 |
| 28 | Ga0055535_1000026 | 3300003761 | Bacteria | 208676 |
| 29 | Ga0055542_1000042 | 3300003762 | Bacteria | 208676 |
| 30 | Ga0055529_1000048 | 3300003763 | Bacteria | 208676 |
| 31 | Ga0055526_1000146 | 3300003771 | Bacteria | 62389 |
| 32 | Ga0055526_1000180 | 3300003771 | Bacteria | 55895 |
| 33 | Ga0055537_1000090 | 3300003773 | Bacteria | 66515 |
| 34 | Ga0055524_1000195 | 3300003775 | Bacteria | 66515 |
| 35 | Ga0055536_1006008 | 3300003781 | Bacteria | 5771 |
| 36 | Ga0055536_1051248 | 3300003781 | Bacteria | 906 |
| 37 | Ga0055534_1000101 | 3300003784 | Bacteria | 66515 |
| 38 | Ga0055528_1000111 | 3300003790 | Bacteria | 66515 |
| 39 | Ga0055530_10018270 | 3300003791 | Bacteria | 2168 |
| 40 | Ga0055540_1000395 | 3300003792 | Bacteria | 35841 |
| 41 | Ga0055540_1006726 | 3300003792 | Bacteria | 4501 |
| 42 | Ga0055531_10000392 | 3300003794 | Bacteria | 42357 |
| 43 | Ga0055531_10007498 | 3300003794 | Bacteria | 5940 |
| 44 | Ga0055531_10013758 | 3300003794 | Bacteria | 3706 |
| 45 | Ga0058692_1000291 | 3300003856 | Bacteria | 25903 |
| 46 | Ga0058692_1000709 | 3300003856 | Bacteria | 13656 |
| 47 | Ga0058692_1021849 | 3300003856 | Bacteria | 1323 |
| 48 | Ga0055543_1004715 | 3300004625 | Bacteria | 3639 |
| 49 | Ga0065165_1001334 | 3300005262 | Bacteria | 27412 |
| 50 | Ga0070658_10047104 | 3300005327 | Bacteria | 3488 |
| 51 | Ga0070658_10202621 | 3300005327 | Bacteria | 1675 |
| 52 | Ga0070683_100106764 | 3300005329 | Bacteria | 2640 |
| 53 | Ga0070690_100028859 | 3300005330 | Bacteria | 3439 |
| 54 | Ga0068869_100025409 | 3300005334 | Bacteria | 4112 |
| 55 | Ga0070666_10006014 | 3300005335 | Bacteria | 7456 |
| 56 | Ga0070666_10144908 | 3300005335 | Bacteria | 1655 |
| 57 | Ga0068868_100005504 | 3300005338 | Bacteria | 8909 |
| 58 | Ga0070689_100881408 | 3300005340 | Bacteria | 791 |
| 59 | Ga0070661_100028850 | 3300005344 | Bacteria | 4004 |
| 60 | Ga0070661_100036407 | 3300005344 | Bacteria | 3577 |
| 61 | Ga0070692_10277711 | 3300005345 | Bacteria | 1014 |
| 62 | Ga0070668_100018057 | 3300005347 | Bacteria | 5290 |
| 63 | Ga0070671_100009337 | 3300005355 | Bacteria | 7875 |
| 64 | Ga0070673_100000141 | 3300005364 | Bacteria | 34034 |
| 65 | Ga0070688_100225560 | 3300005365 | Bacteria | 1323 |
| 66 | Ga0070688_100270959 | 3300005365 | Bacteria | 1216 |
| 67 | Ga0070667_100030394 | 3300005367 | Bacteria | 4505 |
| 68 | Ga0070667_100083824 | 3300005367 | Bacteria | 2731 |
| 69 | Ga0070667_100478708 | 3300005367 | Bacteria | 1139 |
| 70 | Ga0070714_100003209 | 3300005435 | Bacteria | 12171 |
| 71 | Ga0070713_100491184 | 3300005436 | Bacteria | 1157 |
| 72 | Ga0070705_100390213 | 3300005440 | Bacteria | 1027 |
| 73 | Ga0070708_100079876 | 3300005445 | Bacteria | 2960 |
| 74 | Ga0070708_100201248 | 3300005445 | Bacteria | 1864 |
| 75 | Ga0070663_100007884 | 3300005455 | Bacteria | 6515 |
| 76 | Ga0070663_100022801 | 3300005455 | Bacteria | 4189 |
| 77 | Ga0070678_100118604 | 3300005456 | Bacteria | 2083 |
| 78 | Ga0070678_100272330 | 3300005456 | Bacteria | 1428 |
| 79 | Ga0070662_100126021 | 3300005457 | Bacteria | 1968 |
| 80 | Ga0070681_10229550 | 3300005458 | Bacteria | 1770 |
| 81 | Ga0070681_10316342 | 3300005458 | Bacteria | 1470 |
| 82 | Ga0070681_10454036 | 3300005458 | Unclassified | 1194 |
| 83 | Ga0070685_10002403 | 3300005466 | Bacteria | 9634 |
| 84 | Ga0070685_10002790 | 3300005466 | Bacteria | 8927 |
| 85 | Ga0070706_100074654 | 3300005467 | Bacteria | 3138 |
| 86 | Ga0070706_100091055 | 3300005467 | Bacteria | 2828 |
| 87 | Ga0070706_100579633 | 3300005467 | Bacteria | 1043 |
| 88 | Ga0070707_100047627 | 3300005468 | Bacteria | 4104 |
| 89 | Ga0070707_100296416 | 3300005468 | Bacteria | 1571 |
| 90 | Ga0070698_100011515 | 3300005471 | Bacteria | 9387 |
| 91 | Ga0070698_100182678 | 3300005471 | Bacteria | 2035 |
| 92 | Ga0070698_100214916 | 3300005471 | Bacteria | 1857 |
| 93 | Ga0070699_100037018 | 3300005518 | Bacteria | 4222 |
| 94 | Ga0070697_100106965 | 3300005536 | Bacteria | 2327 |
| 95 | Ga0070697_100155673 | 3300005536 | Bacteria | 1929 |
| 96 | Ga0070697_100273077 | 3300005536 | Bacteria | 1449 |
| 97 | Ga0068853_100024171 | 3300005539 | Bacteria | 5093 |
| 98 | Ga0068853_100140920 | 3300005539 | Bacteria | 2164 |
| 99 | Ga0068853_100864020 | 3300005539 | Bacteria | 868 |
| 100 | Ga0070695_100024027 | 3300005545 | Bacteria | 3752 |
| 101 | Ga0070695_100086364 | 3300005545 | Bacteria | 2085 |
| 102 | Ga0070696_100711050 | 3300005546 | Bacteria | 820 |
| 103 | Ga0070693_100026364 | 3300005547 | Unclassified | 3137 |
| 104 | Ga0070665_100000266 | 3300005548 | Bacteria | 85554 |
| 105 | Ga0070704_100036073 | 3300005549 | Bacteria | 3366 |
| 106 | Ga0068855_100004153 | 3300005563 | Bacteria | 17667 |
| 107 | Ga0068855_100356754 | 3300005563 | Bacteria | 1609 |
| 108 | Ga0070664_100874524 | 3300005564 | Bacteria | 842 |
| 109 | Ga0068857_100055881 | 3300005577 | Bacteria | 3502 |
| 110 | Ga0068854_100000001 | 3300005578 | Bacteria | 608908 |
| 111 | Ga0068854_100022639 | 3300005578 | Bacteria | 4286 |
| 112 | Ga0068854_100338832 | 3300005578 | Bacteria | 1227 |
| 113 | Ga0068856_100169576 | 3300005614 | Bacteria | 2194 |
| 114 | Ga0068856_100323564 | 3300005614 | Unclassified | 1559 |
| 115 | Ga0068856_100727060 | 3300005614 | Bacteria | 1013 |
| 116 | Ga0068852_100044907 | 3300005616 | Bacteria | 3756 |
| 117 | Ga0068852_100097887 | 3300005616 | Bacteria | 2640 |
| 118 | Ga0068859_100005189 | 3300005617 | Bacteria | 13230 |
| 119 | Ga0068864_100000917 | 3300005618 | Bacteria | 24719 |
| 120 | Ga0068851_10003540 | 3300005834 | Bacteria | 6949 |
| 121 | Ga0068870_10018451 | 3300005840 | Bacteria | 3370 |
| 122 | Ga0068863_100000513 | 3300005841 | Bacteria | 39390 |
| 123 | Ga0068863_100757318 | 3300005841 | Bacteria | 967 |
| 124 | Ga0068858_100001759 | 3300005842 | Bacteria | 22087 |
| 125 | Ga0068858_100021689 | 3300005842 | Bacteria | 6002 |
| 126 | Ga0068860_100005306 | 3300005843 | Bacteria | 13087 |
| 127 | Ga0068860_100148933 | 3300005843 | Bacteria | 2253 |
| 128 | Ga0068862_100534488 | 3300005844 | Bacteria | 1117 |
| 129 | Ga0081539_10036407 | 3300005985 | Bacteria | 2946 |
| 130 | Ga0070717_10116035 | 3300006028 | Bacteria | 2289 |
| 131 | Ga0070717_10343343 | 3300006028 | Unclassified | 1334 |
| 132 | Ga0075365_10240513 | 3300006038 | Bacteria | 1271 |
| 133 | Ga0075363_100005255 | 3300006048 | Bacteria | 5741 |
| 134 | Ga0075363_100081017 | 3300006048 | Bacteria | 1775 |
| 135 | Ga0070715_10058956 | 3300006163 | Bacteria | 1678 |
| 136 | Ga0070716_100100769 | 3300006173 | Bacteria | 1770 |
| 137 | Ga0075366_10004616 | 3300006195 | Bacteria | 7401 |
| 138 | Ga0075366_10005365 | 3300006195 | Bacteria | 6946 |
| 139 | Ga0097621_100004565 | 3300006237 | Bacteria | 9665 |
| 140 | Ga0097621_100174707 | 3300006237 | Bacteria | 1854 |
| 141 | Ga0097621_100367527 | 3300006237 | Bacteria | 1283 |
| 142 | Ga0097621_100489273 | 3300006237 | Bacteria | 1113 |
| 143 | Ga0097621_100543437 | 3300006237 | Bacteria | 1057 |
| 144 | Ga0075370_10006582 | 3300006353 | Bacteria | 5853 |
| 145 | Ga0075370_10014671 | 3300006353 | Bacteria | 4184 |
| 146 | Ga0075370_10104777 | 3300006353 | Bacteria | 1639 |
| 147 | Ga0075370_10172203 | 3300006353 | Bacteria | 1273 |
| 148 | Ga0068871_100015616 | 3300006358 | Bacteria | 5690 |
| 149 | Ga0068871_100433141 | 3300006358 | Bacteria | 1176 |
| 150 | Ga0075428_100026987 | 3300006844 | Bacteria | 6360 |
| 151 | Ga0075433_10039977 | 3300006852 | Bacteria | 4058 |
| 152 | Ga0075434_100033336 | 3300006871 | Bacteria | 5082 |
| 153 | Ga0075436_100069460 | 3300006914 | Bacteria | 2434 |
| 154 | Ga0097620_100005190 | 3300006931 | Bacteria | 13230 |
| 155 | Ga0079104_1030084 | 3300006946 | Bacteria | 1361 |
| 156 | Ga0075435_100019214 | 3300007076 | Bacteria | 5212 |
| 157 | Ga0099795_10143964 | 3300007788 | Bacteria | 972 |
| 158 | Ga0105251_10018284 | 3300009011 | Bacteria | 3729 |
| 159 | Ga0105251_10066080 | 3300009011 | Bacteria | 1691 |
| 160 | Ga0105244_10008569 | 3300009036 | Bacteria | 6377 |
| 161 | Ga0105244_10017785 | 3300009036 | Bacteria | 4007 |
| 162 | Ga0105244_10119765 | 3300009036 | Bacteria | 1275 |
| 163 | Ga0105240_10000018 | 3300009093 | Bacteria | 434461 |
| 164 | Ga0105240_10000377 | 3300009093 | Bacteria | 83854 |
| 165 | Ga0105240_10135970 | 3300009093 | Bacteria | 2944 |
| 166 | Ga0105240_10137945 | 3300009093 | Bacteria | 2919 |
| 167 | Ga0105240_10146386 | 3300009093 | Bacteria | 2818 |
| 168 | Ga0105240_10175872 | 3300009093 | Bacteria | 2530 |
| 169 | Ga0105240_10701646 | 3300009093 | Bacteria | 1104 |
| 170 | Ga0105245_10002409 | 3300009098 | Bacteria | 16918 |
| 171 | Ga0105245_10008952 | 3300009098 | Bacteria | 8730 |
| 172 | Ga0105245_10267409 | 3300009098 | Bacteria | 1666 |
| 173 | Ga0105245_10338506 | 3300009098 | Bacteria | 1487 |
| 174 | Ga0105247_10013569 | 3300009101 | Bacteria | 4885 |
| 175 | Ga0114129_10036550 | 3300009147 | Bacteria | 6934 |
| 176 | Ga0114129_10039913 | 3300009147 | Bacteria | 6622 |
| 177 | Ga0114129_10044287 | 3300009147 | Bacteria | 6260 |
| 178 | Ga0114129_10058581 | 3300009147 | Bacteria | 5387 |
| 179 | Ga0114129_10160674 | 3300009147 | Bacteria | 3069 |
| 180 | Ga0105243_10009475 | 3300009148 | Bacteria | 7413 |
| 181 | Ga0105243_10019008 | 3300009148 | Bacteria | 5209 |
| 182 | Ga0105241_10345616 | 3300009174 | Bacteria | 1290 |
| 183 | Ga0105241_10540192 | 3300009174 | Unclassified | 1045 |
| 184 | Ga0105242_10003387 | 3300009176 | Bacteria | 12413 |
| 185 | Ga0105242_10181124 | 3300009176 | Bacteria | 1859 |
| 186 | Ga0105242_10629794 | 3300009176 | Bacteria | 1040 |
| 187 | Ga0105248_10001779 | 3300009177 | Bacteria | 23972 |
| 188 | Ga0105248_10215872 | 3300009177 | Bacteria | 2160 |
| 189 | Ga0105248_10544207 | 3300009177 | Bacteria | 1310 |
| 190 | Ga0105237_10086872 | 3300009545 | Bacteria | 3117 |
| 191 | Ga0105237_10336273 | 3300009545 | Bacteria | 1514 |
| 192 | Ga0105237_10646485 | 3300009545 | Bacteria | 1064 |
| 193 | Ga0105238_10006002 | 3300009551 | Bacteria | 12042 |
| 194 | Ga0105238_10085881 | 3300009551 | Bacteria | 3134 |
| 195 | Ga0105238_10106903 | 3300009551 | Bacteria | 2779 |
| 196 | Ga0105238_10350795 | 3300009551 | Bacteria | 1465 |
| 197 | Ga0105238_10779829 | 3300009551 | Bacteria | 971 |
| 198 | Ga0105249_10001046 | 3300009553 | Bacteria | 24484 |
| 199 | Ga0105239_10092479 | 3300010375 | Bacteria | 3339 |
| 200 | Ga0105239_10201237 | 3300010375 | Bacteria | 2231 |
| 201 | Ga0105239_10215416 | 3300010375 | Bacteria | 2153 |
| 202 | Ga0105246_10256633 | 3300011119 | Bacteria | 1390 |
| 203 | Ga0157373_10086165 | 3300013100 | Bacteria | 2214 |
| 204 | Ga0157370_10171353 | 3300013104 | Bacteria | 2018 |
| 205 | Ga0157369_10076866 | 3300013105 | Bacteria | 3579 |
| 206 | Ga0157369_10565296 | 3300013105 | Bacteria | 1175 |
| 207 | Ga0157374_10167559 | 3300013296 | Bacteria | 2142 |
| 208 | Ga0157378_10281001 | 3300013297 | Unclassified | 1604 |
| 209 | Ga0163162_10002679 | 3300013306 | Bacteria | 16876 |
| 210 | Ga0157372_10119090 | 3300013307 | Bacteria | 3030 |
| 211 | Ga0157372_10130228 | 3300013307 | Bacteria | 2894 |
| 212 | Ga0157372_10756115 | 3300013307 | Bacteria | 1130 |
| 213 | Ga0157380_10053974 | 3300014326 | Bacteria | 3188 |
| 214 | Ga0182008_10000846 | 3300014497 | Bacteria | 21301 |
| 215 | Ga0182008_10001161 | 3300014497 | Bacteria | 18139 |
| 216 | Ga0182008_10012263 | 3300014497 | Bacteria | 4526 |
| 217 | Ga0157379_10031675 | 3300014968 | Bacteria | 4712 |
| 218 | Ga0157379_10128366 | 3300014968 | Unclassified | 2282 |
| 219 | Ga0157379_10880854 | 3300014968 | Bacteria | 848 |
| 220 | Ga0157376_10842966 | 3300014969 | Bacteria | 932 |
| 221 | Ga0182006_1006519 | 3300015261 | Bacteria | 5415 |
| 222 | Ga0182006_1019783 | 3300015261 | Bacteria | 2830 |
| 223 | Ga0182006_1034517 | 3300015261 | Bacteria | 2023 |
| 224 | Ga0182006_1073396 | 3300015261 | Bacteria | 1263 |
| 225 | Ga0182007_10001504 | 3300015262 | Bacteria | 12452 |
| 226 | Ga0182007_10003696 | 3300015262 | Bacteria | 7155 |
| 227 | Ga0182007_10015136 | 3300015262 | Bacteria | 2887 |
| 228 | Ga0182005_1019424 | 3300015265 | Bacteria | 1873 |
| 229 | Ga0163161_10021987 | 3300017792 | Bacteria | 4486 |
| 230 | Ga0163161_10561864 | 3300017792 | Bacteria | 936 |
| 231 | Ga0213875_10027813 | 3300021388 | Bacteria | 2690 |
| 232 | Ga0209436_103651 | 3300025208 | Bacteria | 4016 |
| 233 | Ga0209566_100400 | 3300025225 | Bacteria | 34494 |
| 234 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 235 | Ga0209674_105307 | 3300025226 | Bacteria | 1930 |
| 236 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 237 | Ga0209672_102432 | 3300025228 | Bacteria | 4579 |
| 238 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 239 | Ga0209147_100156 | 3300025229 | Bacteria | 93105 |
| 240 | Ga0207427_102208 | 3300025231 | Bacteria | 5512 |
| 241 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 242 | Ga0207425_1000042 | 3300025245 | Bacteria | 210165 |
| 243 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 244 | Ga0209759_1000009 | 3300025256 | Bacteria | 446623 |
| 245 | Ga0209759_1000039 | 3300025256 | Bacteria | 256444 |
| 246 | Ga0209129_1000058 | 3300025258 | Bacteria | 252258 |
| 247 | Ga0209129_1000265 | 3300025258 | Bacteria | 51980 |
| 248 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 249 | Ga0209565_1000027 | 3300025263 | Bacteria | 360545 |
| 250 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 251 | Ga0209673_1000031 | 3300025273 | Bacteria | 347560 |
| 252 | Ga0209130_1000025 | 3300025284 | Bacteria | 336491 |
| 253 | Ga0209675_1000064 | 3300025291 | Bacteria | 177063 |
| 254 | Ga0209675_1018632 | 3300025291 | Bacteria | 1936 |
| 255 | Ga0209676_1001283 | 3300025292 | Bacteria | 25966 |
| 256 | Ga0209676_1013104 | 3300025292 | Bacteria | 3208 |
| 257 | Ga0209676_1025550 | 3300025292 | Bacteria | 1892 |
| 258 | Ga0209025_1000075 | 3300025294 | Bacteria | 275717 |
| 259 | Ga0209025_1000204 | 3300025294 | Bacteria | 142193 |
| 260 | Ga0209025_1000380 | 3300025294 | Bacteria | 92360 |
| 261 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 262 | Ga0209564_1000040 | 3300025295 | Bacteria | 411388 |
| 263 | Ga0209758_1000050 | 3300025297 | Bacteria | 345008 |
| 264 | Ga0209050_1000704 | 3300025298 | Bacteria | 49577 |
| 265 | Ga0209050_1003418 | 3300025298 | Bacteria | 11746 |
| 266 | Ga0209256_1000023 | 3300025299 | Bacteria | 461150 |
| 267 | Ga0207426_1000118 | 3300025302 | Bacteria | 223341 |
| 268 | Ga0209051_1000186 | 3300025303 | Bacteria | 109900 |
| 269 | Ga0209051_1001497 | 3300025303 | Bacteria | 19533 |
| 270 | Ga0209257_1000188 | 3300025304 | Bacteria | 154074 |
| 271 | Ga0209257_1000460 | 3300025304 | Bacteria | 75384 |
| 272 | Ga0209257_1000663 | 3300025304 | Bacteria | 54142 |
| 273 | Ga0207656_10004236 | 3300025321 | Bacteria | 4994 |
| 274 | Ga0207655_1005414 | 3300025728 | Bacteria | 8686 |
| 275 | Ga0207655_1042915 | 3300025728 | Bacteria | 1919 |
| 276 | Ga0207713_1012478 | 3300025735 | Bacteria | 4537 |
| 277 | Ga0207713_1041673 | 3300025735 | Bacteria | 1913 |
| 278 | Ga0207710_10010419 | 3300025900 | Bacteria | 3915 |
| 279 | Ga0207680_10004781 | 3300025903 | Bacteria | 6448 |
| 280 | Ga0207680_10018401 | 3300025903 | Bacteria | 3713 |
| 281 | Ga0207680_10473374 | 3300025903 | Bacteria | 890 |
| 282 | Ga0207647_10001123 | 3300025904 | Bacteria | 20593 |
| 283 | Ga0207647_10005424 | 3300025904 | Bacteria | 9348 |
| 284 | Ga0207647_10006206 | 3300025904 | Bacteria | 8710 |
| 285 | Ga0207647_10069363 | 3300025904 | Bacteria | 2131 |
| 286 | Ga0207699_10167126 | 3300025906 | Bacteria | 1469 |
| 287 | Ga0207705_10036448 | 3300025909 | Bacteria | 3519 |
| 288 | Ga0207705_10039249 | 3300025909 | Bacteria | 3392 |
| 289 | Ga0207684_10026476 | 3300025910 | Bacteria | 4944 |
| 290 | Ga0207684_10258163 | 3300025910 | Bacteria | 1503 |
| 291 | Ga0207654_10296574 | 3300025911 | Bacteria | 1098 |
| 292 | Ga0207707_10166487 | 3300025912 | Bacteria | 1926 |
| 293 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 294 | Ga0207695_10000141 | 3300025913 | Bacteria | 215831 |
| 295 | Ga0207695_10017795 | 3300025913 | Bacteria | 8246 |
| 296 | Ga0207695_10268504 | 3300025913 | Bacteria | 1602 |
| 297 | Ga0207671_10013102 | 3300025914 | Bacteria | 6624 |
| 298 | Ga0207693_10219465 | 3300025915 | Bacteria | 1494 |
| 299 | Ga0207663_10219459 | 3300025916 | Bacteria | 1383 |
| 300 | Ga0207649_10087076 | 3300025920 | Bacteria | 2037 |
| 301 | Ga0207649_10219175 | 3300025920 | Bacteria | 1354 |
| 302 | Ga0207646_10037926 | 3300025922 | Bacteria | 4343 |
| 303 | Ga0207681_10037631 | 3300025923 | Bacteria | 3199 |
| 304 | Ga0207694_10000996 | 3300025924 | Bacteria | 24749 |
| 305 | Ga0207694_10002131 | 3300025924 | Bacteria | 16262 |
| 306 | Ga0207694_10142271 | 3300025924 | Bacteria | 1929 |
| 307 | Ga0207694_10245175 | 3300025924 | Bacteria | 1465 |
| 308 | Ga0207650_10004121 | 3300025925 | Bacteria | 9934 |
| 309 | Ga0207650_10151889 | 3300025925 | Bacteria | 1828 |
| 310 | Ga0207687_10001314 | 3300025927 | Bacteria | 16986 |
| 311 | Ga0207687_10013870 | 3300025927 | Bacteria | 5264 |
| 312 | Ga0207700_10179425 | 3300025928 | Bacteria | 1772 |
| 313 | Ga0207664_10003413 | 3300025929 | Bacteria | 10584 |
| 314 | Ga0207664_10250962 | 3300025929 | Unclassified | 1544 |
| 315 | Ga0207644_10148774 | 3300025931 | Bacteria | 1810 |
| 316 | Ga0207706_10020233 | 3300025933 | Bacteria | 5981 |
| 317 | Ga0207686_10096160 | 3300025934 | Bacteria | 1967 |
| 318 | Ga0207709_10002070 | 3300025935 | Bacteria | 12957 |
| 319 | Ga0207709_10037321 | 3300025935 | Bacteria | 2887 |
| 320 | Ga0207670_10016823 | 3300025936 | Bacteria | 4406 |
| 321 | Ga0207670_10371508 | 3300025936 | Bacteria | 1137 |
| 322 | Ga0207665_10094081 | 3300025939 | Bacteria | 2081 |
| 323 | Ga0207711_10209509 | 3300025941 | Bacteria | 1780 |
| 324 | Ga0207711_10380127 | 3300025941 | Bacteria | 1310 |
| 325 | Ga0207667_10036229 | 3300025949 | Bacteria | 5289 |
| 326 | Ga0207651_10226527 | 3300025960 | Bacteria | 1515 |
| 327 | Ga0207712_10000349 | 3300025961 | Bacteria | 41192 |
| 328 | Ga0207668_10010539 | 3300025972 | Bacteria | 5588 |
| 329 | Ga0207640_10000003 | 3300025981 | Bacteria | 505282 |
| 330 | Ga0207640_10099922 | 3300025981 | Bacteria | 2032 |
| 331 | Ga0207658_10015667 | 3300025986 | Bacteria | 5204 |
| 332 | Ga0207658_10164602 | 3300025986 | Bacteria | 1820 |
| 333 | Ga0207658_10166824 | 3300025986 | Bacteria | 1810 |
| 334 | Ga0207677_10000312 | 3300026023 | Bacteria | 35589 |
| 335 | Ga0207703_10005588 | 3300026035 | Bacteria | 10095 |
| 336 | Ga0207703_10011122 | 3300026035 | Bacteria | 7007 |
| 337 | Ga0207639_10000102 | 3300026041 | Bacteria | 70172 |
| 338 | Ga0207639_10077869 | 3300026041 | Unclassified | 2615 |
| 339 | Ga0207678_10000769 | 3300026067 | Bacteria | 29267 |
| 340 | Ga0207678_10023453 | 3300026067 | Bacteria | 5397 |
| 341 | Ga0207702_10102570 | 3300026078 | Bacteria | 2529 |
| 342 | Ga0207702_10475188 | 3300026078 | Unclassified | 1216 |
| 343 | Ga0207702_10575720 | 3300026078 | Bacteria | 1103 |
| 344 | Ga0207702_10780041 | 3300026078 | Bacteria | 944 |
| 345 | Ga0207641_10018610 | 3300026088 | Bacteria | 5694 |
| 346 | Ga0207676_10061410 | 3300026095 | Bacteria | 2976 |
| 347 | Ga0207674_10096035 | 3300026116 | Bacteria | 2949 |
| 348 | Ga0207683_10116456 | 3300026121 | Bacteria | 2396 |
| 349 | Ga0207683_10149316 | 3300026121 | Bacteria | 2109 |
| 350 | Ga0207698_10008725 | 3300026142 | Bacteria | 6428 |
| 351 | Ga0207698_10489196 | 3300026142 | Bacteria | 1195 |
| 352 | Ga0209371_1000061 | 3300027312 | Bacteria | 223014 |
| 353 | Ga0209371_1002070 | 3300027312 | Bacteria | 11949 |
| 354 | Ga0209371_1017758 | 3300027312 | Bacteria | 1831 |
| 355 | Ga0209974_10025484 | 3300027876 | Bacteria | 1957 |
| 356 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 357 | Ga0268265_10558062 | 3300028380 | Bacteria | 1088 |
| 358 | Ga0268264_10002693 | 3300028381 | Bacteria | 15509 |
| 359 | Ga0268264_10632363 | 3300028381 | Bacteria | 1058 |
| 360 | Ga0265323_10003834 | 3300028653 | Bacteria | 6549 |
| 361 | Ga0307515_10494513 | 3300028794 | Bacteria | 834 |
| 362 | Ga0268256_1000059 | 3300030500 | Bacteria | 223875 |
| 363 | Ga0268256_1018546 | 3300030500 | Bacteria | 1926 |
| 364 | Ga0268256_1019795 | 3300030500 | Bacteria | 1832 |
| 365 | Ga0316177_1202970 | 3300030731 | Bacteria | 6074 |
| 366 | Ga0316176_1038327 | 3300030732 | Bacteria | 3881 |
| 367 | Ga0314311_1013956 | 3300030733 | Bacteria | 9041 |
| 368 | Ga0316179_1016783 | 3300030734 | Bacteria | 3777 |
| 369 | Ga0316178_1052877 | 3300030735 | Bacteria | 4082 |
| 370 | Ga0316180_1157241 | 3300030736 | Bacteria | 4826 |
| 371 | Ga0316182_1144941 | 3300030745 | Bacteria | 9282 |
| 372 | Ga0265762_1026356 | 3300030760 | Bacteria | 1087 |
| 373 | Ga0265327_10123981 | 3300031251 | Bacteria | 1221 |
| 374 | Ga0307513_10191691 | 3300031456 | Bacteria | 1895 |
| 375 | Ga0307408_100006508 | 3300031548 | Bacteria | 7744 |
| 376 | Ga0316576_10096584 | 3300031727 | Bacteria | 2205 |
| 377 | Ga0316578_10102308 | 3300031728 | Bacteria | 1718 |
| 378 | Ga0307405_10231930 | 3300031731 | Bacteria | 1361 |
| 379 | Ga0307405_10276686 | 3300031731 | Bacteria | 1261 |
| 380 | Ga0307413_10228412 | 3300031824 | Bacteria | 1365 |
| 381 | Ga0307406_10327634 | 3300031901 | Bacteria | 1187 |
| 382 | Ga0307412_10199768 | 3300031911 | Bacteria | 1517 |
| 383 | Ga0307412_10590161 | 3300031911 | Bacteria | 939 |
| 384 | Ga0307415_100262265 | 3300032126 | Bacteria | 1411 |
| 385 | Ga0373923_0115267 | 3300035111 | Bacteria | 1196 |
| 386 | Ga0373923_0178355 | 3300035111 | Bacteria | 975 |
| 387 | Ga0373957_0007425 | 3300035120 | Bacteria | 3507 |
| 388 | Ga0373955_0013903 | 3300035172 | Bacteria | 3905 |
| 389 | Ga0316574_0000112 | 3300035398 | Bacteria | 24428 |
| 390 | Ga0373924_0047722 | 3300035410 | Bacteria | 1767 |
| 391 | Ga0373931_0109525 | 3300035691 | Bacteria | 1565 |
| 392 | Ga0373927_0043621 | 3300035695 | Bacteria | 2903 |
| 393 | Ga0373927_0171280 | 3300035695 | Bacteria | 1423 |
| 394 | Ga0373937_0018691 | 3300036401 | Bacteria | 6193 |
| 395 | Ga0373937_0054333 | 3300036401 | Bacteria | 3675 |
| 396 | Ga0373937_0480549 | 3300036401 | Bacteria | 1180 |
| 397 | Ga0373937_0748473 | 3300036401 | Bacteria | 925 |
| 398 | Ga0373937_0982749 | 3300036401 | Bacteria | 793 |
| 399 | Ga0316584_0102676 | 3300036712 | Bacteria | 2141 |
| 400 | Ga0316584_0411309 | 3300036712 | Bacteria | 962 |
| 401 | Ga0373925_0019595 | 3300037068 | Bacteria | 4923 |
| 402 | Ga0395900_0392285 | 3300037418 | Bacteria | 1354 |
| 403 | Ga0395905_0583857 | 3300037471 | Bacteria | 1019 |
| 404 | Ga0436364_0020996 | 3300037853 | Bacteria | 3747 |
| 405 | Ga0436364_1091802 | 3300037853 | Unclassified | 936 |
| 406 | Ga0436364_1550326 | 3300037853 | Bacteria | 15744 |
| 407 | Ga0436360_1282181 | 3300039438 | Bacteria | 12068 |
| 408 | Ga0436361_0430826 | 3300039447 | Bacteria | 7116 |
| 409 | Ga0439466_0112194 | 3300041411 | Bacteria | 845 |
| 410 | Ga0451849_0741869 | 3300041505 | Bacteria | 1333 |
| 411 | Ga0439445_0015131 | 3300042004 | Bacteria | 1886 |
| 412 | Ga0439448_0045545 | 3300042005 | Bacteria | 1428 |
| 413 | Ga0439432_074189 | 3300042006 | Bacteria | 1035 |
| 414 | Ga0450891_005710 | 3300042129 | Bacteria | 1150 |
| 415 | Ga0451577_0002733 | 3300042876 | Bacteria | 20475 |
| 416 | Ga0451577_0110531 | 3300042876 | Bacteria | 2458 |
| 417 | Ga0451577_0494765 | 3300042876 | Bacteria | 1110 |
| 418 | Ga0466972_0001438 | 3300044658 | Bacteria | 11560 |
| 419 | Ga0466972_0118302 | 3300044658 | Bacteria | 1250 |
| 420 | Ga0466961_0605567 | 3300044693 | Bacteria | 659 |
| 421 | Ga0453684_0539919 | 3300044712 | Bacteria | 1286 |
| 422 | Ga0466970_0000972 | 3300044765 | Bacteria | 13784 |
| 423 | Ga0466957_0002291 | 3300044842 | Bacteria | 10254 |
| 424 | Ga0466957_0026464 | 3300044842 | Bacteria | 3442 |
| 425 | Ga0451576_0091674 | 3300045051 | Bacteria | 3161 |
| 426 | Ga0466958_0024051 | 3300045836 | Bacteria | 3582 |
| 427 | Ga0466958_0170227 | 3300045836 | Bacteria | 1379 |
| 428 | Ga0466967_0934065 | 3300045976 | Bacteria | 863 |
| 429 | Ga0495592_0029261 | 3300046454 | Bacteria | 4171 |
| 430 | Ga0495590_0002911 | 3300046457 | Bacteria | 7047 |
| 431 | Ga0495591_004217 | 3300046458 | Bacteria | 7126 |
| 432 | Ga0495629_0015543 | 3300046459 | Bacteria | 5464 |
| 433 | Ga0495629_0021702 | 3300046459 | Bacteria | 4581 |
| 434 | Ga0495651_0062147 | 3300046462 | Bacteria | 2858 |
| 435 | Ga0495651_0079539 | 3300046462 | Bacteria | 2477 |
| 436 | Ga0495651_0098527 | 3300046462 | Bacteria | 2181 |
| 437 | Ga0495653_0000409 | 3300046463 | Bacteria | 34377 |
| 438 | Ga0495653_0044328 | 3300046463 | Bacteria | 3452 |
| 439 | Ga0495653_0236300 | 3300046463 | Bacteria | 1220 |
| 440 | Ga0495650_0000166 | 3300046471 | Bacteria | 146047 |
| 441 | Ga0495650_0000503 | 3300046471 | Bacteria | 58702 |
| 442 | Ga0495580_0000839 | 3300046472 | Bacteria | 26622 |
| 443 | Ga0495580_0015417 | 3300046472 | Bacteria | 5763 |
| 444 | Ga0495582_0082465 | 3300046473 | Bacteria | 1787 |
| 445 | Ga0495582_0123578 | 3300046473 | Bacteria | 1459 |
| 446 | Ga0495605_0000059 | 3300046474 | Bacteria | 146371 |
| 447 | Ga0495639_0006419 | 3300046475 | Bacteria | 5059 |
| 448 | Ga0495662_0017244 | 3300046476 | Bacteria | 3496 |
| 449 | Ga0495664_0004899 | 3300046477 | Bacteria | 7325 |
| 450 | Ga0495664_0070685 | 3300046477 | Bacteria | 2084 |
| 451 | Ga0495664_0128409 | 3300046477 | Bacteria | 1534 |
| 452 | Ga0495596_0096712 | 3300046500 | Bacteria | 1146 |
| 453 | Ga0495583_0134277 | 3300046506 | Bacteria | 1034 |
| 454 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 455 | Ga0495606_0000156 | 3300046507 | Bacteria | 118821 |
| 456 | Ga0495606_0039372 | 3300046507 | Bacteria | 3187 |
| 457 | Ga0495608_0041612 | 3300046511 | Bacteria | 3074 |
| 458 | Ga0495610_0002878 | 3300046512 | Bacteria | 13942 |
| 459 | Ga0495618_0004484 | 3300046514 | Bacteria | 8586 |
| 460 | Ga0495618_0010063 | 3300046514 | Bacteria | 5720 |
| 461 | Ga0495628_0039577 | 3300046516 | Bacteria | 3770 |
| 462 | Ga0495628_0070321 | 3300046516 | Bacteria | 2728 |
| 463 | Ga0495628_0103038 | 3300046516 | Bacteria | 2201 |
| 464 | Ga0495628_0194233 | 3300046516 | Bacteria | 1532 |
| 465 | Ga0495630_0001458 | 3300046517 | Bacteria | 16385 |
| 466 | Ga0495630_0012098 | 3300046517 | Bacteria | 6257 |
| 467 | Ga0495630_0259490 | 3300046517 | Bacteria | 1327 |
| 468 | Ga0495648_0000675 | 3300046524 | Bacteria | 36444 |
| 469 | Ga0495648_0043908 | 3300046524 | Bacteria | 2795 |
| 470 | Ga0495648_0102751 | 3300046524 | Bacteria | 1573 |
| 471 | Ga0495666_0007246 | 3300046526 | Bacteria | 5565 |
| 472 | Ga0495666_0014061 | 3300046526 | Bacteria | 3991 |
| 473 | Ga0495666_0018617 | 3300046526 | Bacteria | 3453 |
| 474 | Ga0495642_0008798 | 3300046528 | Bacteria | 3860 |
| 475 | Ga0495642_0067361 | 3300046528 | Bacteria | 1493 |
| 476 | Ga0495652_0074918 | 3300046529 | Bacteria | 2813 |
| 477 | Ga0495665_0000581 | 3300046531 | Bacteria | 18623 |
| 478 | Ga0495665_0017430 | 3300046531 | Bacteria | 3862 |
| 479 | Ga0495665_0116383 | 3300046531 | Bacteria | 1400 |
| 480 | Ga0495640_0006005 | 3300046533 | Bacteria | 9630 |
| 481 | Ga0495640_0017324 | 3300046533 | Bacteria | 5372 |
| 482 | Ga0495640_0060018 | 3300046533 | Bacteria | 2588 |
| 483 | Ga0495586_0007335 | 3300046535 | Bacteria | 5884 |
| 484 | Ga0495587_0011727 | 3300046536 | Bacteria | 5547 |
| 485 | Ga0495609_0128351 | 3300046538 | Bacteria | 1087 |
| 486 | Ga0495645_0014763 | 3300046543 | Bacteria | 5548 |
| 487 | Ga0495645_0230457 | 3300046543 | Bacteria | 1241 |
| 488 | Ga0495622_0000031 | 3300046557 | Bacteria | 130204 |
| 489 | Ga0495633_0183968 | 3300046558 | Bacteria | 961 |
| 490 | Ga0495656_0096274 | 3300046615 | Bacteria | 1362 |
| 491 | Ga0495668_0001239 | 3300046616 | Bacteria | 25630 |
| 492 | Ga0495668_0028854 | 3300046616 | Bacteria | 3137 |
| 493 | Ga0495634_0006573 | 3300046642 | Bacteria | 8820 |
| 494 | Ga0495634_0113250 | 3300046642 | Bacteria | 1742 |
| 495 | Ga0495635_0005627 | 3300046663 | Bacteria | 8732 |
| 496 | Ga0495635_0273744 | 3300046663 | Bacteria | 1135 |
| 497 | Ga0495661_0004712 | 3300046665 | Bacteria | 9796 |
| 498 | Ga0495661_0017821 | 3300046665 | Bacteria | 4680 |
| 499 | Ga0495661_0025430 | 3300046665 | Bacteria | 3823 |
| 500 | Ga0495588_0066605 | 3300046674 | Bacteria | 1869 |
| 501 | Ga0495657_0186450 | 3300046675 | Bacteria | 1270 |
| 502 | Ga0495657_0190860 | 3300046675 | Bacteria | 1252 |
| 503 | Ga0495599_0025119 | 3300046678 | Bacteria | 3728 |
| 504 | Ga0495599_0091528 | 3300046678 | Bacteria | 1897 |
| 505 | Ga0495599_0203592 | 3300046678 | Bacteria | 1215 |
| 506 | Ga0495623_0000861 | 3300046679 | Bacteria | 20557 |
| 507 | Ga0495623_0013447 | 3300046679 | Bacteria | 5306 |
| 508 | Ga0495646_0000655 | 3300046680 | Bacteria | 18969 |
| 509 | Ga0495646_0001183 | 3300046680 | Bacteria | 15273 |
| 510 | Ga0495646_0018898 | 3300046680 | Bacteria | 4365 |
| 511 | Ga0495647_0067293 | 3300046681 | Bacteria | 1426 |
| 512 | Ga0495613_0014070 | 3300046689 | Bacteria | 5937 |
| 513 | Ga0495613_0159416 | 3300046689 | Bacteria | 1606 |
| 514 | Ga0495624_0309081 | 3300046690 | Bacteria | 952 |
| 515 | Ga0495670_0007113 | 3300046691 | Bacteria | 5511 |
| 516 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 517 | Ga0495671_0134609 | 3300046692 | Bacteria | 1205 |
| 518 | Ga0495600_0058911 | 3300046809 | Bacteria | 2508 |
| 519 | Ga0495581_0001228 | 3300047315 | Bacteria | 14126 |
| 520 | Ga0495581_0030485 | 3300047315 | Bacteria | 3125 |
| 521 | Ga0495604_0004144 | 3300047317 | Bacteria | 11512 |
| 522 | Ga0495604_0088636 | 3300047317 | Bacteria | 2301 |
| 523 | Ga0495674_0112010 | 3300047319 | Bacteria | 2312 |
| 524 | Ga0495672_0030414 | 3300047320 | Bacteria | 3388 |
| 525 | Ga0495676_0191593 | 3300047321 | Bacteria | 1426 |
| 526 | Ga0495680_0010571 | 3300047322 | Bacteria | 8233 |
| 527 | Ga0495680_0024259 | 3300047322 | Bacteria | 5032 |
| 528 | Ga0495680_0033513 | 3300047322 | Bacteria | 4157 |
| 529 | Ga0495680_0112378 | 3300047322 | Bacteria | 2018 |
| 530 | Ga0495683_0000746 | 3300047323 | Bacteria | 23507 |
| 531 | Ga0495675_0003273 | 3300047444 | Bacteria | 9737 |
| 532 | Ga0495675_0003327 | 3300047444 | Bacteria | 9672 |
| 533 | Ga0495675_0007996 | 3300047444 | Bacteria | 6541 |
| 534 | Ga0495675_0033793 | 3300047444 | Bacteria | 3264 |
| 535 | Ga0495679_001681 | 3300047446 | Bacteria | 12281 |
| 536 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 537 | Ga0495673_0013387 | 3300047469 | Bacteria | 4311 |
| 538 | Ga0495673_0045036 | 3300047469 | Bacteria | 1964 |
| 539 | Ga0495593_0011089 | 3300047673 | Bacteria | 5185 |
| 540 | Ga0495593_0016593 | 3300047673 | Bacteria | 4151 |
| 541 | Ga0495593_0181831 | 3300047673 | Bacteria | 1059 |
| 542 | Ga0495602_0012144 | 3300048088 | Bacteria | 8869 |
| 543 | Ga0495602_0142045 | 3300048088 | Bacteria | 1899 |
| 544 | Ga0495602_0214375 | 3300048088 | Bacteria | 1458 |
| 545 | Ga0495614_0032669 | 3300048089 | Bacteria | 2239 |
| 546 | Ga0496100_0451671 | 3300048903 | Unclassified | 985 |
| 547 | Ga0496101_0020528 | 3300048904 | Bacteria | 4524 |
| 548 | Ga0496102_0009970 | 3300048905 | Bacteria | 8168 |
| 549 | Ga0496102_0010929 | 3300048905 | Bacteria | 7820 |
| 550 | Ga0496104_0026839 | 3300048907 | Bacteria | 5323 |
| 551 | Ga0496104_0266262 | 3300048907 | Bacteria | 1626 |
| 552 | Ga0496104_0346523 | 3300048907 | Bacteria | 1398 |
| 553 | Ga0496105_0006554 | 3300048908 | Bacteria | 8956 |
| 554 | Ga0496105_0038601 | 3300048908 | Unclassified | 3935 |
| 555 | Ga0496106_0009899 | 3300048909 | Bacteria | 7039 |
| 556 | Ga0496106_0109118 | 3300048909 | Bacteria | 2153 |
| 557 | Ga0496107_0107789 | 3300048910 | Bacteria | 2046 |
| 558 | Ga0496107_0115560 | 3300048910 | Bacteria | 1975 |
| 559 | Ga0496109_0148551 | 3300048912 | Bacteria | 2194 |
| 560 | Ga0496110_0024981 | 3300048913 | Bacteria | 5100 |
| 561 | Ga0496110_0133499 | 3300048913 | Bacteria | 2242 |
| 562 | Ga0496111_0003347 | 3300048914 | Bacteria | 9913 |
| 563 | Ga0496111_0190122 | 3300048914 | Bacteria | 1526 |
| 564 | Ga0496112_0002221 | 3300048915 | Bacteria | 15486 |
| 565 | Ga0496112_0046538 | 3300048915 | Unclassified | 4255 |
| 566 | Ga0496112_0683793 | 3300048915 | Unclassified | 954 |
| 567 | Ga0496113_0104887 | 3300048916 | Bacteria | 2194 |
| 568 | Ga0496113_0364609 | 3300048916 | Bacteria | 1159 |
| 569 | Ga0496114_0103935 | 3300048917 | Bacteria | 2428 |
| 570 | Ga0496115_0046841 | 3300048918 | Bacteria | 3457 |
| 571 | Ga0496115_0138212 | 3300048918 | Bacteria | 2009 |
| 572 | Ga0496116_0008081 | 3300048919 | Bacteria | 9199 |
| 573 | Ga0496116_0020316 | 3300048919 | Bacteria | 5048 |
| 574 | Ga0496116_0242214 | 3300048919 | Bacteria | 905 |
| 575 | Ga0496117_0006969 | 3300048920 | Bacteria | 11205 |
| 576 | Ga0496117_0016111 | 3300048920 | Bacteria | 6325 |
| 577 | Ga0496117_0046765 | 3300048920 | Bacteria | 3110 |
| 578 | Ga0496117_0065779 | 3300048920 | Bacteria | 2462 |
| 579 | Ga0496118_0000316 | 3300048921 | Bacteria | 83449 |
| 580 | Ga0496118_0000365 | 3300048921 | Bacteria | 76413 |
| 581 | Ga0496118_0063083 | 3300048921 | Bacteria | 2729 |
| 582 | Ga0496118_0297227 | 3300048921 | Bacteria | 889 |
| 583 | Ga0496121_0053387 | 3300048924 | Bacteria | 3386 |
| 584 | Ga0496121_0130554 | 3300048924 | Bacteria | 1881 |
| 585 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 586 | Ga0496122_0019094 | 3300048925 | Bacteria | 6285 |
| 587 | Ga0496122_0304136 | 3300048925 | Bacteria | 858 |
| 588 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 589 | Ga0496123_0004114 | 3300048926 | Bacteria | 15593 |
| 590 | Ga0496123_0008012 | 3300048926 | Bacteria | 9786 |
| 591 | Ga0496123_0082795 | 3300048926 | Bacteria | 1943 |
| 592 | Ga0496123_0092781 | 3300048926 | Bacteria | 1785 |
| 593 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 594 | Ga0496124_0071977 | 3300048927 | Bacteria | 2863 |
| 595 | Ga0496124_0247434 | 3300048927 | Bacteria | 1321 |
| 596 | Ga0496124_0481868 | 3300048927 | Bacteria | 837 |
| 597 | Ga0496125_0010015 | 3300048928 | Bacteria | 9632 |
| 598 | Ga0496125_0058594 | 3300048928 | Bacteria | 3110 |
| 599 | Ga0496126_0000231 | 3300048929 | Bacteria | 120254 |
| 600 | Ga0496126_0000629 | 3300048929 | Bacteria | 66001 |
| 601 | Ga0496126_0013342 | 3300048929 | Bacteria | 8365 |
| 602 | Ga0496126_0046950 | 3300048929 | Bacteria | 3956 |
| 603 | Ga0496126_0067531 | 3300048929 | Bacteria | 3194 |
| 604 | Ga0496126_0114455 | 3300048929 | Bacteria | 2347 |
| 605 | Ga0495678_011455 | 3300049459 | Bacteria | 4245 |
| 606 | Ga0495682_0019414 | 3300049460 | Bacteria | 2557 |
| 607 | Ga0501321_015971 | 3300049537 | Bacteria | 889 |
| 608 | Ga0501323_013172 | 3300049539 | Bacteria | 1020 |
| 609 | Ga0501323_026524 | 3300049539 | Bacteria | 794 |
| 610 | Ga0501034_0147518 | 3300049571 | Bacteria | 2329 |
| 611 | Ga0501034_0561658 | 3300049571 | Bacteria | 1050 |
| 612 | Ga0501036_0726482 | 3300049572 | Bacteria | 820 |
| 613 | Ga0501047_0109754 | 3300049581 | Bacteria | 2641 |
| 614 | Ga0501047_0591437 | 3300049581 | Bacteria | 932 |
| 615 | Ga0501070_0359636 | 3300049586 | Bacteria | 1181 |
| 616 | Ga0501209_000168 | 3300049656 | Bacteria | 7397 |
| 617 | Ga0501249_043114 | 3300049679 | Bacteria | 1026 |
| 618 | Ga0501225_0028464 | 3300049705 | Bacteria | 1536 |
| 619 | Ga0501080_0134538 | 3300049742 | Bacteria | 2288 |
| 620 | Ga0501080_0714055 | 3300049742 | Bacteria | 883 |
| 621 | Ga0501080_0961927 | 3300049742 | Unclassified | 742 |
| 622 | Ga0501083_0376226 | 3300049744 | Unclassified | 924 |
| 623 | Ga0501262_000117 | 3300049759 | Bacteria | 9842 |
| 624 | Ga0501044_0001012 | 3300049823 | Bacteria | 33764 |
| 625 | nmdc:mga03n38_154812_c1 | 3300050490 | Bacteria | 1156 |
| 626 | nmdc:mga03n38_3331_c1 | 3300050490 | Bacteria | 5145 |
| 627 | nmdc:mga00v17_112546_c1 | 3300050491 | Bacteria | 1727 |
| 628 | nmdc:mga00v17_24396_c1 | 3300050491 | Bacteria | 3508 |
| 629 | nmdc:mga0yw44_64083_c1 | 3300050492 | Bacteria | 2261 |
| 630 | nmdc:mga0k408_88990_c1 | 3300050493 | Bacteria | 1813 |
| 631 | nmdc:mga06z11_151583_c1 | 3300050494 | Bacteria | 1318 |
| 632 | nmdc:mga07m45_12158_c1 | 3300050496 | Bacteria | 4542 |
| 633 | nmdc:mga07m45_32586_c1 | 3300050496 | Bacteria | 2890 |
| 634 | nmdc:mga05p37_48474_c1 | 3300050507 | Bacteria | 5224 |
| 635 | nmdc:mga08y16_29818_c1 | 3300050511 | Bacteria | 5744 |
| 636 | nmdc:mga0n895_88189_c1 | 3300050512 | Bacteria | 3102 |
| 637 | nmdc:mga0rr50_15500_c1 | 3300050513 | Bacteria | 5033 |
| 638 | nmdc:mga0rr50_303638_c1 | 3300050513 | Bacteria | 1335 |
| 639 | nmdc:mga08x19_33518_c1 | 3300050514 | Bacteria | 3241 |
| 640 | nmdc:mga0a205_33910_c1 | 3300050515 | Bacteria | 4896 |
| 641 | nmdc:mga0sz30_15762_c1 | 3300050516 | Bacteria | 2990 |
| 642 | Ga0495601_0007434 | 3300053077 | Bacteria | 6423 |
| 643 | Ga0500594_0102160 | 3300053118 | Bacteria | 883 |
| 644 | Ga0500618_000108 | 3300053125 | Bacteria | 67640 |
| 645 | Ga0500618_002276 | 3300053125 | Bacteria | 7422 |
| 646 | Ga0500618_017872 | 3300053125 | Bacteria | 1761 |
| 647 | Ga0500559_0000906 | 3300053136 | Bacteria | 18900 |
| 648 | Ga0500559_0001710 | 3300053136 | Bacteria | 12058 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10565296 | Ga0157369_105652962 | 198 |
| 2 | 3300013307 | Ga0157372_10130228 | Ga0157372_101302282 | 198 |
| 3 | 3300044693 | Ga0466961_0605567 | Ga0466961_0605567_32_637 | 198 |
| 4 | 3300049459 | Ga0495678_011455 | Ga0495678_011455_2260_3000 | 219 |
| 5 | 3300025916 | Ga0207663_10219459 | Ga0207663_102194591 | 226 |
| 6 | 3300021388 | Ga0213875_10027813 | Ga0213875_100278133 | 228 |
| 7 | 3300037853 | Ga0436364_0020996 | Ga0436364_0020996_970_1695 | 228 |
| 8 | 3300009147 | Ga0114129_10044287 | Ga0114129_100442872 | 229 |
| 9 | 3300009147 | Ga0114129_10058581 | Ga0114129_100585812 | 229 |
| 10 | 3300036712 | Ga0316584_0411309 | Ga0316584_0411309_227_919 | 229 |
| 11 | 3300050507 | nmdc:mga05p37_48474_c1 | nmdc:mga05p37_48474_c1_229_918 | 229 |
| 12 | 3300050513 | nmdc:mga0rr50_303638_c1 | nmdc:mga0rr50_303638_c1_165_854 | 229 |
| 13 | iso_pu_bacteria | 2511231003 | 2511248361 | 229 |
| 14 | iso_pu_bacteria | 2842711865 | 2842714206 | 229 |
| 15 | 3300006844 | Ga0075428_100026987 | Ga0075428_1000269876 | 230 |
| 16 | 3300009093 | Ga0105240_10000018 | Ga0105240_10000018253 | 230 |
| 17 | 3300025913 | Ga0207695_10000141 | Ga0207695_1000014130 | 230 |
| 18 | 3300030760 | Ga0265762_1026356 | Ga0265762_10263562 | 230 |
| 19 | 3300045836 | Ga0466958_0024051 | Ga0466958_0024051_65_787 | 230 |
| 20 | 3300049571 | Ga0501034_0561658 | Ga0501034_0561658_199_894 | 230 |
| 21 | 3300049742 | Ga0501080_0134538 | Ga0501080_0134538_1222_1944 | 230 |
| 22 | iso_pu_bacteria | 2821131069 | 2821131442 | 230 |
| 23 | 3300003856 | Ga0058692_1000291 | Ga0058692_100029112 | 231 |
| 24 | 3300003856 | Ga0058692_1000709 | Ga0058692_10007096 | 231 |
| 25 | 3300003856 | Ga0058692_1021849 | Ga0058692_10218491 | 231 |
| 26 | 3300005563 | Ga0068855_100004153 | Ga0068855_10000415312 | 231 |
| 27 | 3300005985 | Ga0081539_10036407 | Ga0081539_100364074 | 231 |
| 28 | 3300009093 | Ga0105240_10135970 | Ga0105240_101359701 | 231 |
| 29 | 3300009147 | Ga0114129_10036550 | Ga0114129_100365505 | 231 |
| 30 | 3300009551 | Ga0105238_10350795 | Ga0105238_103507952 | 231 |
| 31 | 3300025924 | Ga0207694_10245175 | Ga0207694_102451751 | 231 |
| 32 | 3300025949 | Ga0207667_10036229 | Ga0207667_100362292 | 231 |
| 33 | 3300027312 | Ga0209371_1000061 | Ga0209371_1000061133 | 231 |
| 34 | 3300027312 | Ga0209371_1002070 | Ga0209371_10020703 | 231 |
| 35 | 3300030500 | Ga0268256_1000059 | Ga0268256_100005981 | 231 |
| 36 | 3300030500 | Ga0268256_1018546 | Ga0268256_10185462 | 231 |
| 37 | 3300035398 | Ga0316574_0000112 | Ga0316574_0000112_18435_19133 | 231 |
| 38 | 3300044842 | Ga0466957_0026464 | Ga0466957_0026464_320_1015 | 231 |
| 39 | 3300049571 | Ga0501034_0147518 | Ga0501034_0147518_1163_1858 | 231 |
| 40 | 3300049572 | Ga0501036_0726482 | Ga0501036_0726482_78_773 | 231 |
| 41 | 3300049581 | Ga0501047_0109754 | Ga0501047_0109754_797_1492 | 231 |
| 42 | 3300049742 | Ga0501080_0961927 | Ga0501080_0961927_12_707 | 231 |
| 43 | 3300049744 | Ga0501083_0376226 | Ga0501083_0376226_131_826 | 231 |
| 44 | 3300049823 | Ga0501044_0001012 | Ga0501044_0001012_18224_18919 | 231 |
| 45 | 3300005327 | Ga0070658_10047104 | Ga0070658_100471043 | 232 |
| 46 | 3300005329 | Ga0070683_100106764 | Ga0070683_1001067643 | 232 |
| 47 | 3300005330 | Ga0070690_100028859 | Ga0070690_1000288593 | 232 |
| 48 | 3300005334 | Ga0068869_100025409 | Ga0068869_1000254091 | 232 |
| 49 | 3300005335 | Ga0070666_10144908 | Ga0070666_101449082 | 232 |
| 50 | 3300005338 | Ga0068868_100005504 | Ga0068868_1000055044 | 232 |
| 51 | 3300005340 | Ga0070689_100881408 | Ga0070689_1008814081 | 232 |
| 52 | 3300005344 | Ga0070661_100028850 | Ga0070661_1000288505 | 232 |
| 53 | 3300005345 | Ga0070692_10277711 | Ga0070692_102777112 | 232 |
| 54 | 3300005355 | Ga0070671_100009337 | Ga0070671_1000093374 | 232 |
| 55 | 3300005364 | Ga0070673_100000141 | Ga0070673_1000001418 | 232 |
| 56 | 3300005436 | Ga0070713_100491184 | Ga0070713_1004911842 | 232 |
| 57 | 3300005440 | Ga0070705_100390213 | Ga0070705_1003902131 | 232 |
| 58 | 3300005445 | Ga0070708_100201248 | Ga0070708_1002012482 | 232 |
| 59 | 3300005455 | Ga0070663_100007884 | Ga0070663_1000078845 | 232 |
| 60 | 3300005458 | Ga0070681_10229550 | Ga0070681_102295503 | 232 |
| 61 | 3300005458 | Ga0070681_10316342 | Ga0070681_103163422 | 232 |
| 62 | 3300005458 | Ga0070681_10454036 | Ga0070681_104540362 | 232 |
| 63 | 3300005466 | Ga0070685_10002403 | Ga0070685_100024034 | 232 |
| 64 | 3300005467 | Ga0070706_100074654 | Ga0070706_1000746542 | 232 |
| 65 | 3300005467 | Ga0070706_100091055 | Ga0070706_1000910553 | 232 |
| 66 | 3300005467 | Ga0070706_100579633 | Ga0070706_1005796332 | 232 |
| 67 | 3300005468 | Ga0070707_100047627 | Ga0070707_1000476274 | 232 |
| 68 | 3300005468 | Ga0070707_100296416 | Ga0070707_1002964162 | 232 |
| 69 | 3300005471 | Ga0070698_100011515 | Ga0070698_1000115156 | 232 |
| 70 | 3300005471 | Ga0070698_100182678 | Ga0070698_1001826782 | 232 |
| 71 | 3300005471 | Ga0070698_100214916 | Ga0070698_1002149162 | 232 |
| 72 | 3300005518 | Ga0070699_100037018 | Ga0070699_1000370185 | 232 |
| 73 | 3300005536 | Ga0070697_100106965 | Ga0070697_1001069654 | 232 |
| 74 | 3300005536 | Ga0070697_100155673 | Ga0070697_1001556732 | 232 |
| 75 | 3300005536 | Ga0070697_100273077 | Ga0070697_1002730771 | 232 |
| 76 | 3300005539 | Ga0068853_100024171 | Ga0068853_1000241713 | 232 |
| 77 | 3300005539 | Ga0068853_100140920 | Ga0068853_1001409203 | 232 |
| 78 | 3300005545 | Ga0070695_100024027 | Ga0070695_1000240275 | 232 |
| 79 | 3300005545 | Ga0070695_100086364 | Ga0070695_1000863641 | 232 |
| 80 | 3300005546 | Ga0070696_100711050 | Ga0070696_1007110501 | 232 |
| 81 | 3300005547 | Ga0070693_100026364 | Ga0070693_1000263642 | 232 |
| 82 | 3300005549 | Ga0070704_100036073 | Ga0070704_1000360734 | 232 |
| 83 | 3300005563 | Ga0068855_100356754 | Ga0068855_1003567542 | 232 |
| 84 | 3300005578 | Ga0068854_100000001 | Ga0068854_100000001318 | 232 |
| 85 | 3300005614 | Ga0068856_100169576 | Ga0068856_1001695762 | 232 |
| 86 | 3300005614 | Ga0068856_100323564 | Ga0068856_1003235642 | 232 |
| 87 | 3300005614 | Ga0068856_100727060 | Ga0068856_1007270601 | 232 |
| 88 | 3300005617 | Ga0068859_100005189 | Ga0068859_10000518913 | 232 |
| 89 | 3300005618 | Ga0068864_100000917 | Ga0068864_10000091719 | 232 |
| 90 | 3300005841 | Ga0068863_100000513 | Ga0068863_10000051320 | 232 |
| 91 | 3300005842 | Ga0068858_100001759 | Ga0068858_1000017592 | 232 |
| 92 | 3300005843 | Ga0068860_100005306 | Ga0068860_10000530611 | 232 |
| 93 | 3300006028 | Ga0070717_10116035 | Ga0070717_101160353 | 232 |
| 94 | 3300006028 | Ga0070717_10343343 | Ga0070717_103433432 | 232 |
| 95 | 3300006163 | Ga0070715_10058956 | Ga0070715_100589562 | 232 |
| 96 | 3300006173 | Ga0070716_100100769 | Ga0070716_1001007692 | 232 |
| 97 | 3300006237 | Ga0097621_100004565 | Ga0097621_1000045656 | 232 |
| 98 | 3300006237 | Ga0097621_100489273 | Ga0097621_1004892732 | 232 |
| 99 | 3300006358 | Ga0068871_100015616 | Ga0068871_1000156164 | 232 |
| 100 | 3300006852 | Ga0075433_10039977 | Ga0075433_100399773 | 232 |
| 101 | 3300006871 | Ga0075434_100033336 | Ga0075434_1000333364 | 232 |
| 102 | 3300006914 | Ga0075436_100069460 | Ga0075436_1000694602 | 232 |
| 103 | 3300006931 | Ga0097620_100005190 | Ga0097620_10000519013 | 232 |
| 104 | 3300007076 | Ga0075435_100019214 | Ga0075435_1000192142 | 232 |
| 105 | 3300007788 | Ga0099795_10143964 | Ga0099795_101439641 | 232 |
| 106 | 3300009093 | Ga0105240_10137945 | Ga0105240_101379452 | 232 |
| 107 | 3300009093 | Ga0105240_10175872 | Ga0105240_101758723 | 232 |
| 108 | 3300009093 | Ga0105240_10701646 | Ga0105240_107016462 | 232 |
| 109 | 3300009098 | Ga0105245_10002409 | Ga0105245_1000240913 | 232 |
| 110 | 3300009098 | Ga0105245_10008952 | Ga0105245_100089525 | 232 |
| 111 | 3300009098 | Ga0105245_10267409 | Ga0105245_102674093 | 232 |
| 112 | 3300009098 | Ga0105245_10338506 | Ga0105245_103385062 | 232 |
| 113 | 3300009101 | Ga0105247_10013569 | Ga0105247_100135694 | 232 |
| 114 | 3300009147 | Ga0114129_10039913 | Ga0114129_100399137 | 232 |
| 115 | 3300009147 | Ga0114129_10160674 | Ga0114129_101606742 | 232 |
| 116 | 3300009174 | Ga0105241_10540192 | Ga0105241_105401921 | 232 |
| 117 | 3300009176 | Ga0105242_10629794 | Ga0105242_106297942 | 232 |
| 118 | 3300009177 | Ga0105248_10001779 | Ga0105248_100017793 | 232 |
| 119 | 3300009551 | Ga0105238_10779829 | Ga0105238_107798291 | 232 |
| 120 | 3300010375 | Ga0105239_10215416 | Ga0105239_102154162 | 232 |
| 121 | 3300013296 | Ga0157374_10167559 | Ga0157374_101675593 | 232 |
| 122 | 3300013297 | Ga0157378_10281001 | Ga0157378_102810012 | 232 |
| 123 | 3300013306 | Ga0163162_10002679 | Ga0163162_1000267913 | 232 |
| 124 | 3300014326 | Ga0157380_10053974 | Ga0157380_100539742 | 232 |
| 125 | 3300014968 | Ga0157379_10031675 | Ga0157379_100316753 | 232 |
| 126 | 3300014968 | Ga0157379_10128366 | Ga0157379_101283663 | 232 |
| 127 | 3300025900 | Ga0207710_10010419 | Ga0207710_100104194 | 232 |
| 128 | 3300025903 | Ga0207680_10018401 | Ga0207680_100184012 | 232 |
| 129 | 3300025903 | Ga0207680_10473374 | Ga0207680_104733742 | 232 |
| 130 | 3300025909 | Ga0207705_10036448 | Ga0207705_100364482 | 232 |
| 131 | 3300025910 | Ga0207684_10026476 | Ga0207684_100264764 | 232 |
| 132 | 3300025910 | Ga0207684_10258163 | Ga0207684_102581632 | 232 |
| 133 | 3300025912 | Ga0207707_10166487 | Ga0207707_101664872 | 232 |
| 134 | 3300025915 | Ga0207693_10219465 | Ga0207693_102194653 | 232 |
| 135 | 3300025920 | Ga0207649_10087076 | Ga0207649_100870763 | 232 |
| 136 | 3300025922 | Ga0207646_10037926 | Ga0207646_100379264 | 232 |
| 137 | 3300025925 | Ga0207650_10151889 | Ga0207650_101518891 | 232 |
| 138 | 3300025927 | Ga0207687_10001314 | Ga0207687_100013145 | 232 |
| 139 | 3300025927 | Ga0207687_10013870 | Ga0207687_100138704 | 232 |
| 140 | 3300025928 | Ga0207700_10179425 | Ga0207700_101794251 | 232 |
| 141 | 3300025929 | Ga0207664_10250962 | Ga0207664_102509622 | 232 |
| 142 | 3300025931 | Ga0207644_10148774 | Ga0207644_101487742 | 232 |
| 143 | 3300025936 | Ga0207670_10016823 | Ga0207670_100168232 | 232 |
| 144 | 3300025939 | Ga0207665_10094081 | Ga0207665_100940813 | 232 |
| 145 | 3300025941 | Ga0207711_10209509 | Ga0207711_102095092 | 232 |
| 146 | 3300025981 | Ga0207640_10000003 | Ga0207640_1000000391 | 232 |
| 147 | 3300026023 | Ga0207677_10000312 | Ga0207677_1000031229 | 232 |
| 148 | 3300026035 | Ga0207703_10011122 | Ga0207703_100111221 | 232 |
| 149 | 3300026041 | Ga0207639_10077869 | Ga0207639_100778693 | 232 |
| 150 | 3300026067 | Ga0207678_10000769 | Ga0207678_1000076922 | 232 |
| 151 | 3300026078 | Ga0207702_10102570 | Ga0207702_101025703 | 232 |
| 152 | 3300026078 | Ga0207702_10475188 | Ga0207702_104751882 | 232 |
| 153 | 3300026078 | Ga0207702_10575720 | Ga0207702_105757201 | 232 |
| 154 | 3300026088 | Ga0207641_10018610 | Ga0207641_100186104 | 232 |
| 155 | 3300026095 | Ga0207676_10061410 | Ga0207676_100614103 | 232 |
| 156 | 3300026142 | Ga0207698_10489196 | Ga0207698_104891961 | 232 |
| 157 | 3300028381 | Ga0268264_10002693 | Ga0268264_1000269314 | 232 |
| 158 | 3300028653 | Ga0265323_10003834 | Ga0265323_100038343 | 232 |
| 159 | 3300031901 | Ga0307406_10327634 | Ga0307406_103276341 | 232 |
| 160 | 3300035111 | Ga0373923_0115267 | Ga0373923_0115267_230_931 | 232 |
| 161 | 3300035111 | Ga0373923_0178355 | Ga0373923_0178355_217_924 | 232 |
| 162 | 3300035120 | Ga0373957_0007425 | Ga0373957_0007425_2625_3326 | 232 |
| 163 | 3300035172 | Ga0373955_0013903 | Ga0373955_0013903_1302_2009 | 232 |
| 164 | 3300035410 | Ga0373924_0047722 | Ga0373924_0047722_565_1266 | 232 |
| 165 | 3300035691 | Ga0373931_0109525 | Ga0373931_0109525_760_1458 | 232 |
| 166 | 3300035695 | Ga0373927_0043621 | Ga0373927_0043621_146_847 | 232 |
| 167 | 3300035695 | Ga0373927_0171280 | Ga0373927_0171280_187_894 | 232 |
| 168 | 3300036401 | Ga0373937_0018691 | Ga0373937_0018691_980_1687 | 232 |
| 169 | 3300036401 | Ga0373937_0054333 | Ga0373937_0054333_2015_2722 | 232 |
| 170 | 3300036401 | Ga0373937_0480549 | Ga0373937_0480549_369_1067 | 232 |
| 171 | 3300036401 | Ga0373937_0748473 | Ga0373937_0748473_37_735 | 232 |
| 172 | 3300036401 | Ga0373937_0982749 | Ga0373937_0982749_53_754 | 232 |
| 173 | 3300037068 | Ga0373925_0019595 | Ga0373925_0019595_3904_4605 | 232 |
| 174 | 3300037418 | Ga0395900_0392285 | Ga0395900_0392285_402_1100 | 232 |
| 175 | 3300042005 | Ga0439448_0045545 | Ga0439448_0045545_29_736 | 232 |
| 176 | 3300042129 | Ga0450891_005710 | Ga0450891_005710_172_870 | 232 |
| 177 | 3300042876 | Ga0451577_0494765 | Ga0451577_0494765_321_1019 | 232 |
| 178 | 3300044712 | Ga0453684_0539919 | Ga0453684_0539919_401_1102 | 232 |
| 179 | 3300044842 | Ga0466957_0002291 | Ga0466957_0002291_2080_2787 | 232 |
| 180 | 3300045976 | Ga0466967_0934065 | Ga0466967_0934065_139_837 | 232 |
| 181 | 3300046462 | Ga0495651_0098527 | Ga0495651_0098527_478_1185 | 232 |
| 182 | 3300046477 | Ga0495664_0004899 | Ga0495664_0004899_989_1690 | 232 |
| 183 | 3300046516 | Ga0495628_0103038 | Ga0495628_0103038_938_1639 | 232 |
| 184 | 3300046533 | Ga0495640_0060018 | Ga0495640_0060018_1411_2112 | 232 |
| 185 | 3300046543 | Ga0495645_0014763 | Ga0495645_0014763_1880_2581 | 232 |
| 186 | 3300046543 | Ga0495645_0230457 | Ga0495645_0230457_13_714 | 232 |
| 187 | 3300046681 | Ga0495647_0067293 | Ga0495647_0067293_486_1187 | 232 |
| 188 | 3300048903 | Ga0496100_0451671 | Ga0496100_0451671_225_932 | 232 |
| 189 | 3300048905 | Ga0496102_0010929 | Ga0496102_0010929_183_890 | 232 |
| 190 | 3300048907 | Ga0496104_0346523 | Ga0496104_0346523_200_904 | 232 |
| 191 | 3300048908 | Ga0496105_0038601 | Ga0496105_0038601_211_918 | 232 |
| 192 | 3300048910 | Ga0496107_0107789 | Ga0496107_0107789_105_806 | 232 |
| 193 | 3300048913 | Ga0496110_0024981 | Ga0496110_0024981_2781_3488 | 232 |
| 194 | 3300048914 | Ga0496111_0003347 | Ga0496111_0003347_7329_8036 | 232 |
| 195 | 3300048915 | Ga0496112_0002221 | Ga0496112_0002221_14266_14967 | 232 |
| 196 | 3300048915 | Ga0496112_0046538 | Ga0496112_0046538_318_1022 | 232 |
| 197 | 3300048915 | Ga0496112_0683793 | Ga0496112_0683793_138_845 | 232 |
| 198 | 3300048916 | Ga0496113_0104887 | Ga0496113_0104887_809_1516 | 232 |
| 199 | 3300048918 | Ga0496115_0046841 | Ga0496115_0046841_62_763 | 232 |
| 200 | 3300048918 | Ga0496115_0138212 | Ga0496115_0138212_100_804 | 232 |
| 201 | 3300048929 | Ga0496126_0000231 | Ga0496126_0000231_13111_13815 | 232 |
| 202 | 3300049539 | Ga0501323_026524 | Ga0501323_026524_50_748 | 232 |
| 203 | 3300049581 | Ga0501047_0591437 | Ga0501047_0591437_158_859 | 232 |
| 204 | 3300049742 | Ga0501080_0714055 | Ga0501080_0714055_37_738 | 232 |
| 205 | 3300050492 | nmdc:mga0yw44_64083_c1 | nmdc:mga0yw44_64083_c1_297_998 | 232 |
| 206 | 3300050511 | nmdc:mga08y16_29818_c1 | nmdc:mga08y16_29818_c1_2797_3495 | 232 |
| 207 | 3300050512 | nmdc:mga0n895_88189_c1 | nmdc:mga0n895_88189_c1_1534_2235 | 232 |
| 208 | 3300050513 | nmdc:mga0rr50_15500_c1 | nmdc:mga0rr50_15500_c1_1603_2304 | 232 |
| 209 | 3300050514 | nmdc:mga08x19_33518_c1 | nmdc:mga08x19_33518_c1_724_1425 | 232 |
| 210 | 3300050515 | nmdc:mga0a205_33910_c1 | nmdc:mga0a205_33910_c1_2005_2706 | 232 |
| 211 | 3300053077 | Ga0495601_0007434 | Ga0495601_0007434_1315_2022 | 232 |
| 212 | 3300003322 | rootL2_10162574 | rootL2_101625742 | 233 |
| 213 | 3300003771 | Ga0055526_1000180 | Ga0055526_100018018 | 233 |
| 214 | 3300005335 | Ga0070666_10006014 | Ga0070666_100060147 | 233 |
| 215 | 3300005344 | Ga0070661_100036407 | Ga0070661_1000364074 | 233 |
| 216 | 3300005347 | Ga0070668_100018057 | Ga0070668_1000180575 | 233 |
| 217 | 3300005365 | Ga0070688_100270959 | Ga0070688_1002709591 | 233 |
| 218 | 3300005367 | Ga0070667_100083824 | Ga0070667_1000838244 | 233 |
| 219 | 3300005367 | Ga0070667_100478708 | Ga0070667_1004787082 | 233 |
| 220 | 3300005445 | Ga0070708_100079876 | Ga0070708_1000798763 | 233 |
| 221 | 3300005455 | Ga0070663_100022801 | Ga0070663_1000228014 | 233 |
| 222 | 3300005466 | Ga0070685_10002790 | Ga0070685_100027908 | 233 |
| 223 | 3300005548 | Ga0070665_100000266 | Ga0070665_10000026669 | 233 |
| 224 | 3300005564 | Ga0070664_100874524 | Ga0070664_1008745241 | 233 |
| 225 | 3300005578 | Ga0068854_100022639 | Ga0068854_1000226392 | 233 |
| 226 | 3300005616 | Ga0068852_100044907 | Ga0068852_1000449073 | 233 |
| 227 | 3300005616 | Ga0068852_100097887 | Ga0068852_1000978873 | 233 |
| 228 | 3300005834 | Ga0068851_10003540 | Ga0068851_100035404 | 233 |
| 229 | 3300005842 | Ga0068858_100021689 | Ga0068858_1000216892 | 233 |
| 230 | 3300006353 | Ga0075370_10172203 | Ga0075370_101722032 | 233 |
| 231 | 3300009036 | Ga0105244_10017785 | Ga0105244_100177853 | 233 |
| 232 | 3300009093 | Ga0105240_10000377 | Ga0105240_1000037710 | 233 |
| 233 | 3300009177 | Ga0105248_10215872 | Ga0105248_102158723 | 233 |
| 234 | 3300009177 | Ga0105248_10544207 | Ga0105248_105442072 | 233 |
| 235 | 3300009545 | Ga0105237_10086872 | Ga0105237_100868723 | 233 |
| 236 | 3300009551 | Ga0105238_10006002 | Ga0105238_100060025 | 233 |
| 237 | 3300009551 | Ga0105238_10106903 | Ga0105238_101069032 | 233 |
| 238 | 3300009553 | Ga0105249_10001046 | Ga0105249_1000104623 | 233 |
| 239 | 3300013104 | Ga0157370_10171353 | Ga0157370_101713532 | 233 |
| 240 | 3300013105 | Ga0157369_10076866 | Ga0157369_100768663 | 233 |
| 241 | 3300013307 | Ga0157372_10119090 | Ga0157372_101190903 | 233 |
| 242 | 3300013307 | Ga0157372_10756115 | Ga0157372_107561151 | 233 |
| 243 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009333 | 233 |
| 244 | 3300025321 | Ga0207656_10004236 | Ga0207656_100042364 | 233 |
| 245 | 3300025728 | Ga0207655_1042915 | Ga0207655_10429153 | 233 |
| 246 | 3300025903 | Ga0207680_10004781 | Ga0207680_100047815 | 233 |
| 247 | 3300025904 | Ga0207647_10001123 | Ga0207647_1000112317 | 233 |
| 248 | 3300025904 | Ga0207647_10005424 | Ga0207647_100054243 | 233 |
| 249 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007174 | 233 |
| 250 | 3300025913 | Ga0207695_10017795 | Ga0207695_100177956 | 233 |
| 251 | 3300025914 | Ga0207671_10013102 | Ga0207671_100131025 | 233 |
| 252 | 3300025920 | Ga0207649_10219175 | Ga0207649_102191752 | 233 |
| 253 | 3300025924 | Ga0207694_10000996 | Ga0207694_1000099621 | 233 |
| 254 | 3300025924 | Ga0207694_10002131 | Ga0207694_100021316 | 233 |
| 255 | 3300025925 | Ga0207650_10004121 | Ga0207650_100041215 | 233 |
| 256 | 3300025941 | Ga0207711_10380127 | Ga0207711_103801272 | 233 |
| 257 | 3300025961 | Ga0207712_10000349 | Ga0207712_1000034912 | 233 |
| 258 | 3300025972 | Ga0207668_10010539 | Ga0207668_100105395 | 233 |
| 259 | 3300025981 | Ga0207640_10099922 | Ga0207640_100999222 | 233 |
| 260 | 3300025986 | Ga0207658_10164602 | Ga0207658_101646022 | 233 |
| 261 | 3300025986 | Ga0207658_10166824 | Ga0207658_101668243 | 233 |
| 262 | 3300026035 | Ga0207703_10005588 | Ga0207703_100055882 | 233 |
| 263 | 3300026041 | Ga0207639_10000102 | Ga0207639_1000010255 | 233 |
| 264 | 3300026067 | Ga0207678_10023453 | Ga0207678_100234533 | 233 |
| 265 | 3300026078 | Ga0207702_10780041 | Ga0207702_107800412 | 233 |
| 266 | 3300026142 | Ga0207698_10008725 | Ga0207698_100087255 | 233 |
| 267 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006533 | 233 |
| 268 | 3300028794 | Ga0307515_10494513 | Ga0307515_104945131 | 233 |
| 269 | 3300031456 | Ga0307513_10191691 | Ga0307513_101916912 | 233 |
| 270 | 3300037471 | Ga0395905_0583857 | Ga0395905_0583857_90_791 | 233 |
| 271 | 3300037853 | Ga0436364_1550326 | Ga0436364_1550326_3359_4099 | 233 |
| 272 | 3300044658 | Ga0466972_0001438 | Ga0466972_0001438_9455_10156 | 233 |
| 273 | 3300044658 | Ga0466972_0118302 | Ga0466972_0118302_269_976 | 233 |
| 274 | 3300044765 | Ga0466970_0000972 | Ga0466970_0000972_1140_1841 | 233 |
| 275 | 3300046471 | Ga0495650_0000166 | Ga0495650_0000166_129892_130593 | 233 |
| 276 | 3300046474 | Ga0495605_0000059 | Ga0495605_0000059_133690_134442 | 233 |
| 277 | 3300046506 | Ga0495583_0134277 | Ga0495583_0134277_215_922 | 233 |
| 278 | 3300046507 | Ga0495606_0000064 | Ga0495606_0000064_162056_162757 | 233 |
| 279 | 3300046512 | Ga0495610_0002878 | Ga0495610_0002878_12668_13369 | 233 |
| 280 | 3300046558 | Ga0495633_0183968 | Ga0495633_0183968_247_948 | 233 |
| 281 | 3300046616 | Ga0495668_0001239 | Ga0495668_0001239_3693_4394 | 233 |
| 282 | 3300046616 | Ga0495668_0028854 | Ga0495668_0028854_1011_1718 | 233 |
| 283 | 3300046665 | Ga0495661_0017821 | Ga0495661_0017821_510_1271 | 233 |
| 284 | 3300046691 | Ga0495670_0007113 | Ga0495670_0007113_390_1118 | 233 |
| 285 | 3300048921 | Ga0496118_0063083 | Ga0496118_0063083_762_1463 | 233 |
| 286 | 3300048927 | Ga0496124_0071977 | Ga0496124_0071977_510_1211 | 233 |
| 287 | 3300048927 | Ga0496124_0247434 | Ga0496124_0247434_576_1277 | 233 |
| 288 | 3300048927 | Ga0496124_0481868 | Ga0496124_0481868_53_754 | 233 |
| 289 | 3300048929 | Ga0496126_0114455 | Ga0496126_0114455_162_863 | 233 |
| 290 | 3300049537 | Ga0501321_015971 | Ga0501321_015971_56_757 | 233 |
| 291 | 3300049539 | Ga0501323_013172 | Ga0501323_013172_172_873 | 233 |
| 292 | 3300005365 | Ga0070688_100225560 | Ga0070688_1002255602 | 234 |
| 293 | 3300005435 | Ga0070714_100003209 | Ga0070714_1000032098 | 234 |
| 294 | 3300005456 | Ga0070678_100118604 | Ga0070678_1001186042 | 234 |
| 295 | 3300005840 | Ga0068870_10018451 | Ga0068870_100184513 | 234 |
| 296 | 3300006237 | Ga0097621_100543437 | Ga0097621_1005434372 | 234 |
| 297 | 3300025929 | Ga0207664_10003413 | Ga0207664_100034135 | 234 |
| 298 | 3300025936 | Ga0207670_10371508 | Ga0207670_103715082 | 234 |
| 299 | 3300031727 | Ga0316576_10096584 | Ga0316576_100965842 | 234 |
| 300 | 3300031728 | Ga0316578_10102308 | Ga0316578_101023082 | 234 |
| 301 | 3300036712 | Ga0316584_0102676 | Ga0316584_0102676_1374_2081 | 234 |
| 302 | 3300039438 | Ga0436360_1282181 | Ga0436360_1282181_11282_11995 | 234 |
| 303 | 3300039447 | Ga0436361_0430826 | Ga0436361_0430826_1447_2160 | 234 |
| 304 | 3300045836 | Ga0466958_0170227 | Ga0466958_0170227_63_797 | 234 |
| 305 | 3300046463 | Ga0495653_0000409 | Ga0495653_0000409_12766_13470 | 234 |
| 306 | 3300046471 | Ga0495650_0000503 | Ga0495650_0000503_23237_24019 | 234 |
| 307 | 3300046507 | Ga0495606_0000156 | Ga0495606_0000156_100166_100870 | 234 |
| 308 | 3300046524 | Ga0495648_0000675 | Ga0495648_0000675_10131_10913 | 234 |
| 309 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_229570_230352 | 234 |
| 310 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1466139_1466843 | 234 |
| 311 | 3300048919 | Ga0496116_0242214 | Ga0496116_0242214_44_748 | 234 |
| 312 | 3300048921 | Ga0496118_0297227 | Ga0496118_0297227_42_758 | 234 |
| 313 | 3300048926 | Ga0496123_0004114 | Ga0496123_0004114_14797_15513 | 234 |
| 314 | 3300048929 | Ga0496126_0067531 | Ga0496126_0067531_2414_3118 | 234 |
| 315 | 3300053118 | Ga0500594_0102160 | Ga0500594_0102160_108_812 | 234 |
| 316 | 3300053125 | Ga0500618_000108 | Ga0500618_000108_31678_32382 | 234 |
| 317 | 3300005843 | Ga0068860_100148933 | Ga0068860_1001489333 | 235 |
| 318 | 3300028381 | Ga0268264_10632363 | Ga0268264_106323632 | 235 |
| 319 | 3300046457 | Ga0495590_0002911 | Ga0495590_0002911_5393_6100 | 235 |
| 320 | 3300046507 | Ga0495606_0039372 | Ga0495606_0039372_544_1251 | 235 |
| 321 | 3300048927 | Ga0496124_0000317 | Ga0496124_0000317_39210_39917 | 235 |
| 322 | 3300048928 | Ga0496125_0010015 | Ga0496125_0010015_3289_3996 | 235 |
| 323 | iso_pu_bacteria | 2513020051 | 2513228123 | 235 |
| 324 | iso_pu_bacteria | 2643221658 | 2644325632 | 235 |
| 325 | iso_pu_bacteria | 2643221672 | 2644400979 | 235 |
| 326 | iso_pu_bacteria | 2734482258 | 2735816510 | 235 |
| 327 | iso_pu_bacteria | 2738541307 | 2738883212 | 235 |
| 328 | iso_pu_bacteria | 2842677519 | 2842679538 | 235 |
| 329 | iso_pu_bacteria | 2842733646 | 2842733954 | 235 |
| 330 | iso_pu_bacteria | 2842747753 | 2842749756 | 235 |
| 331 | iso_pu_bacteria | 2904434214 | 2904439361 | 235 |
| 332 | iso_pu_bacteria | 2904541872 | 2904546086 | 235 |
| 333 | iso_pu_bacteria | 2919462493 | 2919462498 | 235 |
| 334 | iso_pu_bacteria | 2929520902 | 2929523220 | 235 |
| 335 | iso_pu_bacteria | 2945945610 | 2945948694 | 235 |
| 336 | iso_pu_bacteria | 2945972063 | 2945972327 | 235 |
| 337 | 3300037853 | Ga0436364_1091802 | Ga0436364_1091802_102_845 | 236 |
| 338 | iso_pu_bacteria | 2842718218 | 2842722236 | 236 |
| 339 | iso_pu_bacteria | 2974320154 | 2974320900 | 236 |
| 340 | iso_pu_bacteria | 3007315729 | 3007319500 | 236 |
| 341 | iso_pu_bacteria | 2508501125 | 2509128319 | 237 |
| 342 | iso_pu_bacteria | 2512047030 | 2512350534 | 237 |
| 343 | iso_pu_bacteria | 2513237151 | 2513958887 | 237 |
| 344 | iso_pu_bacteria | 2515154122 | 2515682985 | 237 |
| 345 | iso_pu_bacteria | 2519103095 | 2519463292 | 237 |
| 346 | iso_pu_bacteria | 2526164713 | 2527076165 | 237 |
| 347 | iso_pu_bacteria | 2547132374 | 2548499543 | 237 |
| 348 | iso_pu_bacteria | 2582581311 | 2585295110 | 237 |
| 349 | iso_pu_bacteria | 2599185239 | 2599738904 | 237 |
| 350 | iso_pu_bacteria | 2643221570 | 2643866381 | 237 |
| 351 | iso_pu_bacteria | 2643221596 | 2643994371 | 237 |
| 352 | iso_pu_bacteria | 2643221717 | 2644648209 | 237 |
| 353 | iso_pu_bacteria | 2751185846 | 2753568119 | 237 |
| 354 | iso_pu_bacteria | 2808606384 | 2808970990 | 237 |
| 355 | iso_pu_bacteria | 2808606390 | 2809005821 | 237 |
| 356 | iso_pu_bacteria | 2808606391 | 2809012422 | 237 |
| 357 | iso_pu_bacteria | 2816332253 | 2817263334 | 237 |
| 358 | iso_pu_bacteria | 2816332256 | 2817276715 | 237 |
| 359 | iso_pu_bacteria | 2816332286 | 2817452787 | 237 |
| 360 | iso_pu_bacteria | 2818991450 | 2819621493 | 237 |
| 361 | iso_pu_bacteria | 2818991452 | 2819631477 | 237 |
| 362 | iso_pu_bacteria | 2842454564 | 2842461081 | 237 |
| 363 | iso_pu_bacteria | 2902682994 | 2902684203 | 237 |
| 364 | iso_pu_bacteria | 2904483920 | 2904486225 | 237 |
| 365 | iso_pu_bacteria | 2919527303 | 2919527563 | 237 |
| 366 | iso_pu_bacteria | 2928108538 | 2928112022 | 237 |
| 367 | iso_pu_bacteria | 2928135762 | 2928139434 | 237 |
| 368 | iso_pu_bacteria | 2928157003 | 2928163587 | 237 |
| 369 | iso_pu_bacteria | 2928163908 | 2928166535 | 237 |
| 370 | iso_pu_bacteria | 2928170801 | 2928176053 | 237 |
| 371 | iso_pu_bacteria | 2928503688 | 2928508702 | 237 |
| 372 | iso_pu_bacteria | 2981990288 | 2981996502 | 237 |
| 373 | iso_pu_bacteria | 641736154 | 642415271 | 237 |
| 374 | iso_pu_bacteria | 8018845410 | 8018847210 | 237 |
| 375 | iso_pu_bacteria | 8020807995 | 8020812328 | 237 |
| 376 | iso_pu_bacteria | 8021120328 | 8021126069 | 237 |
| 377 | iso_pu_bacteria | 8040167225 | 8040172031 | 237 |
| 378 | iso_pu_bacteria | 8040173305 | 8040177998 | 237 |
| 379 | iso_pu_bacteria | 8055266321 | 8055269713 | 237 |
| 380 | iso_pu_bacteria | 8055301274 | 8055305976 | 237 |
| 381 | 3300005841 | Ga0068863_100757318 | Ga0068863_1007573182 | 238 |
| 382 | 3300002773 | JGI25152J39213_1000073 | JGI25152J39213_10000731 | 239 |
| 383 | 3300002773 | JGI25152J39213_1010358 | JGI25152J39213_10103582 | 239 |
| 384 | 3300002774 | JGI25150J39212_1000062 | JGI25150J39212_10000621 | 239 |
| 385 | 3300002987 | JGI25159J45721_1000212 | JGI25159J45721_100021239 | 239 |
| 386 | 3300003187 | JGI25151J46595_10000224 | JGI25151J46595_1000022461 | 239 |
| 387 | 3300003187 | JGI25151J46595_10000255 | JGI25151J46595_1000025569 | 239 |
| 388 | 3300003187 | JGI25151J46595_10001680 | JGI25151J46595_1000168015 | 239 |
| 389 | 3300003215 | JGI25153J46596_10000165 | JGI25153J46596_100001651 | 239 |
| 390 | 3300003354 | JGI25160J50197_1000410 | JGI25160J50197_100041039 | 239 |
| 391 | 3300003374 | JGI25161J50226_1000688 | JGI25161J50226_10006881 | 239 |
| 392 | 3300003578 | Ga0006562J51391_1071781 | Ga0006562J51391_10717811 | 239 |
| 393 | 3300003771 | Ga0055526_1000146 | Ga0055526_100014669 | 239 |
| 394 | 3300003773 | Ga0055537_1000090 | Ga0055537_10000901 | 239 |
| 395 | 3300003775 | Ga0055524_1000195 | Ga0055524_10001951 | 239 |
| 396 | 3300003781 | Ga0055536_1006008 | Ga0055536_10060086 | 239 |
| 397 | 3300003781 | Ga0055536_1051248 | Ga0055536_10512481 | 239 |
| 398 | 3300003784 | Ga0055534_1000101 | Ga0055534_10001011 | 239 |
| 399 | 3300003790 | Ga0055528_1000111 | Ga0055528_10001111 | 239 |
| 400 | 3300003791 | Ga0055530_10018270 | Ga0055530_100182702 | 239 |
| 401 | 3300003792 | Ga0055540_1000395 | Ga0055540_100039514 | 239 |
| 402 | 3300003792 | Ga0055540_1006726 | Ga0055540_10067262 | 239 |
| 403 | 3300003794 | Ga0055531_10000392 | Ga0055531_1000039228 | 239 |
| 404 | 3300003794 | Ga0055531_10007498 | Ga0055531_100074988 | 239 |
| 405 | 3300004625 | Ga0055543_1004715 | Ga0055543_10047152 | 239 |
| 406 | 3300005262 | Ga0065165_1001334 | Ga0065165_100133439 | 239 |
| 407 | 3300005367 | Ga0070667_100030394 | Ga0070667_1000303944 | 239 |
| 408 | 3300005456 | Ga0070678_100272330 | Ga0070678_1002723303 | 239 |
| 409 | 3300005457 | Ga0070662_100126021 | Ga0070662_1001260212 | 239 |
| 410 | 3300005539 | Ga0068853_100864020 | Ga0068853_1008640201 | 239 |
| 411 | 3300005577 | Ga0068857_100055881 | Ga0068857_1000558813 | 239 |
| 412 | 3300005578 | Ga0068854_100338832 | Ga0068854_1003388322 | 239 |
| 413 | 3300005844 | Ga0068862_100534488 | Ga0068862_1005344881 | 239 |
| 414 | 3300006048 | Ga0075363_100081017 | Ga0075363_1000810172 | 239 |
| 415 | 3300006195 | Ga0075366_10005365 | Ga0075366_100053656 | 239 |
| 416 | 3300006237 | Ga0097621_100174707 | Ga0097621_1001747072 | 239 |
| 417 | 3300006237 | Ga0097621_100367527 | Ga0097621_1003675272 | 239 |
| 418 | 3300006353 | Ga0075370_10006582 | Ga0075370_100065824 | 239 |
| 419 | 3300006353 | Ga0075370_10014671 | Ga0075370_100146715 | 239 |
| 420 | 3300006353 | Ga0075370_10104777 | Ga0075370_101047772 | 239 |
| 421 | 3300006358 | Ga0068871_100433141 | Ga0068871_1004331412 | 239 |
| 422 | 3300009036 | Ga0105244_10008569 | Ga0105244_100085695 | 239 |
| 423 | 3300009148 | Ga0105243_10009475 | Ga0105243_100094756 | 239 |
| 424 | 3300009148 | Ga0105243_10019008 | Ga0105243_100190084 | 239 |
| 425 | 3300009174 | Ga0105241_10345616 | Ga0105241_103456161 | 239 |
| 426 | 3300009176 | Ga0105242_10003387 | Ga0105242_100033872 | 239 |
| 427 | 3300009176 | Ga0105242_10181124 | Ga0105242_101811242 | 239 |
| 428 | 3300009551 | Ga0105238_10085881 | Ga0105238_100858812 | 239 |
| 429 | 3300010375 | Ga0105239_10092479 | Ga0105239_100924793 | 239 |
| 430 | 3300011119 | Ga0105246_10256633 | Ga0105246_102566332 | 239 |
| 431 | 3300013100 | Ga0157373_10086165 | Ga0157373_100861652 | 239 |
| 432 | 3300014497 | Ga0182008_10000846 | Ga0182008_100008468 | 239 |
| 433 | 3300014497 | Ga0182008_10001161 | Ga0182008_100011618 | 239 |
| 434 | 3300014497 | Ga0182008_10012263 | Ga0182008_100122634 | 239 |
| 435 | 3300014968 | Ga0157379_10880854 | Ga0157379_108808541 | 239 |
| 436 | 3300014969 | Ga0157376_10842966 | Ga0157376_108429661 | 239 |
| 437 | 3300015261 | Ga0182006_1006519 | Ga0182006_10065196 | 239 |
| 438 | 3300015261 | Ga0182006_1019783 | Ga0182006_10197832 | 239 |
| 439 | 3300015262 | Ga0182007_10001504 | Ga0182007_100015042 | 239 |
| 440 | 3300015262 | Ga0182007_10003696 | Ga0182007_100036964 | 239 |
| 441 | 3300017792 | Ga0163161_10021987 | Ga0163161_100219873 | 239 |
| 442 | 3300017792 | Ga0163161_10561864 | Ga0163161_105618641 | 239 |
| 443 | 3300025208 | Ga0209436_103651 | Ga0209436_1036512 | 239 |
| 444 | 3300025245 | Ga0207425_1000042 | Ga0207425_100004292 | 239 |
| 445 | 3300025258 | Ga0209129_1000058 | Ga0209129_100005898 | 239 |
| 446 | 3300025258 | Ga0209129_1000265 | Ga0209129_10002652 | 239 |
| 447 | 3300025263 | Ga0209565_1000027 | Ga0209565_1000027113 | 239 |
| 448 | 3300025273 | Ga0209673_1000031 | Ga0209673_1000031103 | 239 |
| 449 | 3300025284 | Ga0209130_1000025 | Ga0209130_1000025155 | 239 |
| 450 | 3300025291 | Ga0209675_1000064 | Ga0209675_100006487 | 239 |
| 451 | 3300025291 | Ga0209675_1018632 | Ga0209675_10186322 | 239 |
| 452 | 3300025292 | Ga0209676_1001283 | Ga0209676_10012833 | 239 |
| 453 | 3300025292 | Ga0209676_1013104 | Ga0209676_10131044 | 239 |
| 454 | 3300025294 | Ga0209025_1000075 | Ga0209025_1000075195 | 239 |
| 455 | 3300025294 | Ga0209025_1000204 | Ga0209025_10002042 | 239 |
| 456 | 3300025294 | Ga0209025_1000380 | Ga0209025_100038074 | 239 |
| 457 | 3300025295 | Ga0209564_1000040 | Ga0209564_1000040196 | 239 |
| 458 | 3300025297 | Ga0209758_1000050 | Ga0209758_1000050243 | 239 |
| 459 | 3300025298 | Ga0209050_1000704 | Ga0209050_100070428 | 239 |
| 460 | 3300025298 | Ga0209050_1003418 | Ga0209050_10034188 | 239 |
| 461 | 3300025299 | Ga0209256_1000023 | Ga0209256_1000023243 | 239 |
| 462 | 3300025302 | Ga0207426_1000118 | Ga0207426_1000118144 | 239 |
| 463 | 3300025303 | Ga0209051_1000186 | Ga0209051_100018626 | 239 |
| 464 | 3300025303 | Ga0209051_1001497 | Ga0209051_100149724 | 239 |
| 465 | 3300025304 | Ga0209257_1000188 | Ga0209257_100018888 | 239 |
| 466 | 3300025304 | Ga0209257_1000663 | Ga0209257_100066331 | 239 |
| 467 | 3300025728 | Ga0207655_1005414 | Ga0207655_10054146 | 239 |
| 468 | 3300025911 | Ga0207654_10296574 | Ga0207654_102965741 | 239 |
| 469 | 3300025923 | Ga0207681_10037631 | Ga0207681_100376312 | 239 |
| 470 | 3300025924 | Ga0207694_10142271 | Ga0207694_101422712 | 239 |
| 471 | 3300025933 | Ga0207706_10020233 | Ga0207706_100202336 | 239 |
| 472 | 3300025934 | Ga0207686_10096160 | Ga0207686_100961602 | 239 |
| 473 | 3300025935 | Ga0207709_10002070 | Ga0207709_100020705 | 239 |
| 474 | 3300025935 | Ga0207709_10037321 | Ga0207709_100373213 | 239 |
| 475 | 3300025960 | Ga0207651_10226527 | Ga0207651_102265272 | 239 |
| 476 | 3300025986 | Ga0207658_10015667 | Ga0207658_100156671 | 239 |
| 477 | 3300026116 | Ga0207674_10096035 | Ga0207674_100960352 | 239 |
| 478 | 3300026121 | Ga0207683_10116456 | Ga0207683_101164563 | 239 |
| 479 | 3300026121 | Ga0207683_10149316 | Ga0207683_101493161 | 239 |
| 480 | 3300028380 | Ga0268265_10558062 | Ga0268265_105580622 | 239 |
| 481 | 3300030731 | Ga0316177_1202970 | Ga0316177_12029703 | 239 |
| 482 | 3300030732 | Ga0316176_1038327 | Ga0316176_10383272 | 239 |
| 483 | 3300030733 | Ga0314311_1013956 | Ga0314311_10139565 | 239 |
| 484 | 3300030734 | Ga0316179_1016783 | Ga0316179_10167834 | 239 |
| 485 | 3300030735 | Ga0316178_1052877 | Ga0316178_10528774 | 239 |
| 486 | 3300030736 | Ga0316180_1157241 | Ga0316180_11572413 | 239 |
| 487 | 3300030745 | Ga0316182_1144941 | Ga0316182_11449416 | 239 |
| 488 | 3300031251 | Ga0265327_10123981 | Ga0265327_101239811 | 239 |
| 489 | 3300031731 | Ga0307405_10231930 | Ga0307405_102319302 | 239 |
| 490 | 3300031731 | Ga0307405_10276686 | Ga0307405_102766862 | 239 |
| 491 | 3300031824 | Ga0307413_10228412 | Ga0307413_102284121 | 239 |
| 492 | 3300031911 | Ga0307412_10199768 | Ga0307412_101997682 | 239 |
| 493 | 3300031911 | Ga0307412_10590161 | Ga0307412_105901611 | 239 |
| 494 | 3300032126 | Ga0307415_100262265 | Ga0307415_1002622652 | 239 |
| 495 | 3300041411 | Ga0439466_0112194 | Ga0439466_0112194_42_761 | 239 |
| 496 | 3300041505 | Ga0451849_0741869 | Ga0451849_0741869_527_1246 | 239 |
| 497 | 3300042006 | Ga0439432_074189 | Ga0439432_074189_142_861 | 239 |
| 498 | 3300042876 | Ga0451577_0002733 | Ga0451577_0002733_10590_11309 | 239 |
| 499 | 3300042876 | Ga0451577_0110531 | Ga0451577_0110531_802_1521 | 239 |
| 500 | 3300045051 | Ga0451576_0091674 | Ga0451576_0091674_2000_2719 | 239 |
| 501 | 3300046475 | Ga0495639_0006419 | Ga0495639_0006419_3959_4717 | 239 |
| 502 | 3300046516 | Ga0495628_0194233 | Ga0495628_0194233_100_819 | 239 |
| 503 | 3300046528 | Ga0495642_0008798 | Ga0495642_0008798_1269_1988 | 239 |
| 504 | 3300046528 | Ga0495642_0067361 | Ga0495642_0067361_234_953 | 239 |
| 505 | 3300046538 | Ga0495609_0128351 | Ga0495609_0128351_236_955 | 239 |
| 506 | 3300046615 | Ga0495656_0096274 | Ga0495656_0096274_434_1153 | 239 |
| 507 | 3300046663 | Ga0495635_0273744 | Ga0495635_0273744_118_876 | 239 |
| 508 | 3300046674 | Ga0495588_0066605 | Ga0495588_0066605_427_1185 | 239 |
| 509 | 3300046675 | Ga0495657_0186450 | Ga0495657_0186450_468_1187 | 239 |
| 510 | 3300046675 | Ga0495657_0190860 | Ga0495657_0190860_90_809 | 239 |
| 511 | 3300046689 | Ga0495613_0159416 | Ga0495613_0159416_455_1174 | 239 |
| 512 | 3300047321 | Ga0495676_0191593 | Ga0495676_0191593_194_913 | 239 |
| 513 | 3300047322 | Ga0495680_0112378 | Ga0495680_0112378_1191_1910 | 239 |
| 514 | 3300047673 | Ga0495593_0181831 | Ga0495593_0181831_97_855 | 239 |
| 515 | 3300048904 | Ga0496101_0020528 | Ga0496101_0020528_3776_4495 | 239 |
| 516 | 3300048905 | Ga0496102_0009970 | Ga0496102_0009970_3772_4491 | 239 |
| 517 | 3300048907 | Ga0496104_0026839 | Ga0496104_0026839_244_963 | 239 |
| 518 | 3300048908 | Ga0496105_0006554 | Ga0496105_0006554_3996_4715 | 239 |
| 519 | 3300048909 | Ga0496106_0009899 | Ga0496106_0009899_159_878 | 239 |
| 520 | 3300048910 | Ga0496107_0115560 | Ga0496107_0115560_1225_1944 | 239 |
| 521 | 3300048912 | Ga0496109_0148551 | Ga0496109_0148551_126_845 | 239 |
| 522 | 3300048913 | Ga0496110_0133499 | Ga0496110_0133499_841_1560 | 239 |
| 523 | 3300048914 | Ga0496111_0190122 | Ga0496111_0190122_26_745 | 239 |
| 524 | 3300048916 | Ga0496113_0364609 | Ga0496113_0364609_195_1055 | 239 |
| 525 | 3300048917 | Ga0496114_0103935 | Ga0496114_0103935_575_1294 | 239 |
| 526 | 3300048919 | Ga0496116_0008081 | Ga0496116_0008081_5950_6669 | 239 |
| 527 | 3300048920 | Ga0496117_0006969 | Ga0496117_0006969_10372_11091 | 239 |
| 528 | 3300048920 | Ga0496117_0065779 | Ga0496117_0065779_428_1147 | 239 |
| 529 | 3300048924 | Ga0496121_0053387 | Ga0496121_0053387_1676_2395 | 239 |
| 530 | 3300048924 | Ga0496121_0130554 | Ga0496121_0130554_463_1182 | 239 |
| 531 | 3300048925 | Ga0496122_0000383 | Ga0496122_0000383_73010_73729 | 239 |
| 532 | 3300048925 | Ga0496122_0304136 | Ga0496122_0304136_79_798 | 239 |
| 533 | 3300048926 | Ga0496123_0000249 | Ga0496123_0000249_20983_21702 | 239 |
| 534 | 3300048926 | Ga0496123_0082795 | Ga0496123_0082795_146_865 | 239 |
| 535 | 3300048926 | Ga0496123_0092781 | Ga0496123_0092781_831_1550 | 239 |
| 536 | 3300048928 | Ga0496125_0058594 | Ga0496125_0058594_756_1475 | 239 |
| 537 | 3300048929 | Ga0496126_0046950 | Ga0496126_0046950_380_1099 | 239 |
| 538 | 3300049586 | Ga0501070_0359636 | Ga0501070_0359636_56_775 | 239 |
| 539 | 3300049679 | Ga0501249_043114 | Ga0501249_043114_292_1011 | 239 |
| 540 | 3300049705 | Ga0501225_0028464 | Ga0501225_0028464_371_1090 | 239 |
| 541 | 3300049759 | Ga0501262_000117 | Ga0501262_000117_6958_7677 | 239 |
| 542 | 3300050490 | nmdc:mga03n38_154812_c1 | nmdc:mga03n38_154812_c1_122_841 | 239 |
| 543 | 3300050491 | nmdc:mga00v17_112546_c1 | nmdc:mga00v17_112546_c1_453_1172 | 239 |
| 544 | 3300050494 | nmdc:mga06z11_151583_c1 | nmdc:mga06z11_151583_c1_341_1060 | 239 |
| 545 | 3300050496 | nmdc:mga07m45_12158_c1 | nmdc:mga07m45_12158_c1_277_996 | 239 |
| 546 | 3300050496 | nmdc:mga07m45_32586_c1 | nmdc:mga07m45_32586_c1_539_1258 | 239 |
| 547 | 3300050516 | nmdc:mga0sz30_15762_c1 | nmdc:mga0sz30_15762_c1_415_1134 | 239 |
| 548 | 3300053125 | Ga0500618_017872 | Ga0500618_017872_281_1033 | 239 |
| 549 | 3300053136 | Ga0500559_0000906 | Ga0500559_0000906_4030_4749 | 239 |
| 550 | 3300053136 | Ga0500559_0001710 | Ga0500559_0001710_658_1377 | 239 |
| 551 | 3300003794 | Ga0055531_10013758 | Ga0055531_100137583 | 240 |
| 552 | 3300006038 | Ga0075365_10240513 | Ga0075365_102405132 | 240 |
| 553 | 3300006048 | Ga0075363_100005255 | Ga0075363_1000052558 | 240 |
| 554 | 3300006195 | Ga0075366_10004616 | Ga0075366_100046169 | 240 |
| 555 | 3300006946 | Ga0079104_1030084 | Ga0079104_10300842 | 240 |
| 556 | 3300009011 | Ga0105251_10066080 | Ga0105251_100660802 | 240 |
| 557 | 3300009036 | Ga0105244_10119765 | Ga0105244_101197652 | 240 |
| 558 | 3300025292 | Ga0209676_1025550 | Ga0209676_10255502 | 240 |
| 559 | 3300025304 | Ga0209257_1000460 | Ga0209257_100046019 | 240 |
| 560 | 3300025735 | Ga0207713_1041673 | Ga0207713_10416733 | 240 |
| 561 | 3300042004 | Ga0439445_0015131 | Ga0439445_0015131_456_1178 | 240 |
| 562 | 3300048909 | Ga0496106_0109118 | Ga0496106_0109118_1110_1847 | 240 |
| 563 | 3300048925 | Ga0496122_0019094 | Ga0496122_0019094_545_1267 | 240 |
| 564 | 3300048926 | Ga0496123_0008012 | Ga0496123_0008012_3803_4525 | 240 |
| 565 | 3300048929 | Ga0496126_0013342 | Ga0496126_0013342_2247_2984 | 240 |
| 566 | 3300049656 | Ga0501209_000168 | Ga0501209_000168_4034_4771 | 240 |
| 567 | 3300050490 | nmdc:mga03n38_3331_c1 | nmdc:mga03n38_3331_c1_1582_2376 | 240 |
| 568 | 3300050491 | nmdc:mga00v17_24396_c1 | nmdc:mga00v17_24396_c1_673_1467 | 240 |
| 569 | 3300050493 | nmdc:mga0k408_88990_c1 | nmdc:mga0k408_88990_c1_1051_1773 | 240 |
| 570 | 3300053125 | Ga0500618_002276 | Ga0500618_002276_5196_5918 | 240 |
| 571 | 3300001979 | JGI24740J21852_10022324 | JGI24740J21852_100223242 | 241 |
| 572 | 3300001989 | JGI24739J22299_10001868 | JGI24739J22299_100018687 | 241 |
| 573 | 3300001989 | JGI24739J22299_10011512 | JGI24739J22299_100115122 | 241 |
| 574 | 3300001989 | JGI24739J22299_10038700 | JGI24739J22299_100387003 | 241 |
| 575 | 3300002067 | JGI24735J21928_10006073 | JGI24735J21928_100060731 | 241 |
| 576 | 3300002067 | JGI24735J21928_10017531 | JGI24735J21928_100175312 | 241 |
| 577 | 3300002067 | JGI24735J21928_10051437 | JGI24735J21928_100514372 | 241 |
| 578 | 3300002067 | JGI24735J21928_10118990 | JGI24735J21928_101189901 | 241 |
| 579 | 3300002705 | JGI25156J39149_1001506 | JGI25156J39149_10015068 | 241 |
| 580 | 3300002705 | JGI25156J39149_1004510 | JGI25156J39149_10045103 | 241 |
| 581 | 3300003214 | JGI25165J46597_1000805 | JGI25165J46597_100080513 | 241 |
| 582 | 3300003756 | Ga0055533_1002359 | Ga0055533_10023593 | 241 |
| 583 | 3300003758 | Ga0055532_1000036 | Ga0055532_100003670 | 241 |
| 584 | 3300003758 | Ga0055532_1001534 | Ga0055532_10015342 | 241 |
| 585 | 3300003760 | Ga0055527_1000022 | Ga0055527_1000022120 | 241 |
| 586 | 3300003761 | Ga0055535_1000026 | Ga0055535_100002670 | 241 |
| 587 | 3300003762 | Ga0055542_1000042 | Ga0055542_100004270 | 241 |
| 588 | 3300003763 | Ga0055529_1000048 | Ga0055529_100004870 | 241 |
| 589 | 3300005327 | Ga0070658_10202621 | Ga0070658_102026212 | 241 |
| 590 | 3300009011 | Ga0105251_10018284 | Ga0105251_100182843 | 241 |
| 591 | 3300009093 | Ga0105240_10146386 | Ga0105240_101463862 | 241 |
| 592 | 3300009545 | Ga0105237_10336273 | Ga0105237_103362732 | 241 |
| 593 | 3300009545 | Ga0105237_10646485 | Ga0105237_106464851 | 241 |
| 594 | 3300010375 | Ga0105239_10201237 | Ga0105239_102012372 | 241 |
| 595 | 3300015261 | Ga0182006_1034517 | Ga0182006_10345172 | 241 |
| 596 | 3300015261 | Ga0182006_1073396 | Ga0182006_10733961 | 241 |
| 597 | 3300015262 | Ga0182007_10015136 | Ga0182007_100151362 | 241 |
| 598 | 3300015265 | Ga0182005_1019424 | Ga0182005_10194242 | 241 |
| 599 | 3300025225 | Ga0209566_100400 | Ga0209566_10040030 | 241 |
| 600 | 3300025226 | Ga0209674_100048 | Ga0209674_10004821 | 241 |
| 601 | 3300025226 | Ga0209674_105307 | Ga0209674_1053073 | 241 |
| 602 | 3300025228 | Ga0209672_100002 | Ga0209672_100002474 | 241 |
| 603 | 3300025228 | Ga0209672_102432 | Ga0209672_1024325 | 241 |
| 604 | 3300025229 | Ga0209147_100003 | Ga0209147_100003474 | 241 |
| 605 | 3300025229 | Ga0209147_100156 | Ga0209147_1001562 | 241 |
| 606 | 3300025231 | Ga0207427_102208 | Ga0207427_1022082 | 241 |
| 607 | 3300025242 | Ga0209258_100005 | Ga0209258_100005116 | 241 |
| 608 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006474 | 241 |
| 609 | 3300025256 | Ga0209759_1000009 | Ga0209759_1000009240 | 241 |
| 610 | 3300025256 | Ga0209759_1000039 | Ga0209759_1000039178 | 241 |
| 611 | 3300025261 | Ga0209233_1000033 | Ga0209233_100003367 | 241 |
| 612 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003474 | 241 |
| 613 | 3300025735 | Ga0207713_1012478 | Ga0207713_10124782 | 241 |
| 614 | 3300025904 | Ga0207647_10006206 | Ga0207647_100062065 | 241 |
| 615 | 3300025904 | Ga0207647_10069363 | Ga0207647_100693632 | 241 |
| 616 | 3300025906 | Ga0207699_10167126 | Ga0207699_101671261 | 241 |
| 617 | 3300025909 | Ga0207705_10039249 | Ga0207705_100392492 | 241 |
| 618 | 3300025913 | Ga0207695_10268504 | Ga0207695_102685042 | 241 |
| 619 | 3300027312 | Ga0209371_1017758 | Ga0209371_10177582 | 241 |
| 620 | 3300027876 | Ga0209974_10025484 | Ga0209974_100254842 | 241 |
| 621 | 3300030500 | Ga0268256_1019795 | Ga0268256_10197952 | 241 |
| 622 | 3300031548 | Ga0307408_100006508 | Ga0307408_1000065084 | 241 |
| 623 | 3300046454 | Ga0495592_0029261 | Ga0495592_0029261_1948_2673 | 241 |
| 624 | 3300046458 | Ga0495591_004217 | Ga0495591_004217_519_1244 | 241 |
| 625 | 3300046459 | Ga0495629_0015543 | Ga0495629_0015543_2073_2798 | 241 |
| 626 | 3300046459 | Ga0495629_0021702 | Ga0495629_0021702_3552_4277 | 241 |
| 627 | 3300046462 | Ga0495651_0062147 | Ga0495651_0062147_2103_2828 | 241 |
| 628 | 3300046462 | Ga0495651_0079539 | Ga0495651_0079539_99_824 | 241 |
| 629 | 3300046463 | Ga0495653_0044328 | Ga0495653_0044328_1157_1882 | 241 |
| 630 | 3300046463 | Ga0495653_0236300 | Ga0495653_0236300_129_854 | 241 |
| 631 | 3300046472 | Ga0495580_0000839 | Ga0495580_0000839_3376_4152 | 241 |
| 632 | 3300046472 | Ga0495580_0015417 | Ga0495580_0015417_104_829 | 241 |
| 633 | 3300046473 | Ga0495582_0082465 | Ga0495582_0082465_704_1528 | 241 |
| 634 | 3300046473 | Ga0495582_0123578 | Ga0495582_0123578_217_942 | 241 |
| 635 | 3300046476 | Ga0495662_0017244 | Ga0495662_0017244_986_1711 | 241 |
| 636 | 3300046477 | Ga0495664_0070685 | Ga0495664_0070685_550_1374 | 241 |
| 637 | 3300046477 | Ga0495664_0128409 | Ga0495664_0128409_487_1212 | 241 |
| 638 | 3300046500 | Ga0495596_0096712 | Ga0495596_0096712_91_915 | 241 |
| 639 | 3300046511 | Ga0495608_0041612 | Ga0495608_0041612_626_1405 | 241 |
| 640 | 3300046514 | Ga0495618_0004484 | Ga0495618_0004484_699_1523 | 241 |
| 641 | 3300046514 | Ga0495618_0010063 | Ga0495618_0010063_2842_3567 | 241 |
| 642 | 3300046516 | Ga0495628_0039577 | Ga0495628_0039577_2568_3344 | 241 |
| 643 | 3300046516 | Ga0495628_0070321 | Ga0495628_0070321_1067_1891 | 241 |
| 644 | 3300046517 | Ga0495630_0001458 | Ga0495630_0001458_13079_13804 | 241 |
| 645 | 3300046517 | Ga0495630_0012098 | Ga0495630_0012098_3047_3871 | 241 |
| 646 | 3300046517 | Ga0495630_0259490 | Ga0495630_0259490_394_1119 | 241 |
| 647 | 3300046524 | Ga0495648_0043908 | Ga0495648_0043908_53_778 | 241 |
| 648 | 3300046524 | Ga0495648_0102751 | Ga0495648_0102751_621_1346 | 241 |
| 649 | 3300046526 | Ga0495666_0007246 | Ga0495666_0007246_482_1207 | 241 |
| 650 | 3300046526 | Ga0495666_0014061 | Ga0495666_0014061_838_1662 | 241 |
| 651 | 3300046526 | Ga0495666_0018617 | Ga0495666_0018617_2274_2999 | 241 |
| 652 | 3300046529 | Ga0495652_0074918 | Ga0495652_0074918_245_970 | 241 |
| 653 | 3300046531 | Ga0495665_0000581 | Ga0495665_0000581_6458_7183 | 241 |
| 654 | 3300046531 | Ga0495665_0017430 | Ga0495665_0017430_1115_1939 | 241 |
| 655 | 3300046531 | Ga0495665_0116383 | Ga0495665_0116383_49_774 | 241 |
| 656 | 3300046533 | Ga0495640_0006005 | Ga0495640_0006005_8394_9119 | 241 |
| 657 | 3300046533 | Ga0495640_0017324 | Ga0495640_0017324_3227_4051 | 241 |
| 658 | 3300046535 | Ga0495586_0007335 | Ga0495586_0007335_4265_4990 | 241 |
| 659 | 3300046536 | Ga0495587_0011727 | Ga0495587_0011727_2303_3028 | 241 |
| 660 | 3300046557 | Ga0495622_0000031 | Ga0495622_0000031_104675_105400 | 241 |
| 661 | 3300046642 | Ga0495634_0006573 | Ga0495634_0006573_2282_3007 | 241 |
| 662 | 3300046642 | Ga0495634_0113250 | Ga0495634_0113250_418_1242 | 241 |
| 663 | 3300046663 | Ga0495635_0005627 | Ga0495635_0005627_2377_3201 | 241 |
| 664 | 3300046665 | Ga0495661_0004712 | Ga0495661_0004712_8445_9170 | 241 |
| 665 | 3300046665 | Ga0495661_0025430 | Ga0495661_0025430_1668_2393 | 241 |
| 666 | 3300046678 | Ga0495599_0025119 | Ga0495599_0025119_865_1590 | 241 |
| 667 | 3300046678 | Ga0495599_0091528 | Ga0495599_0091528_66_842 | 241 |
| 668 | 3300046678 | Ga0495599_0203592 | Ga0495599_0203592_384_1109 | 241 |
| 669 | 3300046679 | Ga0495623_0000861 | Ga0495623_0000861_2576_3301 | 241 |
| 670 | 3300046679 | Ga0495623_0013447 | Ga0495623_0013447_937_1761 | 241 |
| 671 | 3300046680 | Ga0495646_0000655 | Ga0495646_0000655_455_1180 | 241 |
| 672 | 3300046680 | Ga0495646_0001183 | Ga0495646_0001183_6578_7303 | 241 |
| 673 | 3300046680 | Ga0495646_0018898 | Ga0495646_0018898_3012_3737 | 241 |
| 674 | 3300046689 | Ga0495613_0014070 | Ga0495613_0014070_3403_4128 | 241 |
| 675 | 3300046690 | Ga0495624_0309081 | Ga0495624_0309081_49_873 | 241 |
| 676 | 3300046692 | Ga0495671_0134609 | Ga0495671_0134609_201_926 | 241 |
| 677 | 3300046809 | Ga0495600_0058911 | Ga0495600_0058911_1157_1882 | 241 |
| 678 | 3300047315 | Ga0495581_0001228 | Ga0495581_0001228_2384_3208 | 241 |
| 679 | 3300047315 | Ga0495581_0030485 | Ga0495581_0030485_534_1259 | 241 |
| 680 | 3300047317 | Ga0495604_0004144 | Ga0495604_0004144_5359_6084 | 241 |
| 681 | 3300047317 | Ga0495604_0088636 | Ga0495604_0088636_524_1300 | 241 |
| 682 | 3300047319 | Ga0495674_0112010 | Ga0495674_0112010_422_1246 | 241 |
| 683 | 3300047320 | Ga0495672_0030414 | Ga0495672_0030414_1822_2547 | 241 |
| 684 | 3300047322 | Ga0495680_0010571 | Ga0495680_0010571_1206_1931 | 241 |
| 685 | 3300047322 | Ga0495680_0024259 | Ga0495680_0024259_1174_1899 | 241 |
| 686 | 3300047322 | Ga0495680_0033513 | Ga0495680_0033513_517_1293 | 241 |
| 687 | 3300047323 | Ga0495683_0000746 | Ga0495683_0000746_2765_3490 | 241 |
| 688 | 3300047444 | Ga0495675_0003273 | Ga0495675_0003273_1946_2770 | 241 |
| 689 | 3300047444 | Ga0495675_0003327 | Ga0495675_0003327_5686_6411 | 241 |
| 690 | 3300047444 | Ga0495675_0007996 | Ga0495675_0007996_5000_5725 | 241 |
| 691 | 3300047444 | Ga0495675_0033793 | Ga0495675_0033793_2145_2870 | 241 |
| 692 | 3300047446 | Ga0495679_001681 | Ga0495679_001681_6574_7299 | 241 |
| 693 | 3300047469 | Ga0495673_0013387 | Ga0495673_0013387_3185_3910 | 241 |
| 694 | 3300047469 | Ga0495673_0045036 | Ga0495673_0045036_938_1663 | 241 |
| 695 | 3300047673 | Ga0495593_0011089 | Ga0495593_0011089_710_1435 | 241 |
| 696 | 3300047673 | Ga0495593_0016593 | Ga0495593_0016593_2387_3211 | 241 |
| 697 | 3300048088 | Ga0495602_0012144 | Ga0495602_0012144_2250_2975 | 241 |
| 698 | 3300048088 | Ga0495602_0142045 | Ga0495602_0142045_96_920 | 241 |
| 699 | 3300048088 | Ga0495602_0214375 | Ga0495602_0214375_655_1380 | 241 |
| 700 | 3300048089 | Ga0495614_0032669 | Ga0495614_0032669_810_1634 | 241 |
| 701 | 3300048907 | Ga0496104_0266262 | Ga0496104_0266262_496_1221 | 241 |
| 702 | 3300048919 | Ga0496116_0020316 | Ga0496116_0020316_3746_4471 | 241 |
| 703 | 3300048920 | Ga0496117_0016111 | Ga0496117_0016111_2931_3728 | 241 |
| 704 | 3300048920 | Ga0496117_0046765 | Ga0496117_0046765_2374_3099 | 241 |
| 705 | 3300048921 | Ga0496118_0000316 | Ga0496118_0000316_76656_77381 | 241 |
| 706 | 3300048921 | Ga0496118_0000365 | Ga0496118_0000365_73006_73803 | 241 |
| 707 | 3300048929 | Ga0496126_0000629 | Ga0496126_0000629_25397_26122 | 241 |
| 708 | 3300049460 | Ga0495682_0019414 | Ga0495682_0019414_1781_2506 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.972 | 1 | 235 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9719 | 1 | 234 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9677 | 1 | 234 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9599 | 1 | 235 |
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.8778 | 38 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9961 | 13 | 131 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9906 | 11 | 134 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9797 | 13 | 131 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9743 | 11 | 134 | 2.60.120.10 |
| af_F1QLW3_37_119_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9607 | 40 | 120 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B6S415-F1-model_v4 | Quercetin 2,3-dioxygenase | 1.002 | 2 | 241 |
GO:0046872
|
| AF-A0A354XYT3-F1-model_v4 | Pirin N-terminal domain-containing protein | 1.002 | 5 | 136 |
|
| AF-A0A7Z0V0A2-F1-model_v4 | Putative Pirin family protein | 1.001 | 5 | 135 |
GO:0046872
|
| AF-A0A3B0T399-F1-model_v4 | Pirin | 1.001 | 5 | 134 |
|
| AF-X1XEF8-F1-model_v4 | deleted | 0.9995 | 20 | 235 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar