F476621

General Info

Members Datasets Scaffolds Average Seq Length
708 434 648 238

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0364609|Ga0496113_0364609_195_1055
Length 286
Sequence MAKPFNLMPCHAPDTSSIAALMPNEIRQISNRTLSVKFIDRHRKEDTMLDIRKAQHRGNANHGWLHSRHTFSFGHYHDPKQEGFSDLLVINDDRVAPEQGFGTHPHRDMEIMSYVLDGALEHRDSMGTGSVIRPGDVQLMSAGTGVRHSEFNHSKSEPVHFLQIWLVPSVRGAVPRYQQVHFSAAEKRGRLRLIVSPESAQGSLSVHQDARVHAGLFDGAESATLPLAPDRYAYVHVARGSVEVNGERLGQGDGARIRDERTLRFAKGDQAEVLVFDLRPRERPSM

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2519103095 Burkholderia sp. KJ006 Isolate Nodule
8 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
9 2547132374 Acidovorax radicis N35 Isolate Unclassified
10 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
11 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
12 2643221570 Acidovorax sp. Root568 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
20 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
21 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
22 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
23 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
24 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
25 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
26 2818991450 Burkholderia sp. 604 Isolate Unclassified
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2821131069 Duganella sp. 1224 Isolate Unclassified
29 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842711865 Duganella sp. R-73148 Isolate Unclassified
32 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
33 2842733646 Variovorax sp. R-72446 Isolate Unclassified
34 2842747753 Variovorax sp. R-72060 Isolate Unclassified
35 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
36 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
37 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
38 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
39 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
40 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
41 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
42 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
43 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
44 2928163908 Burkholderia sp. 567 Isolate Unclassified
45 2928170801 Burkholderia sp. 572 Isolate Unclassified
46 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
47 2929520902 Variovorax beijingensis 502 Isolate Unclassified
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
51 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
52 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
56 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
75 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
80 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
83 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
94 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
116 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
117 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
118 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
138 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
143 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
144 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
145 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
146 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
147 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
151 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
152 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
167 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
168 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
169 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
170 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
171 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
176 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
177 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
182 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
190 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
192 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
193 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
194 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
260 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
261 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
262 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
263 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
264 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
265 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
266 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
267 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
268 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
269 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
274 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
284 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
296 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
311 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
312 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
324 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
325 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
334 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
335 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
336 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
337 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
338 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
362 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
366 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
367 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
370 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
371 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
404 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
405 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
408 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
409 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
420 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
428 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
429 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
430 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
431 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
432 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
433 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
434 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.82
Metatranscriptomes 0.71
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.84
Nodule 1.41
Rhizoplane 3.81
Rhizosphere 70.2
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022324 3300001979 Bacteria 2180
2 JGI24739J22299_10001868 3300001989 Bacteria 8027
3 JGI24739J22299_10011512 3300001989 Bacteria 3264
4 JGI24739J22299_10038700 3300001989 Bacteria 1602
5 JGI24735J21928_10006073 3300002067 Bacteria 3990
6 JGI24735J21928_10017531 3300002067 Bacteria 2214
7 JGI24735J21928_10051437 3300002067 Bacteria 1189
8 JGI24735J21928_10118990 3300002067 Bacteria 760
9 JGI25156J39149_1001506 3300002705 Bacteria 9706
10 JGI25156J39149_1004510 3300002705 Bacteria 4227
11 JGI25152J39213_1000073 3300002773 Bacteria 66515
12 JGI25152J39213_1010358 3300002773 Bacteria 2139
13 JGI25150J39212_1000062 3300002774 Bacteria 64560
14 JGI25159J45721_1000212 3300002987 Bacteria 27374
15 JGI25151J46595_10000224 3300003187 Bacteria 67033
16 JGI25151J46595_10000255 3300003187 Bacteria 62389
17 JGI25151J46595_10001680 3300003187 Bacteria 14497
18 JGI25165J46597_1000805 3300003214 Bacteria 23719
19 JGI25153J46596_10000165 3300003215 Bacteria 66515
20 rootL2_10162574 3300003322 Bacteria 1498
21 JGI25160J50197_1000410 3300003354 Bacteria 27374
22 JGI25161J50226_1000688 3300003374 Bacteria 13295
23 Ga0006562J51391_1071781 3300003578 Bacteria 1011
24 Ga0055533_1002359 3300003756 Bacteria 4325
25 Ga0055532_1000036 3300003758 Bacteria 208233
26 Ga0055532_1001534 3300003758 Bacteria 6247
27 Ga0055527_1000022 3300003760 Bacteria 208676
28 Ga0055535_1000026 3300003761 Bacteria 208676
29 Ga0055542_1000042 3300003762 Bacteria 208676
30 Ga0055529_1000048 3300003763 Bacteria 208676
31 Ga0055526_1000146 3300003771 Bacteria 62389
32 Ga0055526_1000180 3300003771 Bacteria 55895
33 Ga0055537_1000090 3300003773 Bacteria 66515
34 Ga0055524_1000195 3300003775 Bacteria 66515
35 Ga0055536_1006008 3300003781 Bacteria 5771
36 Ga0055536_1051248 3300003781 Bacteria 906
37 Ga0055534_1000101 3300003784 Bacteria 66515
38 Ga0055528_1000111 3300003790 Bacteria 66515
39 Ga0055530_10018270 3300003791 Bacteria 2168
40 Ga0055540_1000395 3300003792 Bacteria 35841
41 Ga0055540_1006726 3300003792 Bacteria 4501
42 Ga0055531_10000392 3300003794 Bacteria 42357
43 Ga0055531_10007498 3300003794 Bacteria 5940
44 Ga0055531_10013758 3300003794 Bacteria 3706
45 Ga0058692_1000291 3300003856 Bacteria 25903
46 Ga0058692_1000709 3300003856 Bacteria 13656
47 Ga0058692_1021849 3300003856 Bacteria 1323
48 Ga0055543_1004715 3300004625 Bacteria 3639
49 Ga0065165_1001334 3300005262 Bacteria 27412
50 Ga0070658_10047104 3300005327 Bacteria 3488
51 Ga0070658_10202621 3300005327 Bacteria 1675
52 Ga0070683_100106764 3300005329 Bacteria 2640
53 Ga0070690_100028859 3300005330 Bacteria 3439
54 Ga0068869_100025409 3300005334 Bacteria 4112
55 Ga0070666_10006014 3300005335 Bacteria 7456
56 Ga0070666_10144908 3300005335 Bacteria 1655
57 Ga0068868_100005504 3300005338 Bacteria 8909
58 Ga0070689_100881408 3300005340 Bacteria 791
59 Ga0070661_100028850 3300005344 Bacteria 4004
60 Ga0070661_100036407 3300005344 Bacteria 3577
61 Ga0070692_10277711 3300005345 Bacteria 1014
62 Ga0070668_100018057 3300005347 Bacteria 5290
63 Ga0070671_100009337 3300005355 Bacteria 7875
64 Ga0070673_100000141 3300005364 Bacteria 34034
65 Ga0070688_100225560 3300005365 Bacteria 1323
66 Ga0070688_100270959 3300005365 Bacteria 1216
67 Ga0070667_100030394 3300005367 Bacteria 4505
68 Ga0070667_100083824 3300005367 Bacteria 2731
69 Ga0070667_100478708 3300005367 Bacteria 1139
70 Ga0070714_100003209 3300005435 Bacteria 12171
71 Ga0070713_100491184 3300005436 Bacteria 1157
72 Ga0070705_100390213 3300005440 Bacteria 1027
73 Ga0070708_100079876 3300005445 Bacteria 2960
74 Ga0070708_100201248 3300005445 Bacteria 1864
75 Ga0070663_100007884 3300005455 Bacteria 6515
76 Ga0070663_100022801 3300005455 Bacteria 4189
77 Ga0070678_100118604 3300005456 Bacteria 2083
78 Ga0070678_100272330 3300005456 Bacteria 1428
79 Ga0070662_100126021 3300005457 Bacteria 1968
80 Ga0070681_10229550 3300005458 Bacteria 1770
81 Ga0070681_10316342 3300005458 Bacteria 1470
82 Ga0070681_10454036 3300005458 Unclassified 1194
83 Ga0070685_10002403 3300005466 Bacteria 9634
84 Ga0070685_10002790 3300005466 Bacteria 8927
85 Ga0070706_100074654 3300005467 Bacteria 3138
86 Ga0070706_100091055 3300005467 Bacteria 2828
87 Ga0070706_100579633 3300005467 Bacteria 1043
88 Ga0070707_100047627 3300005468 Bacteria 4104
89 Ga0070707_100296416 3300005468 Bacteria 1571
90 Ga0070698_100011515 3300005471 Bacteria 9387
91 Ga0070698_100182678 3300005471 Bacteria 2035
92 Ga0070698_100214916 3300005471 Bacteria 1857
93 Ga0070699_100037018 3300005518 Bacteria 4222
94 Ga0070697_100106965 3300005536 Bacteria 2327
95 Ga0070697_100155673 3300005536 Bacteria 1929
96 Ga0070697_100273077 3300005536 Bacteria 1449
97 Ga0068853_100024171 3300005539 Bacteria 5093
98 Ga0068853_100140920 3300005539 Bacteria 2164
99 Ga0068853_100864020 3300005539 Bacteria 868
100 Ga0070695_100024027 3300005545 Bacteria 3752
101 Ga0070695_100086364 3300005545 Bacteria 2085
102 Ga0070696_100711050 3300005546 Bacteria 820
103 Ga0070693_100026364 3300005547 Unclassified 3137
104 Ga0070665_100000266 3300005548 Bacteria 85554
105 Ga0070704_100036073 3300005549 Bacteria 3366
106 Ga0068855_100004153 3300005563 Bacteria 17667
107 Ga0068855_100356754 3300005563 Bacteria 1609
108 Ga0070664_100874524 3300005564 Bacteria 842
109 Ga0068857_100055881 3300005577 Bacteria 3502
110 Ga0068854_100000001 3300005578 Bacteria 608908
111 Ga0068854_100022639 3300005578 Bacteria 4286
112 Ga0068854_100338832 3300005578 Bacteria 1227
113 Ga0068856_100169576 3300005614 Bacteria 2194
114 Ga0068856_100323564 3300005614 Unclassified 1559
115 Ga0068856_100727060 3300005614 Bacteria 1013
116 Ga0068852_100044907 3300005616 Bacteria 3756
117 Ga0068852_100097887 3300005616 Bacteria 2640
118 Ga0068859_100005189 3300005617 Bacteria 13230
119 Ga0068864_100000917 3300005618 Bacteria 24719
120 Ga0068851_10003540 3300005834 Bacteria 6949
121 Ga0068870_10018451 3300005840 Bacteria 3370
122 Ga0068863_100000513 3300005841 Bacteria 39390
123 Ga0068863_100757318 3300005841 Bacteria 967
124 Ga0068858_100001759 3300005842 Bacteria 22087
125 Ga0068858_100021689 3300005842 Bacteria 6002
126 Ga0068860_100005306 3300005843 Bacteria 13087
127 Ga0068860_100148933 3300005843 Bacteria 2253
128 Ga0068862_100534488 3300005844 Bacteria 1117
129 Ga0081539_10036407 3300005985 Bacteria 2946
130 Ga0070717_10116035 3300006028 Bacteria 2289
131 Ga0070717_10343343 3300006028 Unclassified 1334
132 Ga0075365_10240513 3300006038 Bacteria 1271
133 Ga0075363_100005255 3300006048 Bacteria 5741
134 Ga0075363_100081017 3300006048 Bacteria 1775
135 Ga0070715_10058956 3300006163 Bacteria 1678
136 Ga0070716_100100769 3300006173 Bacteria 1770
137 Ga0075366_10004616 3300006195 Bacteria 7401
138 Ga0075366_10005365 3300006195 Bacteria 6946
139 Ga0097621_100004565 3300006237 Bacteria 9665
140 Ga0097621_100174707 3300006237 Bacteria 1854
141 Ga0097621_100367527 3300006237 Bacteria 1283
142 Ga0097621_100489273 3300006237 Bacteria 1113
143 Ga0097621_100543437 3300006237 Bacteria 1057
144 Ga0075370_10006582 3300006353 Bacteria 5853
145 Ga0075370_10014671 3300006353 Bacteria 4184
146 Ga0075370_10104777 3300006353 Bacteria 1639
147 Ga0075370_10172203 3300006353 Bacteria 1273
148 Ga0068871_100015616 3300006358 Bacteria 5690
149 Ga0068871_100433141 3300006358 Bacteria 1176
150 Ga0075428_100026987 3300006844 Bacteria 6360
151 Ga0075433_10039977 3300006852 Bacteria 4058
152 Ga0075434_100033336 3300006871 Bacteria 5082
153 Ga0075436_100069460 3300006914 Bacteria 2434
154 Ga0097620_100005190 3300006931 Bacteria 13230
155 Ga0079104_1030084 3300006946 Bacteria 1361
156 Ga0075435_100019214 3300007076 Bacteria 5212
157 Ga0099795_10143964 3300007788 Bacteria 972
158 Ga0105251_10018284 3300009011 Bacteria 3729
159 Ga0105251_10066080 3300009011 Bacteria 1691
160 Ga0105244_10008569 3300009036 Bacteria 6377
161 Ga0105244_10017785 3300009036 Bacteria 4007
162 Ga0105244_10119765 3300009036 Bacteria 1275
163 Ga0105240_10000018 3300009093 Bacteria 434461
164 Ga0105240_10000377 3300009093 Bacteria 83854
165 Ga0105240_10135970 3300009093 Bacteria 2944
166 Ga0105240_10137945 3300009093 Bacteria 2919
167 Ga0105240_10146386 3300009093 Bacteria 2818
168 Ga0105240_10175872 3300009093 Bacteria 2530
169 Ga0105240_10701646 3300009093 Bacteria 1104
170 Ga0105245_10002409 3300009098 Bacteria 16918
171 Ga0105245_10008952 3300009098 Bacteria 8730
172 Ga0105245_10267409 3300009098 Bacteria 1666
173 Ga0105245_10338506 3300009098 Bacteria 1487
174 Ga0105247_10013569 3300009101 Bacteria 4885
175 Ga0114129_10036550 3300009147 Bacteria 6934
176 Ga0114129_10039913 3300009147 Bacteria 6622
177 Ga0114129_10044287 3300009147 Bacteria 6260
178 Ga0114129_10058581 3300009147 Bacteria 5387
179 Ga0114129_10160674 3300009147 Bacteria 3069
180 Ga0105243_10009475 3300009148 Bacteria 7413
181 Ga0105243_10019008 3300009148 Bacteria 5209
182 Ga0105241_10345616 3300009174 Bacteria 1290
183 Ga0105241_10540192 3300009174 Unclassified 1045
184 Ga0105242_10003387 3300009176 Bacteria 12413
185 Ga0105242_10181124 3300009176 Bacteria 1859
186 Ga0105242_10629794 3300009176 Bacteria 1040
187 Ga0105248_10001779 3300009177 Bacteria 23972
188 Ga0105248_10215872 3300009177 Bacteria 2160
189 Ga0105248_10544207 3300009177 Bacteria 1310
190 Ga0105237_10086872 3300009545 Bacteria 3117
191 Ga0105237_10336273 3300009545 Bacteria 1514
192 Ga0105237_10646485 3300009545 Bacteria 1064
193 Ga0105238_10006002 3300009551 Bacteria 12042
194 Ga0105238_10085881 3300009551 Bacteria 3134
195 Ga0105238_10106903 3300009551 Bacteria 2779
196 Ga0105238_10350795 3300009551 Bacteria 1465
197 Ga0105238_10779829 3300009551 Bacteria 971
198 Ga0105249_10001046 3300009553 Bacteria 24484
199 Ga0105239_10092479 3300010375 Bacteria 3339
200 Ga0105239_10201237 3300010375 Bacteria 2231
201 Ga0105239_10215416 3300010375 Bacteria 2153
202 Ga0105246_10256633 3300011119 Bacteria 1390
203 Ga0157373_10086165 3300013100 Bacteria 2214
204 Ga0157370_10171353 3300013104 Bacteria 2018
205 Ga0157369_10076866 3300013105 Bacteria 3579
206 Ga0157369_10565296 3300013105 Bacteria 1175
207 Ga0157374_10167559 3300013296 Bacteria 2142
208 Ga0157378_10281001 3300013297 Unclassified 1604
209 Ga0163162_10002679 3300013306 Bacteria 16876
210 Ga0157372_10119090 3300013307 Bacteria 3030
211 Ga0157372_10130228 3300013307 Bacteria 2894
212 Ga0157372_10756115 3300013307 Bacteria 1130
213 Ga0157380_10053974 3300014326 Bacteria 3188
214 Ga0182008_10000846 3300014497 Bacteria 21301
215 Ga0182008_10001161 3300014497 Bacteria 18139
216 Ga0182008_10012263 3300014497 Bacteria 4526
217 Ga0157379_10031675 3300014968 Bacteria 4712
218 Ga0157379_10128366 3300014968 Unclassified 2282
219 Ga0157379_10880854 3300014968 Bacteria 848
220 Ga0157376_10842966 3300014969 Bacteria 932
221 Ga0182006_1006519 3300015261 Bacteria 5415
222 Ga0182006_1019783 3300015261 Bacteria 2830
223 Ga0182006_1034517 3300015261 Bacteria 2023
224 Ga0182006_1073396 3300015261 Bacteria 1263
225 Ga0182007_10001504 3300015262 Bacteria 12452
226 Ga0182007_10003696 3300015262 Bacteria 7155
227 Ga0182007_10015136 3300015262 Bacteria 2887
228 Ga0182005_1019424 3300015265 Bacteria 1873
229 Ga0163161_10021987 3300017792 Bacteria 4486
230 Ga0163161_10561864 3300017792 Bacteria 936
231 Ga0213875_10027813 3300021388 Bacteria 2690
232 Ga0209436_103651 3300025208 Bacteria 4016
233 Ga0209566_100400 3300025225 Bacteria 34494
234 Ga0209674_100048 3300025226 Bacteria 353032
235 Ga0209674_105307 3300025226 Bacteria 1930
236 Ga0209672_100002 3300025228 Bacteria 1733325
237 Ga0209672_102432 3300025228 Bacteria 4579
238 Ga0209147_100003 3300025229 Bacteria 1733325
239 Ga0209147_100156 3300025229 Bacteria 93105
240 Ga0207427_102208 3300025231 Bacteria 5512
241 Ga0209258_100005 3300025242 Bacteria 1087938
242 Ga0207425_1000042 3300025245 Bacteria 210165
243 Ga0209148_1000006 3300025254 Bacteria 1733325
244 Ga0209759_1000009 3300025256 Bacteria 446623
245 Ga0209759_1000039 3300025256 Bacteria 256444
246 Ga0209129_1000058 3300025258 Bacteria 252258
247 Ga0209129_1000265 3300025258 Bacteria 51980
248 Ga0209233_1000033 3300025261 Bacteria 596094
249 Ga0209565_1000027 3300025263 Bacteria 360545
250 Ga0209455_1000003 3300025272 Bacteria 1471893
251 Ga0209673_1000031 3300025273 Bacteria 347560
252 Ga0209130_1000025 3300025284 Bacteria 336491
253 Ga0209675_1000064 3300025291 Bacteria 177063
254 Ga0209675_1018632 3300025291 Bacteria 1936
255 Ga0209676_1001283 3300025292 Bacteria 25966
256 Ga0209676_1013104 3300025292 Bacteria 3208
257 Ga0209676_1025550 3300025292 Bacteria 1892
258 Ga0209025_1000075 3300025294 Bacteria 275717
259 Ga0209025_1000204 3300025294 Bacteria 142193
260 Ga0209025_1000380 3300025294 Bacteria 92360
261 Ga0209564_1000009 3300025295 Bacteria 950196
262 Ga0209564_1000040 3300025295 Bacteria 411388
263 Ga0209758_1000050 3300025297 Bacteria 345008
264 Ga0209050_1000704 3300025298 Bacteria 49577
265 Ga0209050_1003418 3300025298 Bacteria 11746
266 Ga0209256_1000023 3300025299 Bacteria 461150
267 Ga0207426_1000118 3300025302 Bacteria 223341
268 Ga0209051_1000186 3300025303 Bacteria 109900
269 Ga0209051_1001497 3300025303 Bacteria 19533
270 Ga0209257_1000188 3300025304 Bacteria 154074
271 Ga0209257_1000460 3300025304 Bacteria 75384
272 Ga0209257_1000663 3300025304 Bacteria 54142
273 Ga0207656_10004236 3300025321 Bacteria 4994
274 Ga0207655_1005414 3300025728 Bacteria 8686
275 Ga0207655_1042915 3300025728 Bacteria 1919
276 Ga0207713_1012478 3300025735 Bacteria 4537
277 Ga0207713_1041673 3300025735 Bacteria 1913
278 Ga0207710_10010419 3300025900 Bacteria 3915
279 Ga0207680_10004781 3300025903 Bacteria 6448
280 Ga0207680_10018401 3300025903 Bacteria 3713
281 Ga0207680_10473374 3300025903 Bacteria 890
282 Ga0207647_10001123 3300025904 Bacteria 20593
283 Ga0207647_10005424 3300025904 Bacteria 9348
284 Ga0207647_10006206 3300025904 Bacteria 8710
285 Ga0207647_10069363 3300025904 Bacteria 2131
286 Ga0207699_10167126 3300025906 Bacteria 1469
287 Ga0207705_10036448 3300025909 Bacteria 3519
288 Ga0207705_10039249 3300025909 Bacteria 3392
289 Ga0207684_10026476 3300025910 Bacteria 4944
290 Ga0207684_10258163 3300025910 Bacteria 1503
291 Ga0207654_10296574 3300025911 Bacteria 1098
292 Ga0207707_10166487 3300025912 Bacteria 1926
293 Ga0207695_10000007 3300025913 Bacteria 1092551
294 Ga0207695_10000141 3300025913 Bacteria 215831
295 Ga0207695_10017795 3300025913 Bacteria 8246
296 Ga0207695_10268504 3300025913 Bacteria 1602
297 Ga0207671_10013102 3300025914 Bacteria 6624
298 Ga0207693_10219465 3300025915 Bacteria 1494
299 Ga0207663_10219459 3300025916 Bacteria 1383
300 Ga0207649_10087076 3300025920 Bacteria 2037
301 Ga0207649_10219175 3300025920 Bacteria 1354
302 Ga0207646_10037926 3300025922 Bacteria 4343
303 Ga0207681_10037631 3300025923 Bacteria 3199
304 Ga0207694_10000996 3300025924 Bacteria 24749
305 Ga0207694_10002131 3300025924 Bacteria 16262
306 Ga0207694_10142271 3300025924 Bacteria 1929
307 Ga0207694_10245175 3300025924 Bacteria 1465
308 Ga0207650_10004121 3300025925 Bacteria 9934
309 Ga0207650_10151889 3300025925 Bacteria 1828
310 Ga0207687_10001314 3300025927 Bacteria 16986
311 Ga0207687_10013870 3300025927 Bacteria 5264
312 Ga0207700_10179425 3300025928 Bacteria 1772
313 Ga0207664_10003413 3300025929 Bacteria 10584
314 Ga0207664_10250962 3300025929 Unclassified 1544
315 Ga0207644_10148774 3300025931 Bacteria 1810
316 Ga0207706_10020233 3300025933 Bacteria 5981
317 Ga0207686_10096160 3300025934 Bacteria 1967
318 Ga0207709_10002070 3300025935 Bacteria 12957
319 Ga0207709_10037321 3300025935 Bacteria 2887
320 Ga0207670_10016823 3300025936 Bacteria 4406
321 Ga0207670_10371508 3300025936 Bacteria 1137
322 Ga0207665_10094081 3300025939 Bacteria 2081
323 Ga0207711_10209509 3300025941 Bacteria 1780
324 Ga0207711_10380127 3300025941 Bacteria 1310
325 Ga0207667_10036229 3300025949 Bacteria 5289
326 Ga0207651_10226527 3300025960 Bacteria 1515
327 Ga0207712_10000349 3300025961 Bacteria 41192
328 Ga0207668_10010539 3300025972 Bacteria 5588
329 Ga0207640_10000003 3300025981 Bacteria 505282
330 Ga0207640_10099922 3300025981 Bacteria 2032
331 Ga0207658_10015667 3300025986 Bacteria 5204
332 Ga0207658_10164602 3300025986 Bacteria 1820
333 Ga0207658_10166824 3300025986 Bacteria 1810
334 Ga0207677_10000312 3300026023 Bacteria 35589
335 Ga0207703_10005588 3300026035 Bacteria 10095
336 Ga0207703_10011122 3300026035 Bacteria 7007
337 Ga0207639_10000102 3300026041 Bacteria 70172
338 Ga0207639_10077869 3300026041 Unclassified 2615
339 Ga0207678_10000769 3300026067 Bacteria 29267
340 Ga0207678_10023453 3300026067 Bacteria 5397
341 Ga0207702_10102570 3300026078 Bacteria 2529
342 Ga0207702_10475188 3300026078 Unclassified 1216
343 Ga0207702_10575720 3300026078 Bacteria 1103
344 Ga0207702_10780041 3300026078 Bacteria 944
345 Ga0207641_10018610 3300026088 Bacteria 5694
346 Ga0207676_10061410 3300026095 Bacteria 2976
347 Ga0207674_10096035 3300026116 Bacteria 2949
348 Ga0207683_10116456 3300026121 Bacteria 2396
349 Ga0207683_10149316 3300026121 Bacteria 2109
350 Ga0207698_10008725 3300026142 Bacteria 6428
351 Ga0207698_10489196 3300026142 Bacteria 1195
352 Ga0209371_1000061 3300027312 Bacteria 223014
353 Ga0209371_1002070 3300027312 Bacteria 11949
354 Ga0209371_1017758 3300027312 Bacteria 1831
355 Ga0209974_10025484 3300027876 Bacteria 1957
356 Ga0268266_10000006 3300028379 Bacteria 1410021
357 Ga0268265_10558062 3300028380 Bacteria 1088
358 Ga0268264_10002693 3300028381 Bacteria 15509
359 Ga0268264_10632363 3300028381 Bacteria 1058
360 Ga0265323_10003834 3300028653 Bacteria 6549
361 Ga0307515_10494513 3300028794 Bacteria 834
362 Ga0268256_1000059 3300030500 Bacteria 223875
363 Ga0268256_1018546 3300030500 Bacteria 1926
364 Ga0268256_1019795 3300030500 Bacteria 1832
365 Ga0316177_1202970 3300030731 Bacteria 6074
366 Ga0316176_1038327 3300030732 Bacteria 3881
367 Ga0314311_1013956 3300030733 Bacteria 9041
368 Ga0316179_1016783 3300030734 Bacteria 3777
369 Ga0316178_1052877 3300030735 Bacteria 4082
370 Ga0316180_1157241 3300030736 Bacteria 4826
371 Ga0316182_1144941 3300030745 Bacteria 9282
372 Ga0265762_1026356 3300030760 Bacteria 1087
373 Ga0265327_10123981 3300031251 Bacteria 1221
374 Ga0307513_10191691 3300031456 Bacteria 1895
375 Ga0307408_100006508 3300031548 Bacteria 7744
376 Ga0316576_10096584 3300031727 Bacteria 2205
377 Ga0316578_10102308 3300031728 Bacteria 1718
378 Ga0307405_10231930 3300031731 Bacteria 1361
379 Ga0307405_10276686 3300031731 Bacteria 1261
380 Ga0307413_10228412 3300031824 Bacteria 1365
381 Ga0307406_10327634 3300031901 Bacteria 1187
382 Ga0307412_10199768 3300031911 Bacteria 1517
383 Ga0307412_10590161 3300031911 Bacteria 939
384 Ga0307415_100262265 3300032126 Bacteria 1411
385 Ga0373923_0115267 3300035111 Bacteria 1196
386 Ga0373923_0178355 3300035111 Bacteria 975
387 Ga0373957_0007425 3300035120 Bacteria 3507
388 Ga0373955_0013903 3300035172 Bacteria 3905
389 Ga0316574_0000112 3300035398 Bacteria 24428
390 Ga0373924_0047722 3300035410 Bacteria 1767
391 Ga0373931_0109525 3300035691 Bacteria 1565
392 Ga0373927_0043621 3300035695 Bacteria 2903
393 Ga0373927_0171280 3300035695 Bacteria 1423
394 Ga0373937_0018691 3300036401 Bacteria 6193
395 Ga0373937_0054333 3300036401 Bacteria 3675
396 Ga0373937_0480549 3300036401 Bacteria 1180
397 Ga0373937_0748473 3300036401 Bacteria 925
398 Ga0373937_0982749 3300036401 Bacteria 793
399 Ga0316584_0102676 3300036712 Bacteria 2141
400 Ga0316584_0411309 3300036712 Bacteria 962
401 Ga0373925_0019595 3300037068 Bacteria 4923
402 Ga0395900_0392285 3300037418 Bacteria 1354
403 Ga0395905_0583857 3300037471 Bacteria 1019
404 Ga0436364_0020996 3300037853 Bacteria 3747
405 Ga0436364_1091802 3300037853 Unclassified 936
406 Ga0436364_1550326 3300037853 Bacteria 15744
407 Ga0436360_1282181 3300039438 Bacteria 12068
408 Ga0436361_0430826 3300039447 Bacteria 7116
409 Ga0439466_0112194 3300041411 Bacteria 845
410 Ga0451849_0741869 3300041505 Bacteria 1333
411 Ga0439445_0015131 3300042004 Bacteria 1886
412 Ga0439448_0045545 3300042005 Bacteria 1428
413 Ga0439432_074189 3300042006 Bacteria 1035
414 Ga0450891_005710 3300042129 Bacteria 1150
415 Ga0451577_0002733 3300042876 Bacteria 20475
416 Ga0451577_0110531 3300042876 Bacteria 2458
417 Ga0451577_0494765 3300042876 Bacteria 1110
418 Ga0466972_0001438 3300044658 Bacteria 11560
419 Ga0466972_0118302 3300044658 Bacteria 1250
420 Ga0466961_0605567 3300044693 Bacteria 659
421 Ga0453684_0539919 3300044712 Bacteria 1286
422 Ga0466970_0000972 3300044765 Bacteria 13784
423 Ga0466957_0002291 3300044842 Bacteria 10254
424 Ga0466957_0026464 3300044842 Bacteria 3442
425 Ga0451576_0091674 3300045051 Bacteria 3161
426 Ga0466958_0024051 3300045836 Bacteria 3582
427 Ga0466958_0170227 3300045836 Bacteria 1379
428 Ga0466967_0934065 3300045976 Bacteria 863
429 Ga0495592_0029261 3300046454 Bacteria 4171
430 Ga0495590_0002911 3300046457 Bacteria 7047
431 Ga0495591_004217 3300046458 Bacteria 7126
432 Ga0495629_0015543 3300046459 Bacteria 5464
433 Ga0495629_0021702 3300046459 Bacteria 4581
434 Ga0495651_0062147 3300046462 Bacteria 2858
435 Ga0495651_0079539 3300046462 Bacteria 2477
436 Ga0495651_0098527 3300046462 Bacteria 2181
437 Ga0495653_0000409 3300046463 Bacteria 34377
438 Ga0495653_0044328 3300046463 Bacteria 3452
439 Ga0495653_0236300 3300046463 Bacteria 1220
440 Ga0495650_0000166 3300046471 Bacteria 146047
441 Ga0495650_0000503 3300046471 Bacteria 58702
442 Ga0495580_0000839 3300046472 Bacteria 26622
443 Ga0495580_0015417 3300046472 Bacteria 5763
444 Ga0495582_0082465 3300046473 Bacteria 1787
445 Ga0495582_0123578 3300046473 Bacteria 1459
446 Ga0495605_0000059 3300046474 Bacteria 146371
447 Ga0495639_0006419 3300046475 Bacteria 5059
448 Ga0495662_0017244 3300046476 Bacteria 3496
449 Ga0495664_0004899 3300046477 Bacteria 7325
450 Ga0495664_0070685 3300046477 Bacteria 2084
451 Ga0495664_0128409 3300046477 Bacteria 1534
452 Ga0495596_0096712 3300046500 Bacteria 1146
453 Ga0495583_0134277 3300046506 Bacteria 1034
454 Ga0495606_0000064 3300046507 Bacteria 183631
455 Ga0495606_0000156 3300046507 Bacteria 118821
456 Ga0495606_0039372 3300046507 Bacteria 3187
457 Ga0495608_0041612 3300046511 Bacteria 3074
458 Ga0495610_0002878 3300046512 Bacteria 13942
459 Ga0495618_0004484 3300046514 Bacteria 8586
460 Ga0495618_0010063 3300046514 Bacteria 5720
461 Ga0495628_0039577 3300046516 Bacteria 3770
462 Ga0495628_0070321 3300046516 Bacteria 2728
463 Ga0495628_0103038 3300046516 Bacteria 2201
464 Ga0495628_0194233 3300046516 Bacteria 1532
465 Ga0495630_0001458 3300046517 Bacteria 16385
466 Ga0495630_0012098 3300046517 Bacteria 6257
467 Ga0495630_0259490 3300046517 Bacteria 1327
468 Ga0495648_0000675 3300046524 Bacteria 36444
469 Ga0495648_0043908 3300046524 Bacteria 2795
470 Ga0495648_0102751 3300046524 Bacteria 1573
471 Ga0495666_0007246 3300046526 Bacteria 5565
472 Ga0495666_0014061 3300046526 Bacteria 3991
473 Ga0495666_0018617 3300046526 Bacteria 3453
474 Ga0495642_0008798 3300046528 Bacteria 3860
475 Ga0495642_0067361 3300046528 Bacteria 1493
476 Ga0495652_0074918 3300046529 Bacteria 2813
477 Ga0495665_0000581 3300046531 Bacteria 18623
478 Ga0495665_0017430 3300046531 Bacteria 3862
479 Ga0495665_0116383 3300046531 Bacteria 1400
480 Ga0495640_0006005 3300046533 Bacteria 9630
481 Ga0495640_0017324 3300046533 Bacteria 5372
482 Ga0495640_0060018 3300046533 Bacteria 2588
483 Ga0495586_0007335 3300046535 Bacteria 5884
484 Ga0495587_0011727 3300046536 Bacteria 5547
485 Ga0495609_0128351 3300046538 Bacteria 1087
486 Ga0495645_0014763 3300046543 Bacteria 5548
487 Ga0495645_0230457 3300046543 Bacteria 1241
488 Ga0495622_0000031 3300046557 Bacteria 130204
489 Ga0495633_0183968 3300046558 Bacteria 961
490 Ga0495656_0096274 3300046615 Bacteria 1362
491 Ga0495668_0001239 3300046616 Bacteria 25630
492 Ga0495668_0028854 3300046616 Bacteria 3137
493 Ga0495634_0006573 3300046642 Bacteria 8820
494 Ga0495634_0113250 3300046642 Bacteria 1742
495 Ga0495635_0005627 3300046663 Bacteria 8732
496 Ga0495635_0273744 3300046663 Bacteria 1135
497 Ga0495661_0004712 3300046665 Bacteria 9796
498 Ga0495661_0017821 3300046665 Bacteria 4680
499 Ga0495661_0025430 3300046665 Bacteria 3823
500 Ga0495588_0066605 3300046674 Bacteria 1869
501 Ga0495657_0186450 3300046675 Bacteria 1270
502 Ga0495657_0190860 3300046675 Bacteria 1252
503 Ga0495599_0025119 3300046678 Bacteria 3728
504 Ga0495599_0091528 3300046678 Bacteria 1897
505 Ga0495599_0203592 3300046678 Bacteria 1215
506 Ga0495623_0000861 3300046679 Bacteria 20557
507 Ga0495623_0013447 3300046679 Bacteria 5306
508 Ga0495646_0000655 3300046680 Bacteria 18969
509 Ga0495646_0001183 3300046680 Bacteria 15273
510 Ga0495646_0018898 3300046680 Bacteria 4365
511 Ga0495647_0067293 3300046681 Bacteria 1426
512 Ga0495613_0014070 3300046689 Bacteria 5937
513 Ga0495613_0159416 3300046689 Bacteria 1606
514 Ga0495624_0309081 3300046690 Bacteria 952
515 Ga0495670_0007113 3300046691 Bacteria 5511
516 Ga0495671_0000001 3300046692 Bacteria 1169494
517 Ga0495671_0134609 3300046692 Bacteria 1205
518 Ga0495600_0058911 3300046809 Bacteria 2508
519 Ga0495581_0001228 3300047315 Bacteria 14126
520 Ga0495581_0030485 3300047315 Bacteria 3125
521 Ga0495604_0004144 3300047317 Bacteria 11512
522 Ga0495604_0088636 3300047317 Bacteria 2301
523 Ga0495674_0112010 3300047319 Bacteria 2312
524 Ga0495672_0030414 3300047320 Bacteria 3388
525 Ga0495676_0191593 3300047321 Bacteria 1426
526 Ga0495680_0010571 3300047322 Bacteria 8233
527 Ga0495680_0024259 3300047322 Bacteria 5032
528 Ga0495680_0033513 3300047322 Bacteria 4157
529 Ga0495680_0112378 3300047322 Bacteria 2018
530 Ga0495683_0000746 3300047323 Bacteria 23507
531 Ga0495675_0003273 3300047444 Bacteria 9737
532 Ga0495675_0003327 3300047444 Bacteria 9672
533 Ga0495675_0007996 3300047444 Bacteria 6541
534 Ga0495675_0033793 3300047444 Bacteria 3264
535 Ga0495679_001681 3300047446 Bacteria 12281
536 Ga0495673_0000003 3300047469 Bacteria 1491337
537 Ga0495673_0013387 3300047469 Bacteria 4311
538 Ga0495673_0045036 3300047469 Bacteria 1964
539 Ga0495593_0011089 3300047673 Bacteria 5185
540 Ga0495593_0016593 3300047673 Bacteria 4151
541 Ga0495593_0181831 3300047673 Bacteria 1059
542 Ga0495602_0012144 3300048088 Bacteria 8869
543 Ga0495602_0142045 3300048088 Bacteria 1899
544 Ga0495602_0214375 3300048088 Bacteria 1458
545 Ga0495614_0032669 3300048089 Bacteria 2239
546 Ga0496100_0451671 3300048903 Unclassified 985
547 Ga0496101_0020528 3300048904 Bacteria 4524
548 Ga0496102_0009970 3300048905 Bacteria 8168
549 Ga0496102_0010929 3300048905 Bacteria 7820
550 Ga0496104_0026839 3300048907 Bacteria 5323
551 Ga0496104_0266262 3300048907 Bacteria 1626
552 Ga0496104_0346523 3300048907 Bacteria 1398
553 Ga0496105_0006554 3300048908 Bacteria 8956
554 Ga0496105_0038601 3300048908 Unclassified 3935
555 Ga0496106_0009899 3300048909 Bacteria 7039
556 Ga0496106_0109118 3300048909 Bacteria 2153
557 Ga0496107_0107789 3300048910 Bacteria 2046
558 Ga0496107_0115560 3300048910 Bacteria 1975
559 Ga0496109_0148551 3300048912 Bacteria 2194
560 Ga0496110_0024981 3300048913 Bacteria 5100
561 Ga0496110_0133499 3300048913 Bacteria 2242
562 Ga0496111_0003347 3300048914 Bacteria 9913
563 Ga0496111_0190122 3300048914 Bacteria 1526
564 Ga0496112_0002221 3300048915 Bacteria 15486
565 Ga0496112_0046538 3300048915 Unclassified 4255
566 Ga0496112_0683793 3300048915 Unclassified 954
567 Ga0496113_0104887 3300048916 Bacteria 2194
568 Ga0496113_0364609 3300048916 Bacteria 1159
569 Ga0496114_0103935 3300048917 Bacteria 2428
570 Ga0496115_0046841 3300048918 Bacteria 3457
571 Ga0496115_0138212 3300048918 Bacteria 2009
572 Ga0496116_0008081 3300048919 Bacteria 9199
573 Ga0496116_0020316 3300048919 Bacteria 5048
574 Ga0496116_0242214 3300048919 Bacteria 905
575 Ga0496117_0006969 3300048920 Bacteria 11205
576 Ga0496117_0016111 3300048920 Bacteria 6325
577 Ga0496117_0046765 3300048920 Bacteria 3110
578 Ga0496117_0065779 3300048920 Bacteria 2462
579 Ga0496118_0000316 3300048921 Bacteria 83449
580 Ga0496118_0000365 3300048921 Bacteria 76413
581 Ga0496118_0063083 3300048921 Bacteria 2729
582 Ga0496118_0297227 3300048921 Bacteria 889
583 Ga0496121_0053387 3300048924 Bacteria 3386
584 Ga0496121_0130554 3300048924 Bacteria 1881
585 Ga0496122_0000383 3300048925 Bacteria 94797
586 Ga0496122_0019094 3300048925 Bacteria 6285
587 Ga0496122_0304136 3300048925 Bacteria 858
588 Ga0496123_0000249 3300048926 Bacteria 108969
589 Ga0496123_0004114 3300048926 Bacteria 15593
590 Ga0496123_0008012 3300048926 Bacteria 9786
591 Ga0496123_0082795 3300048926 Bacteria 1943
592 Ga0496123_0092781 3300048926 Bacteria 1785
593 Ga0496124_0000317 3300048927 Bacteria 89188
594 Ga0496124_0071977 3300048927 Bacteria 2863
595 Ga0496124_0247434 3300048927 Bacteria 1321
596 Ga0496124_0481868 3300048927 Bacteria 837
597 Ga0496125_0010015 3300048928 Bacteria 9632
598 Ga0496125_0058594 3300048928 Bacteria 3110
599 Ga0496126_0000231 3300048929 Bacteria 120254
600 Ga0496126_0000629 3300048929 Bacteria 66001
601 Ga0496126_0013342 3300048929 Bacteria 8365
602 Ga0496126_0046950 3300048929 Bacteria 3956
603 Ga0496126_0067531 3300048929 Bacteria 3194
604 Ga0496126_0114455 3300048929 Bacteria 2347
605 Ga0495678_011455 3300049459 Bacteria 4245
606 Ga0495682_0019414 3300049460 Bacteria 2557
607 Ga0501321_015971 3300049537 Bacteria 889
608 Ga0501323_013172 3300049539 Bacteria 1020
609 Ga0501323_026524 3300049539 Bacteria 794
610 Ga0501034_0147518 3300049571 Bacteria 2329
611 Ga0501034_0561658 3300049571 Bacteria 1050
612 Ga0501036_0726482 3300049572 Bacteria 820
613 Ga0501047_0109754 3300049581 Bacteria 2641
614 Ga0501047_0591437 3300049581 Bacteria 932
615 Ga0501070_0359636 3300049586 Bacteria 1181
616 Ga0501209_000168 3300049656 Bacteria 7397
617 Ga0501249_043114 3300049679 Bacteria 1026
618 Ga0501225_0028464 3300049705 Bacteria 1536
619 Ga0501080_0134538 3300049742 Bacteria 2288
620 Ga0501080_0714055 3300049742 Bacteria 883
621 Ga0501080_0961927 3300049742 Unclassified 742
622 Ga0501083_0376226 3300049744 Unclassified 924
623 Ga0501262_000117 3300049759 Bacteria 9842
624 Ga0501044_0001012 3300049823 Bacteria 33764
625 nmdc:mga03n38_154812_c1 3300050490 Bacteria 1156
626 nmdc:mga03n38_3331_c1 3300050490 Bacteria 5145
627 nmdc:mga00v17_112546_c1 3300050491 Bacteria 1727
628 nmdc:mga00v17_24396_c1 3300050491 Bacteria 3508
629 nmdc:mga0yw44_64083_c1 3300050492 Bacteria 2261
630 nmdc:mga0k408_88990_c1 3300050493 Bacteria 1813
631 nmdc:mga06z11_151583_c1 3300050494 Bacteria 1318
632 nmdc:mga07m45_12158_c1 3300050496 Bacteria 4542
633 nmdc:mga07m45_32586_c1 3300050496 Bacteria 2890
634 nmdc:mga05p37_48474_c1 3300050507 Bacteria 5224
635 nmdc:mga08y16_29818_c1 3300050511 Bacteria 5744
636 nmdc:mga0n895_88189_c1 3300050512 Bacteria 3102
637 nmdc:mga0rr50_15500_c1 3300050513 Bacteria 5033
638 nmdc:mga0rr50_303638_c1 3300050513 Bacteria 1335
639 nmdc:mga08x19_33518_c1 3300050514 Bacteria 3241
640 nmdc:mga0a205_33910_c1 3300050515 Bacteria 4896
641 nmdc:mga0sz30_15762_c1 3300050516 Bacteria 2990
642 Ga0495601_0007434 3300053077 Bacteria 6423
643 Ga0500594_0102160 3300053118 Bacteria 883
644 Ga0500618_000108 3300053125 Bacteria 67640
645 Ga0500618_002276 3300053125 Bacteria 7422
646 Ga0500618_017872 3300053125 Bacteria 1761
647 Ga0500559_0000906 3300053136 Bacteria 18900
648 Ga0500559_0001710 3300053136 Bacteria 12058

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10565296 Ga0157369_105652962 198
2 3300013307 Ga0157372_10130228 Ga0157372_101302282 198
3 3300044693 Ga0466961_0605567 Ga0466961_0605567_32_637 198
4 3300049459 Ga0495678_011455 Ga0495678_011455_2260_3000 219
5 3300025916 Ga0207663_10219459 Ga0207663_102194591 226
6 3300021388 Ga0213875_10027813 Ga0213875_100278133 228
7 3300037853 Ga0436364_0020996 Ga0436364_0020996_970_1695 228
8 3300009147 Ga0114129_10044287 Ga0114129_100442872 229
9 3300009147 Ga0114129_10058581 Ga0114129_100585812 229
10 3300036712 Ga0316584_0411309 Ga0316584_0411309_227_919 229
11 3300050507 nmdc:mga05p37_48474_c1 nmdc:mga05p37_48474_c1_229_918 229
12 3300050513 nmdc:mga0rr50_303638_c1 nmdc:mga0rr50_303638_c1_165_854 229
13 iso_pu_bacteria 2511231003 2511248361 229
14 iso_pu_bacteria 2842711865 2842714206 229
15 3300006844 Ga0075428_100026987 Ga0075428_1000269876 230
16 3300009093 Ga0105240_10000018 Ga0105240_10000018253 230
17 3300025913 Ga0207695_10000141 Ga0207695_1000014130 230
18 3300030760 Ga0265762_1026356 Ga0265762_10263562 230
19 3300045836 Ga0466958_0024051 Ga0466958_0024051_65_787 230
20 3300049571 Ga0501034_0561658 Ga0501034_0561658_199_894 230
21 3300049742 Ga0501080_0134538 Ga0501080_0134538_1222_1944 230
22 iso_pu_bacteria 2821131069 2821131442 230
23 3300003856 Ga0058692_1000291 Ga0058692_100029112 231
24 3300003856 Ga0058692_1000709 Ga0058692_10007096 231
25 3300003856 Ga0058692_1021849 Ga0058692_10218491 231
26 3300005563 Ga0068855_100004153 Ga0068855_10000415312 231
27 3300005985 Ga0081539_10036407 Ga0081539_100364074 231
28 3300009093 Ga0105240_10135970 Ga0105240_101359701 231
29 3300009147 Ga0114129_10036550 Ga0114129_100365505 231
30 3300009551 Ga0105238_10350795 Ga0105238_103507952 231
31 3300025924 Ga0207694_10245175 Ga0207694_102451751 231
32 3300025949 Ga0207667_10036229 Ga0207667_100362292 231
33 3300027312 Ga0209371_1000061 Ga0209371_1000061133 231
34 3300027312 Ga0209371_1002070 Ga0209371_10020703 231
35 3300030500 Ga0268256_1000059 Ga0268256_100005981 231
36 3300030500 Ga0268256_1018546 Ga0268256_10185462 231
37 3300035398 Ga0316574_0000112 Ga0316574_0000112_18435_19133 231
38 3300044842 Ga0466957_0026464 Ga0466957_0026464_320_1015 231
39 3300049571 Ga0501034_0147518 Ga0501034_0147518_1163_1858 231
40 3300049572 Ga0501036_0726482 Ga0501036_0726482_78_773 231
41 3300049581 Ga0501047_0109754 Ga0501047_0109754_797_1492 231
42 3300049742 Ga0501080_0961927 Ga0501080_0961927_12_707 231
43 3300049744 Ga0501083_0376226 Ga0501083_0376226_131_826 231
44 3300049823 Ga0501044_0001012 Ga0501044_0001012_18224_18919 231
45 3300005327 Ga0070658_10047104 Ga0070658_100471043 232
46 3300005329 Ga0070683_100106764 Ga0070683_1001067643 232
47 3300005330 Ga0070690_100028859 Ga0070690_1000288593 232
48 3300005334 Ga0068869_100025409 Ga0068869_1000254091 232
49 3300005335 Ga0070666_10144908 Ga0070666_101449082 232
50 3300005338 Ga0068868_100005504 Ga0068868_1000055044 232
51 3300005340 Ga0070689_100881408 Ga0070689_1008814081 232
52 3300005344 Ga0070661_100028850 Ga0070661_1000288505 232
53 3300005345 Ga0070692_10277711 Ga0070692_102777112 232
54 3300005355 Ga0070671_100009337 Ga0070671_1000093374 232
55 3300005364 Ga0070673_100000141 Ga0070673_1000001418 232
56 3300005436 Ga0070713_100491184 Ga0070713_1004911842 232
57 3300005440 Ga0070705_100390213 Ga0070705_1003902131 232
58 3300005445 Ga0070708_100201248 Ga0070708_1002012482 232
59 3300005455 Ga0070663_100007884 Ga0070663_1000078845 232
60 3300005458 Ga0070681_10229550 Ga0070681_102295503 232
61 3300005458 Ga0070681_10316342 Ga0070681_103163422 232
62 3300005458 Ga0070681_10454036 Ga0070681_104540362 232
63 3300005466 Ga0070685_10002403 Ga0070685_100024034 232
64 3300005467 Ga0070706_100074654 Ga0070706_1000746542 232
65 3300005467 Ga0070706_100091055 Ga0070706_1000910553 232
66 3300005467 Ga0070706_100579633 Ga0070706_1005796332 232
67 3300005468 Ga0070707_100047627 Ga0070707_1000476274 232
68 3300005468 Ga0070707_100296416 Ga0070707_1002964162 232
69 3300005471 Ga0070698_100011515 Ga0070698_1000115156 232
70 3300005471 Ga0070698_100182678 Ga0070698_1001826782 232
71 3300005471 Ga0070698_100214916 Ga0070698_1002149162 232
72 3300005518 Ga0070699_100037018 Ga0070699_1000370185 232
73 3300005536 Ga0070697_100106965 Ga0070697_1001069654 232
74 3300005536 Ga0070697_100155673 Ga0070697_1001556732 232
75 3300005536 Ga0070697_100273077 Ga0070697_1002730771 232
76 3300005539 Ga0068853_100024171 Ga0068853_1000241713 232
77 3300005539 Ga0068853_100140920 Ga0068853_1001409203 232
78 3300005545 Ga0070695_100024027 Ga0070695_1000240275 232
79 3300005545 Ga0070695_100086364 Ga0070695_1000863641 232
80 3300005546 Ga0070696_100711050 Ga0070696_1007110501 232
81 3300005547 Ga0070693_100026364 Ga0070693_1000263642 232
82 3300005549 Ga0070704_100036073 Ga0070704_1000360734 232
83 3300005563 Ga0068855_100356754 Ga0068855_1003567542 232
84 3300005578 Ga0068854_100000001 Ga0068854_100000001318 232
85 3300005614 Ga0068856_100169576 Ga0068856_1001695762 232
86 3300005614 Ga0068856_100323564 Ga0068856_1003235642 232
87 3300005614 Ga0068856_100727060 Ga0068856_1007270601 232
88 3300005617 Ga0068859_100005189 Ga0068859_10000518913 232
89 3300005618 Ga0068864_100000917 Ga0068864_10000091719 232
90 3300005841 Ga0068863_100000513 Ga0068863_10000051320 232
91 3300005842 Ga0068858_100001759 Ga0068858_1000017592 232
92 3300005843 Ga0068860_100005306 Ga0068860_10000530611 232
93 3300006028 Ga0070717_10116035 Ga0070717_101160353 232
94 3300006028 Ga0070717_10343343 Ga0070717_103433432 232
95 3300006163 Ga0070715_10058956 Ga0070715_100589562 232
96 3300006173 Ga0070716_100100769 Ga0070716_1001007692 232
97 3300006237 Ga0097621_100004565 Ga0097621_1000045656 232
98 3300006237 Ga0097621_100489273 Ga0097621_1004892732 232
99 3300006358 Ga0068871_100015616 Ga0068871_1000156164 232
100 3300006852 Ga0075433_10039977 Ga0075433_100399773 232
101 3300006871 Ga0075434_100033336 Ga0075434_1000333364 232
102 3300006914 Ga0075436_100069460 Ga0075436_1000694602 232
103 3300006931 Ga0097620_100005190 Ga0097620_10000519013 232
104 3300007076 Ga0075435_100019214 Ga0075435_1000192142 232
105 3300007788 Ga0099795_10143964 Ga0099795_101439641 232
106 3300009093 Ga0105240_10137945 Ga0105240_101379452 232
107 3300009093 Ga0105240_10175872 Ga0105240_101758723 232
108 3300009093 Ga0105240_10701646 Ga0105240_107016462 232
109 3300009098 Ga0105245_10002409 Ga0105245_1000240913 232
110 3300009098 Ga0105245_10008952 Ga0105245_100089525 232
111 3300009098 Ga0105245_10267409 Ga0105245_102674093 232
112 3300009098 Ga0105245_10338506 Ga0105245_103385062 232
113 3300009101 Ga0105247_10013569 Ga0105247_100135694 232
114 3300009147 Ga0114129_10039913 Ga0114129_100399137 232
115 3300009147 Ga0114129_10160674 Ga0114129_101606742 232
116 3300009174 Ga0105241_10540192 Ga0105241_105401921 232
117 3300009176 Ga0105242_10629794 Ga0105242_106297942 232
118 3300009177 Ga0105248_10001779 Ga0105248_100017793 232
119 3300009551 Ga0105238_10779829 Ga0105238_107798291 232
120 3300010375 Ga0105239_10215416 Ga0105239_102154162 232
121 3300013296 Ga0157374_10167559 Ga0157374_101675593 232
122 3300013297 Ga0157378_10281001 Ga0157378_102810012 232
123 3300013306 Ga0163162_10002679 Ga0163162_1000267913 232
124 3300014326 Ga0157380_10053974 Ga0157380_100539742 232
125 3300014968 Ga0157379_10031675 Ga0157379_100316753 232
126 3300014968 Ga0157379_10128366 Ga0157379_101283663 232
127 3300025900 Ga0207710_10010419 Ga0207710_100104194 232
128 3300025903 Ga0207680_10018401 Ga0207680_100184012 232
129 3300025903 Ga0207680_10473374 Ga0207680_104733742 232
130 3300025909 Ga0207705_10036448 Ga0207705_100364482 232
131 3300025910 Ga0207684_10026476 Ga0207684_100264764 232
132 3300025910 Ga0207684_10258163 Ga0207684_102581632 232
133 3300025912 Ga0207707_10166487 Ga0207707_101664872 232
134 3300025915 Ga0207693_10219465 Ga0207693_102194653 232
135 3300025920 Ga0207649_10087076 Ga0207649_100870763 232
136 3300025922 Ga0207646_10037926 Ga0207646_100379264 232
137 3300025925 Ga0207650_10151889 Ga0207650_101518891 232
138 3300025927 Ga0207687_10001314 Ga0207687_100013145 232
139 3300025927 Ga0207687_10013870 Ga0207687_100138704 232
140 3300025928 Ga0207700_10179425 Ga0207700_101794251 232
141 3300025929 Ga0207664_10250962 Ga0207664_102509622 232
142 3300025931 Ga0207644_10148774 Ga0207644_101487742 232
143 3300025936 Ga0207670_10016823 Ga0207670_100168232 232
144 3300025939 Ga0207665_10094081 Ga0207665_100940813 232
145 3300025941 Ga0207711_10209509 Ga0207711_102095092 232
146 3300025981 Ga0207640_10000003 Ga0207640_1000000391 232
147 3300026023 Ga0207677_10000312 Ga0207677_1000031229 232
148 3300026035 Ga0207703_10011122 Ga0207703_100111221 232
149 3300026041 Ga0207639_10077869 Ga0207639_100778693 232
150 3300026067 Ga0207678_10000769 Ga0207678_1000076922 232
151 3300026078 Ga0207702_10102570 Ga0207702_101025703 232
152 3300026078 Ga0207702_10475188 Ga0207702_104751882 232
153 3300026078 Ga0207702_10575720 Ga0207702_105757201 232
154 3300026088 Ga0207641_10018610 Ga0207641_100186104 232
155 3300026095 Ga0207676_10061410 Ga0207676_100614103 232
156 3300026142 Ga0207698_10489196 Ga0207698_104891961 232
157 3300028381 Ga0268264_10002693 Ga0268264_1000269314 232
158 3300028653 Ga0265323_10003834 Ga0265323_100038343 232
159 3300031901 Ga0307406_10327634 Ga0307406_103276341 232
160 3300035111 Ga0373923_0115267 Ga0373923_0115267_230_931 232
161 3300035111 Ga0373923_0178355 Ga0373923_0178355_217_924 232
162 3300035120 Ga0373957_0007425 Ga0373957_0007425_2625_3326 232
163 3300035172 Ga0373955_0013903 Ga0373955_0013903_1302_2009 232
164 3300035410 Ga0373924_0047722 Ga0373924_0047722_565_1266 232
165 3300035691 Ga0373931_0109525 Ga0373931_0109525_760_1458 232
166 3300035695 Ga0373927_0043621 Ga0373927_0043621_146_847 232
167 3300035695 Ga0373927_0171280 Ga0373927_0171280_187_894 232
168 3300036401 Ga0373937_0018691 Ga0373937_0018691_980_1687 232
169 3300036401 Ga0373937_0054333 Ga0373937_0054333_2015_2722 232
170 3300036401 Ga0373937_0480549 Ga0373937_0480549_369_1067 232
171 3300036401 Ga0373937_0748473 Ga0373937_0748473_37_735 232
172 3300036401 Ga0373937_0982749 Ga0373937_0982749_53_754 232
173 3300037068 Ga0373925_0019595 Ga0373925_0019595_3904_4605 232
174 3300037418 Ga0395900_0392285 Ga0395900_0392285_402_1100 232
175 3300042005 Ga0439448_0045545 Ga0439448_0045545_29_736 232
176 3300042129 Ga0450891_005710 Ga0450891_005710_172_870 232
177 3300042876 Ga0451577_0494765 Ga0451577_0494765_321_1019 232
178 3300044712 Ga0453684_0539919 Ga0453684_0539919_401_1102 232
179 3300044842 Ga0466957_0002291 Ga0466957_0002291_2080_2787 232
180 3300045976 Ga0466967_0934065 Ga0466967_0934065_139_837 232
181 3300046462 Ga0495651_0098527 Ga0495651_0098527_478_1185 232
182 3300046477 Ga0495664_0004899 Ga0495664_0004899_989_1690 232
183 3300046516 Ga0495628_0103038 Ga0495628_0103038_938_1639 232
184 3300046533 Ga0495640_0060018 Ga0495640_0060018_1411_2112 232
185 3300046543 Ga0495645_0014763 Ga0495645_0014763_1880_2581 232
186 3300046543 Ga0495645_0230457 Ga0495645_0230457_13_714 232
187 3300046681 Ga0495647_0067293 Ga0495647_0067293_486_1187 232
188 3300048903 Ga0496100_0451671 Ga0496100_0451671_225_932 232
189 3300048905 Ga0496102_0010929 Ga0496102_0010929_183_890 232
190 3300048907 Ga0496104_0346523 Ga0496104_0346523_200_904 232
191 3300048908 Ga0496105_0038601 Ga0496105_0038601_211_918 232
192 3300048910 Ga0496107_0107789 Ga0496107_0107789_105_806 232
193 3300048913 Ga0496110_0024981 Ga0496110_0024981_2781_3488 232
194 3300048914 Ga0496111_0003347 Ga0496111_0003347_7329_8036 232
195 3300048915 Ga0496112_0002221 Ga0496112_0002221_14266_14967 232
196 3300048915 Ga0496112_0046538 Ga0496112_0046538_318_1022 232
197 3300048915 Ga0496112_0683793 Ga0496112_0683793_138_845 232
198 3300048916 Ga0496113_0104887 Ga0496113_0104887_809_1516 232
199 3300048918 Ga0496115_0046841 Ga0496115_0046841_62_763 232
200 3300048918 Ga0496115_0138212 Ga0496115_0138212_100_804 232
201 3300048929 Ga0496126_0000231 Ga0496126_0000231_13111_13815 232
202 3300049539 Ga0501323_026524 Ga0501323_026524_50_748 232
203 3300049581 Ga0501047_0591437 Ga0501047_0591437_158_859 232
204 3300049742 Ga0501080_0714055 Ga0501080_0714055_37_738 232
205 3300050492 nmdc:mga0yw44_64083_c1 nmdc:mga0yw44_64083_c1_297_998 232
206 3300050511 nmdc:mga08y16_29818_c1 nmdc:mga08y16_29818_c1_2797_3495 232
207 3300050512 nmdc:mga0n895_88189_c1 nmdc:mga0n895_88189_c1_1534_2235 232
208 3300050513 nmdc:mga0rr50_15500_c1 nmdc:mga0rr50_15500_c1_1603_2304 232
209 3300050514 nmdc:mga08x19_33518_c1 nmdc:mga08x19_33518_c1_724_1425 232
210 3300050515 nmdc:mga0a205_33910_c1 nmdc:mga0a205_33910_c1_2005_2706 232
211 3300053077 Ga0495601_0007434 Ga0495601_0007434_1315_2022 232
212 3300003322 rootL2_10162574 rootL2_101625742 233
213 3300003771 Ga0055526_1000180 Ga0055526_100018018 233
214 3300005335 Ga0070666_10006014 Ga0070666_100060147 233
215 3300005344 Ga0070661_100036407 Ga0070661_1000364074 233
216 3300005347 Ga0070668_100018057 Ga0070668_1000180575 233
217 3300005365 Ga0070688_100270959 Ga0070688_1002709591 233
218 3300005367 Ga0070667_100083824 Ga0070667_1000838244 233
219 3300005367 Ga0070667_100478708 Ga0070667_1004787082 233
220 3300005445 Ga0070708_100079876 Ga0070708_1000798763 233
221 3300005455 Ga0070663_100022801 Ga0070663_1000228014 233
222 3300005466 Ga0070685_10002790 Ga0070685_100027908 233
223 3300005548 Ga0070665_100000266 Ga0070665_10000026669 233
224 3300005564 Ga0070664_100874524 Ga0070664_1008745241 233
225 3300005578 Ga0068854_100022639 Ga0068854_1000226392 233
226 3300005616 Ga0068852_100044907 Ga0068852_1000449073 233
227 3300005616 Ga0068852_100097887 Ga0068852_1000978873 233
228 3300005834 Ga0068851_10003540 Ga0068851_100035404 233
229 3300005842 Ga0068858_100021689 Ga0068858_1000216892 233
230 3300006353 Ga0075370_10172203 Ga0075370_101722032 233
231 3300009036 Ga0105244_10017785 Ga0105244_100177853 233
232 3300009093 Ga0105240_10000377 Ga0105240_1000037710 233
233 3300009177 Ga0105248_10215872 Ga0105248_102158723 233
234 3300009177 Ga0105248_10544207 Ga0105248_105442072 233
235 3300009545 Ga0105237_10086872 Ga0105237_100868723 233
236 3300009551 Ga0105238_10006002 Ga0105238_100060025 233
237 3300009551 Ga0105238_10106903 Ga0105238_101069032 233
238 3300009553 Ga0105249_10001046 Ga0105249_1000104623 233
239 3300013104 Ga0157370_10171353 Ga0157370_101713532 233
240 3300013105 Ga0157369_10076866 Ga0157369_100768663 233
241 3300013307 Ga0157372_10119090 Ga0157372_101190903 233
242 3300013307 Ga0157372_10756115 Ga0157372_107561151 233
243 3300025295 Ga0209564_1000009 Ga0209564_1000009333 233
244 3300025321 Ga0207656_10004236 Ga0207656_100042364 233
245 3300025728 Ga0207655_1042915 Ga0207655_10429153 233
246 3300025903 Ga0207680_10004781 Ga0207680_100047815 233
247 3300025904 Ga0207647_10001123 Ga0207647_1000112317 233
248 3300025904 Ga0207647_10005424 Ga0207647_100054243 233
249 3300025913 Ga0207695_10000007 Ga0207695_10000007174 233
250 3300025913 Ga0207695_10017795 Ga0207695_100177956 233
251 3300025914 Ga0207671_10013102 Ga0207671_100131025 233
252 3300025920 Ga0207649_10219175 Ga0207649_102191752 233
253 3300025924 Ga0207694_10000996 Ga0207694_1000099621 233
254 3300025924 Ga0207694_10002131 Ga0207694_100021316 233
255 3300025925 Ga0207650_10004121 Ga0207650_100041215 233
256 3300025941 Ga0207711_10380127 Ga0207711_103801272 233
257 3300025961 Ga0207712_10000349 Ga0207712_1000034912 233
258 3300025972 Ga0207668_10010539 Ga0207668_100105395 233
259 3300025981 Ga0207640_10099922 Ga0207640_100999222 233
260 3300025986 Ga0207658_10164602 Ga0207658_101646022 233
261 3300025986 Ga0207658_10166824 Ga0207658_101668243 233
262 3300026035 Ga0207703_10005588 Ga0207703_100055882 233
263 3300026041 Ga0207639_10000102 Ga0207639_1000010255 233
264 3300026067 Ga0207678_10023453 Ga0207678_100234533 233
265 3300026078 Ga0207702_10780041 Ga0207702_107800412 233
266 3300026142 Ga0207698_10008725 Ga0207698_100087255 233
267 3300028379 Ga0268266_10000006 Ga0268266_10000006533 233
268 3300028794 Ga0307515_10494513 Ga0307515_104945131 233
269 3300031456 Ga0307513_10191691 Ga0307513_101916912 233
270 3300037471 Ga0395905_0583857 Ga0395905_0583857_90_791 233
271 3300037853 Ga0436364_1550326 Ga0436364_1550326_3359_4099 233
272 3300044658 Ga0466972_0001438 Ga0466972_0001438_9455_10156 233
273 3300044658 Ga0466972_0118302 Ga0466972_0118302_269_976 233
274 3300044765 Ga0466970_0000972 Ga0466970_0000972_1140_1841 233
275 3300046471 Ga0495650_0000166 Ga0495650_0000166_129892_130593 233
276 3300046474 Ga0495605_0000059 Ga0495605_0000059_133690_134442 233
277 3300046506 Ga0495583_0134277 Ga0495583_0134277_215_922 233
278 3300046507 Ga0495606_0000064 Ga0495606_0000064_162056_162757 233
279 3300046512 Ga0495610_0002878 Ga0495610_0002878_12668_13369 233
280 3300046558 Ga0495633_0183968 Ga0495633_0183968_247_948 233
281 3300046616 Ga0495668_0001239 Ga0495668_0001239_3693_4394 233
282 3300046616 Ga0495668_0028854 Ga0495668_0028854_1011_1718 233
283 3300046665 Ga0495661_0017821 Ga0495661_0017821_510_1271 233
284 3300046691 Ga0495670_0007113 Ga0495670_0007113_390_1118 233
285 3300048921 Ga0496118_0063083 Ga0496118_0063083_762_1463 233
286 3300048927 Ga0496124_0071977 Ga0496124_0071977_510_1211 233
287 3300048927 Ga0496124_0247434 Ga0496124_0247434_576_1277 233
288 3300048927 Ga0496124_0481868 Ga0496124_0481868_53_754 233
289 3300048929 Ga0496126_0114455 Ga0496126_0114455_162_863 233
290 3300049537 Ga0501321_015971 Ga0501321_015971_56_757 233
291 3300049539 Ga0501323_013172 Ga0501323_013172_172_873 233
292 3300005365 Ga0070688_100225560 Ga0070688_1002255602 234
293 3300005435 Ga0070714_100003209 Ga0070714_1000032098 234
294 3300005456 Ga0070678_100118604 Ga0070678_1001186042 234
295 3300005840 Ga0068870_10018451 Ga0068870_100184513 234
296 3300006237 Ga0097621_100543437 Ga0097621_1005434372 234
297 3300025929 Ga0207664_10003413 Ga0207664_100034135 234
298 3300025936 Ga0207670_10371508 Ga0207670_103715082 234
299 3300031727 Ga0316576_10096584 Ga0316576_100965842 234
300 3300031728 Ga0316578_10102308 Ga0316578_101023082 234
301 3300036712 Ga0316584_0102676 Ga0316584_0102676_1374_2081 234
302 3300039438 Ga0436360_1282181 Ga0436360_1282181_11282_11995 234
303 3300039447 Ga0436361_0430826 Ga0436361_0430826_1447_2160 234
304 3300045836 Ga0466958_0170227 Ga0466958_0170227_63_797 234
305 3300046463 Ga0495653_0000409 Ga0495653_0000409_12766_13470 234
306 3300046471 Ga0495650_0000503 Ga0495650_0000503_23237_24019 234
307 3300046507 Ga0495606_0000156 Ga0495606_0000156_100166_100870 234
308 3300046524 Ga0495648_0000675 Ga0495648_0000675_10131_10913 234
309 3300046692 Ga0495671_0000001 Ga0495671_0000001_229570_230352 234
310 3300047469 Ga0495673_0000003 Ga0495673_0000003_1466139_1466843 234
311 3300048919 Ga0496116_0242214 Ga0496116_0242214_44_748 234
312 3300048921 Ga0496118_0297227 Ga0496118_0297227_42_758 234
313 3300048926 Ga0496123_0004114 Ga0496123_0004114_14797_15513 234
314 3300048929 Ga0496126_0067531 Ga0496126_0067531_2414_3118 234
315 3300053118 Ga0500594_0102160 Ga0500594_0102160_108_812 234
316 3300053125 Ga0500618_000108 Ga0500618_000108_31678_32382 234
317 3300005843 Ga0068860_100148933 Ga0068860_1001489333 235
318 3300028381 Ga0268264_10632363 Ga0268264_106323632 235
319 3300046457 Ga0495590_0002911 Ga0495590_0002911_5393_6100 235
320 3300046507 Ga0495606_0039372 Ga0495606_0039372_544_1251 235
321 3300048927 Ga0496124_0000317 Ga0496124_0000317_39210_39917 235
322 3300048928 Ga0496125_0010015 Ga0496125_0010015_3289_3996 235
323 iso_pu_bacteria 2513020051 2513228123 235
324 iso_pu_bacteria 2643221658 2644325632 235
325 iso_pu_bacteria 2643221672 2644400979 235
326 iso_pu_bacteria 2734482258 2735816510 235
327 iso_pu_bacteria 2738541307 2738883212 235
328 iso_pu_bacteria 2842677519 2842679538 235
329 iso_pu_bacteria 2842733646 2842733954 235
330 iso_pu_bacteria 2842747753 2842749756 235
331 iso_pu_bacteria 2904434214 2904439361 235
332 iso_pu_bacteria 2904541872 2904546086 235
333 iso_pu_bacteria 2919462493 2919462498 235
334 iso_pu_bacteria 2929520902 2929523220 235
335 iso_pu_bacteria 2945945610 2945948694 235
336 iso_pu_bacteria 2945972063 2945972327 235
337 3300037853 Ga0436364_1091802 Ga0436364_1091802_102_845 236
338 iso_pu_bacteria 2842718218 2842722236 236
339 iso_pu_bacteria 2974320154 2974320900 236
340 iso_pu_bacteria 3007315729 3007319500 236
341 iso_pu_bacteria 2508501125 2509128319 237
342 iso_pu_bacteria 2512047030 2512350534 237
343 iso_pu_bacteria 2513237151 2513958887 237
344 iso_pu_bacteria 2515154122 2515682985 237
345 iso_pu_bacteria 2519103095 2519463292 237
346 iso_pu_bacteria 2526164713 2527076165 237
347 iso_pu_bacteria 2547132374 2548499543 237
348 iso_pu_bacteria 2582581311 2585295110 237
349 iso_pu_bacteria 2599185239 2599738904 237
350 iso_pu_bacteria 2643221570 2643866381 237
351 iso_pu_bacteria 2643221596 2643994371 237
352 iso_pu_bacteria 2643221717 2644648209 237
353 iso_pu_bacteria 2751185846 2753568119 237
354 iso_pu_bacteria 2808606384 2808970990 237
355 iso_pu_bacteria 2808606390 2809005821 237
356 iso_pu_bacteria 2808606391 2809012422 237
357 iso_pu_bacteria 2816332253 2817263334 237
358 iso_pu_bacteria 2816332256 2817276715 237
359 iso_pu_bacteria 2816332286 2817452787 237
360 iso_pu_bacteria 2818991450 2819621493 237
361 iso_pu_bacteria 2818991452 2819631477 237
362 iso_pu_bacteria 2842454564 2842461081 237
363 iso_pu_bacteria 2902682994 2902684203 237
364 iso_pu_bacteria 2904483920 2904486225 237
365 iso_pu_bacteria 2919527303 2919527563 237
366 iso_pu_bacteria 2928108538 2928112022 237
367 iso_pu_bacteria 2928135762 2928139434 237
368 iso_pu_bacteria 2928157003 2928163587 237
369 iso_pu_bacteria 2928163908 2928166535 237
370 iso_pu_bacteria 2928170801 2928176053 237
371 iso_pu_bacteria 2928503688 2928508702 237
372 iso_pu_bacteria 2981990288 2981996502 237
373 iso_pu_bacteria 641736154 642415271 237
374 iso_pu_bacteria 8018845410 8018847210 237
375 iso_pu_bacteria 8020807995 8020812328 237
376 iso_pu_bacteria 8021120328 8021126069 237
377 iso_pu_bacteria 8040167225 8040172031 237
378 iso_pu_bacteria 8040173305 8040177998 237
379 iso_pu_bacteria 8055266321 8055269713 237
380 iso_pu_bacteria 8055301274 8055305976 237
381 3300005841 Ga0068863_100757318 Ga0068863_1007573182 238
382 3300002773 JGI25152J39213_1000073 JGI25152J39213_10000731 239
383 3300002773 JGI25152J39213_1010358 JGI25152J39213_10103582 239
384 3300002774 JGI25150J39212_1000062 JGI25150J39212_10000621 239
385 3300002987 JGI25159J45721_1000212 JGI25159J45721_100021239 239
386 3300003187 JGI25151J46595_10000224 JGI25151J46595_1000022461 239
387 3300003187 JGI25151J46595_10000255 JGI25151J46595_1000025569 239
388 3300003187 JGI25151J46595_10001680 JGI25151J46595_1000168015 239
389 3300003215 JGI25153J46596_10000165 JGI25153J46596_100001651 239
390 3300003354 JGI25160J50197_1000410 JGI25160J50197_100041039 239
391 3300003374 JGI25161J50226_1000688 JGI25161J50226_10006881 239
392 3300003578 Ga0006562J51391_1071781 Ga0006562J51391_10717811 239
393 3300003771 Ga0055526_1000146 Ga0055526_100014669 239
394 3300003773 Ga0055537_1000090 Ga0055537_10000901 239
395 3300003775 Ga0055524_1000195 Ga0055524_10001951 239
396 3300003781 Ga0055536_1006008 Ga0055536_10060086 239
397 3300003781 Ga0055536_1051248 Ga0055536_10512481 239
398 3300003784 Ga0055534_1000101 Ga0055534_10001011 239
399 3300003790 Ga0055528_1000111 Ga0055528_10001111 239
400 3300003791 Ga0055530_10018270 Ga0055530_100182702 239
401 3300003792 Ga0055540_1000395 Ga0055540_100039514 239
402 3300003792 Ga0055540_1006726 Ga0055540_10067262 239
403 3300003794 Ga0055531_10000392 Ga0055531_1000039228 239
404 3300003794 Ga0055531_10007498 Ga0055531_100074988 239
405 3300004625 Ga0055543_1004715 Ga0055543_10047152 239
406 3300005262 Ga0065165_1001334 Ga0065165_100133439 239
407 3300005367 Ga0070667_100030394 Ga0070667_1000303944 239
408 3300005456 Ga0070678_100272330 Ga0070678_1002723303 239
409 3300005457 Ga0070662_100126021 Ga0070662_1001260212 239
410 3300005539 Ga0068853_100864020 Ga0068853_1008640201 239
411 3300005577 Ga0068857_100055881 Ga0068857_1000558813 239
412 3300005578 Ga0068854_100338832 Ga0068854_1003388322 239
413 3300005844 Ga0068862_100534488 Ga0068862_1005344881 239
414 3300006048 Ga0075363_100081017 Ga0075363_1000810172 239
415 3300006195 Ga0075366_10005365 Ga0075366_100053656 239
416 3300006237 Ga0097621_100174707 Ga0097621_1001747072 239
417 3300006237 Ga0097621_100367527 Ga0097621_1003675272 239
418 3300006353 Ga0075370_10006582 Ga0075370_100065824 239
419 3300006353 Ga0075370_10014671 Ga0075370_100146715 239
420 3300006353 Ga0075370_10104777 Ga0075370_101047772 239
421 3300006358 Ga0068871_100433141 Ga0068871_1004331412 239
422 3300009036 Ga0105244_10008569 Ga0105244_100085695 239
423 3300009148 Ga0105243_10009475 Ga0105243_100094756 239
424 3300009148 Ga0105243_10019008 Ga0105243_100190084 239
425 3300009174 Ga0105241_10345616 Ga0105241_103456161 239
426 3300009176 Ga0105242_10003387 Ga0105242_100033872 239
427 3300009176 Ga0105242_10181124 Ga0105242_101811242 239
428 3300009551 Ga0105238_10085881 Ga0105238_100858812 239
429 3300010375 Ga0105239_10092479 Ga0105239_100924793 239
430 3300011119 Ga0105246_10256633 Ga0105246_102566332 239
431 3300013100 Ga0157373_10086165 Ga0157373_100861652 239
432 3300014497 Ga0182008_10000846 Ga0182008_100008468 239
433 3300014497 Ga0182008_10001161 Ga0182008_100011618 239
434 3300014497 Ga0182008_10012263 Ga0182008_100122634 239
435 3300014968 Ga0157379_10880854 Ga0157379_108808541 239
436 3300014969 Ga0157376_10842966 Ga0157376_108429661 239
437 3300015261 Ga0182006_1006519 Ga0182006_10065196 239
438 3300015261 Ga0182006_1019783 Ga0182006_10197832 239
439 3300015262 Ga0182007_10001504 Ga0182007_100015042 239
440 3300015262 Ga0182007_10003696 Ga0182007_100036964 239
441 3300017792 Ga0163161_10021987 Ga0163161_100219873 239
442 3300017792 Ga0163161_10561864 Ga0163161_105618641 239
443 3300025208 Ga0209436_103651 Ga0209436_1036512 239
444 3300025245 Ga0207425_1000042 Ga0207425_100004292 239
445 3300025258 Ga0209129_1000058 Ga0209129_100005898 239
446 3300025258 Ga0209129_1000265 Ga0209129_10002652 239
447 3300025263 Ga0209565_1000027 Ga0209565_1000027113 239
448 3300025273 Ga0209673_1000031 Ga0209673_1000031103 239
449 3300025284 Ga0209130_1000025 Ga0209130_1000025155 239
450 3300025291 Ga0209675_1000064 Ga0209675_100006487 239
451 3300025291 Ga0209675_1018632 Ga0209675_10186322 239
452 3300025292 Ga0209676_1001283 Ga0209676_10012833 239
453 3300025292 Ga0209676_1013104 Ga0209676_10131044 239
454 3300025294 Ga0209025_1000075 Ga0209025_1000075195 239
455 3300025294 Ga0209025_1000204 Ga0209025_10002042 239
456 3300025294 Ga0209025_1000380 Ga0209025_100038074 239
457 3300025295 Ga0209564_1000040 Ga0209564_1000040196 239
458 3300025297 Ga0209758_1000050 Ga0209758_1000050243 239
459 3300025298 Ga0209050_1000704 Ga0209050_100070428 239
460 3300025298 Ga0209050_1003418 Ga0209050_10034188 239
461 3300025299 Ga0209256_1000023 Ga0209256_1000023243 239
462 3300025302 Ga0207426_1000118 Ga0207426_1000118144 239
463 3300025303 Ga0209051_1000186 Ga0209051_100018626 239
464 3300025303 Ga0209051_1001497 Ga0209051_100149724 239
465 3300025304 Ga0209257_1000188 Ga0209257_100018888 239
466 3300025304 Ga0209257_1000663 Ga0209257_100066331 239
467 3300025728 Ga0207655_1005414 Ga0207655_10054146 239
468 3300025911 Ga0207654_10296574 Ga0207654_102965741 239
469 3300025923 Ga0207681_10037631 Ga0207681_100376312 239
470 3300025924 Ga0207694_10142271 Ga0207694_101422712 239
471 3300025933 Ga0207706_10020233 Ga0207706_100202336 239
472 3300025934 Ga0207686_10096160 Ga0207686_100961602 239
473 3300025935 Ga0207709_10002070 Ga0207709_100020705 239
474 3300025935 Ga0207709_10037321 Ga0207709_100373213 239
475 3300025960 Ga0207651_10226527 Ga0207651_102265272 239
476 3300025986 Ga0207658_10015667 Ga0207658_100156671 239
477 3300026116 Ga0207674_10096035 Ga0207674_100960352 239
478 3300026121 Ga0207683_10116456 Ga0207683_101164563 239
479 3300026121 Ga0207683_10149316 Ga0207683_101493161 239
480 3300028380 Ga0268265_10558062 Ga0268265_105580622 239
481 3300030731 Ga0316177_1202970 Ga0316177_12029703 239
482 3300030732 Ga0316176_1038327 Ga0316176_10383272 239
483 3300030733 Ga0314311_1013956 Ga0314311_10139565 239
484 3300030734 Ga0316179_1016783 Ga0316179_10167834 239
485 3300030735 Ga0316178_1052877 Ga0316178_10528774 239
486 3300030736 Ga0316180_1157241 Ga0316180_11572413 239
487 3300030745 Ga0316182_1144941 Ga0316182_11449416 239
488 3300031251 Ga0265327_10123981 Ga0265327_101239811 239
489 3300031731 Ga0307405_10231930 Ga0307405_102319302 239
490 3300031731 Ga0307405_10276686 Ga0307405_102766862 239
491 3300031824 Ga0307413_10228412 Ga0307413_102284121 239
492 3300031911 Ga0307412_10199768 Ga0307412_101997682 239
493 3300031911 Ga0307412_10590161 Ga0307412_105901611 239
494 3300032126 Ga0307415_100262265 Ga0307415_1002622652 239
495 3300041411 Ga0439466_0112194 Ga0439466_0112194_42_761 239
496 3300041505 Ga0451849_0741869 Ga0451849_0741869_527_1246 239
497 3300042006 Ga0439432_074189 Ga0439432_074189_142_861 239
498 3300042876 Ga0451577_0002733 Ga0451577_0002733_10590_11309 239
499 3300042876 Ga0451577_0110531 Ga0451577_0110531_802_1521 239
500 3300045051 Ga0451576_0091674 Ga0451576_0091674_2000_2719 239
501 3300046475 Ga0495639_0006419 Ga0495639_0006419_3959_4717 239
502 3300046516 Ga0495628_0194233 Ga0495628_0194233_100_819 239
503 3300046528 Ga0495642_0008798 Ga0495642_0008798_1269_1988 239
504 3300046528 Ga0495642_0067361 Ga0495642_0067361_234_953 239
505 3300046538 Ga0495609_0128351 Ga0495609_0128351_236_955 239
506 3300046615 Ga0495656_0096274 Ga0495656_0096274_434_1153 239
507 3300046663 Ga0495635_0273744 Ga0495635_0273744_118_876 239
508 3300046674 Ga0495588_0066605 Ga0495588_0066605_427_1185 239
509 3300046675 Ga0495657_0186450 Ga0495657_0186450_468_1187 239
510 3300046675 Ga0495657_0190860 Ga0495657_0190860_90_809 239
511 3300046689 Ga0495613_0159416 Ga0495613_0159416_455_1174 239
512 3300047321 Ga0495676_0191593 Ga0495676_0191593_194_913 239
513 3300047322 Ga0495680_0112378 Ga0495680_0112378_1191_1910 239
514 3300047673 Ga0495593_0181831 Ga0495593_0181831_97_855 239
515 3300048904 Ga0496101_0020528 Ga0496101_0020528_3776_4495 239
516 3300048905 Ga0496102_0009970 Ga0496102_0009970_3772_4491 239
517 3300048907 Ga0496104_0026839 Ga0496104_0026839_244_963 239
518 3300048908 Ga0496105_0006554 Ga0496105_0006554_3996_4715 239
519 3300048909 Ga0496106_0009899 Ga0496106_0009899_159_878 239
520 3300048910 Ga0496107_0115560 Ga0496107_0115560_1225_1944 239
521 3300048912 Ga0496109_0148551 Ga0496109_0148551_126_845 239
522 3300048913 Ga0496110_0133499 Ga0496110_0133499_841_1560 239
523 3300048914 Ga0496111_0190122 Ga0496111_0190122_26_745 239
524 3300048916 Ga0496113_0364609 Ga0496113_0364609_195_1055 239
525 3300048917 Ga0496114_0103935 Ga0496114_0103935_575_1294 239
526 3300048919 Ga0496116_0008081 Ga0496116_0008081_5950_6669 239
527 3300048920 Ga0496117_0006969 Ga0496117_0006969_10372_11091 239
528 3300048920 Ga0496117_0065779 Ga0496117_0065779_428_1147 239
529 3300048924 Ga0496121_0053387 Ga0496121_0053387_1676_2395 239
530 3300048924 Ga0496121_0130554 Ga0496121_0130554_463_1182 239
531 3300048925 Ga0496122_0000383 Ga0496122_0000383_73010_73729 239
532 3300048925 Ga0496122_0304136 Ga0496122_0304136_79_798 239
533 3300048926 Ga0496123_0000249 Ga0496123_0000249_20983_21702 239
534 3300048926 Ga0496123_0082795 Ga0496123_0082795_146_865 239
535 3300048926 Ga0496123_0092781 Ga0496123_0092781_831_1550 239
536 3300048928 Ga0496125_0058594 Ga0496125_0058594_756_1475 239
537 3300048929 Ga0496126_0046950 Ga0496126_0046950_380_1099 239
538 3300049586 Ga0501070_0359636 Ga0501070_0359636_56_775 239
539 3300049679 Ga0501249_043114 Ga0501249_043114_292_1011 239
540 3300049705 Ga0501225_0028464 Ga0501225_0028464_371_1090 239
541 3300049759 Ga0501262_000117 Ga0501262_000117_6958_7677 239
542 3300050490 nmdc:mga03n38_154812_c1 nmdc:mga03n38_154812_c1_122_841 239
543 3300050491 nmdc:mga00v17_112546_c1 nmdc:mga00v17_112546_c1_453_1172 239
544 3300050494 nmdc:mga06z11_151583_c1 nmdc:mga06z11_151583_c1_341_1060 239
545 3300050496 nmdc:mga07m45_12158_c1 nmdc:mga07m45_12158_c1_277_996 239
546 3300050496 nmdc:mga07m45_32586_c1 nmdc:mga07m45_32586_c1_539_1258 239
547 3300050516 nmdc:mga0sz30_15762_c1 nmdc:mga0sz30_15762_c1_415_1134 239
548 3300053125 Ga0500618_017872 Ga0500618_017872_281_1033 239
549 3300053136 Ga0500559_0000906 Ga0500559_0000906_4030_4749 239
550 3300053136 Ga0500559_0001710 Ga0500559_0001710_658_1377 239
551 3300003794 Ga0055531_10013758 Ga0055531_100137583 240
552 3300006038 Ga0075365_10240513 Ga0075365_102405132 240
553 3300006048 Ga0075363_100005255 Ga0075363_1000052558 240
554 3300006195 Ga0075366_10004616 Ga0075366_100046169 240
555 3300006946 Ga0079104_1030084 Ga0079104_10300842 240
556 3300009011 Ga0105251_10066080 Ga0105251_100660802 240
557 3300009036 Ga0105244_10119765 Ga0105244_101197652 240
558 3300025292 Ga0209676_1025550 Ga0209676_10255502 240
559 3300025304 Ga0209257_1000460 Ga0209257_100046019 240
560 3300025735 Ga0207713_1041673 Ga0207713_10416733 240
561 3300042004 Ga0439445_0015131 Ga0439445_0015131_456_1178 240
562 3300048909 Ga0496106_0109118 Ga0496106_0109118_1110_1847 240
563 3300048925 Ga0496122_0019094 Ga0496122_0019094_545_1267 240
564 3300048926 Ga0496123_0008012 Ga0496123_0008012_3803_4525 240
565 3300048929 Ga0496126_0013342 Ga0496126_0013342_2247_2984 240
566 3300049656 Ga0501209_000168 Ga0501209_000168_4034_4771 240
567 3300050490 nmdc:mga03n38_3331_c1 nmdc:mga03n38_3331_c1_1582_2376 240
568 3300050491 nmdc:mga00v17_24396_c1 nmdc:mga00v17_24396_c1_673_1467 240
569 3300050493 nmdc:mga0k408_88990_c1 nmdc:mga0k408_88990_c1_1051_1773 240
570 3300053125 Ga0500618_002276 Ga0500618_002276_5196_5918 240
571 3300001979 JGI24740J21852_10022324 JGI24740J21852_100223242 241
572 3300001989 JGI24739J22299_10001868 JGI24739J22299_100018687 241
573 3300001989 JGI24739J22299_10011512 JGI24739J22299_100115122 241
574 3300001989 JGI24739J22299_10038700 JGI24739J22299_100387003 241
575 3300002067 JGI24735J21928_10006073 JGI24735J21928_100060731 241
576 3300002067 JGI24735J21928_10017531 JGI24735J21928_100175312 241
577 3300002067 JGI24735J21928_10051437 JGI24735J21928_100514372 241
578 3300002067 JGI24735J21928_10118990 JGI24735J21928_101189901 241
579 3300002705 JGI25156J39149_1001506 JGI25156J39149_10015068 241
580 3300002705 JGI25156J39149_1004510 JGI25156J39149_10045103 241
581 3300003214 JGI25165J46597_1000805 JGI25165J46597_100080513 241
582 3300003756 Ga0055533_1002359 Ga0055533_10023593 241
583 3300003758 Ga0055532_1000036 Ga0055532_100003670 241
584 3300003758 Ga0055532_1001534 Ga0055532_10015342 241
585 3300003760 Ga0055527_1000022 Ga0055527_1000022120 241
586 3300003761 Ga0055535_1000026 Ga0055535_100002670 241
587 3300003762 Ga0055542_1000042 Ga0055542_100004270 241
588 3300003763 Ga0055529_1000048 Ga0055529_100004870 241
589 3300005327 Ga0070658_10202621 Ga0070658_102026212 241
590 3300009011 Ga0105251_10018284 Ga0105251_100182843 241
591 3300009093 Ga0105240_10146386 Ga0105240_101463862 241
592 3300009545 Ga0105237_10336273 Ga0105237_103362732 241
593 3300009545 Ga0105237_10646485 Ga0105237_106464851 241
594 3300010375 Ga0105239_10201237 Ga0105239_102012372 241
595 3300015261 Ga0182006_1034517 Ga0182006_10345172 241
596 3300015261 Ga0182006_1073396 Ga0182006_10733961 241
597 3300015262 Ga0182007_10015136 Ga0182007_100151362 241
598 3300015265 Ga0182005_1019424 Ga0182005_10194242 241
599 3300025225 Ga0209566_100400 Ga0209566_10040030 241
600 3300025226 Ga0209674_100048 Ga0209674_10004821 241
601 3300025226 Ga0209674_105307 Ga0209674_1053073 241
602 3300025228 Ga0209672_100002 Ga0209672_100002474 241
603 3300025228 Ga0209672_102432 Ga0209672_1024325 241
604 3300025229 Ga0209147_100003 Ga0209147_100003474 241
605 3300025229 Ga0209147_100156 Ga0209147_1001562 241
606 3300025231 Ga0207427_102208 Ga0207427_1022082 241
607 3300025242 Ga0209258_100005 Ga0209258_100005116 241
608 3300025254 Ga0209148_1000006 Ga0209148_1000006474 241
609 3300025256 Ga0209759_1000009 Ga0209759_1000009240 241
610 3300025256 Ga0209759_1000039 Ga0209759_1000039178 241
611 3300025261 Ga0209233_1000033 Ga0209233_100003367 241
612 3300025272 Ga0209455_1000003 Ga0209455_1000003474 241
613 3300025735 Ga0207713_1012478 Ga0207713_10124782 241
614 3300025904 Ga0207647_10006206 Ga0207647_100062065 241
615 3300025904 Ga0207647_10069363 Ga0207647_100693632 241
616 3300025906 Ga0207699_10167126 Ga0207699_101671261 241
617 3300025909 Ga0207705_10039249 Ga0207705_100392492 241
618 3300025913 Ga0207695_10268504 Ga0207695_102685042 241
619 3300027312 Ga0209371_1017758 Ga0209371_10177582 241
620 3300027876 Ga0209974_10025484 Ga0209974_100254842 241
621 3300030500 Ga0268256_1019795 Ga0268256_10197952 241
622 3300031548 Ga0307408_100006508 Ga0307408_1000065084 241
623 3300046454 Ga0495592_0029261 Ga0495592_0029261_1948_2673 241
624 3300046458 Ga0495591_004217 Ga0495591_004217_519_1244 241
625 3300046459 Ga0495629_0015543 Ga0495629_0015543_2073_2798 241
626 3300046459 Ga0495629_0021702 Ga0495629_0021702_3552_4277 241
627 3300046462 Ga0495651_0062147 Ga0495651_0062147_2103_2828 241
628 3300046462 Ga0495651_0079539 Ga0495651_0079539_99_824 241
629 3300046463 Ga0495653_0044328 Ga0495653_0044328_1157_1882 241
630 3300046463 Ga0495653_0236300 Ga0495653_0236300_129_854 241
631 3300046472 Ga0495580_0000839 Ga0495580_0000839_3376_4152 241
632 3300046472 Ga0495580_0015417 Ga0495580_0015417_104_829 241
633 3300046473 Ga0495582_0082465 Ga0495582_0082465_704_1528 241
634 3300046473 Ga0495582_0123578 Ga0495582_0123578_217_942 241
635 3300046476 Ga0495662_0017244 Ga0495662_0017244_986_1711 241
636 3300046477 Ga0495664_0070685 Ga0495664_0070685_550_1374 241
637 3300046477 Ga0495664_0128409 Ga0495664_0128409_487_1212 241
638 3300046500 Ga0495596_0096712 Ga0495596_0096712_91_915 241
639 3300046511 Ga0495608_0041612 Ga0495608_0041612_626_1405 241
640 3300046514 Ga0495618_0004484 Ga0495618_0004484_699_1523 241
641 3300046514 Ga0495618_0010063 Ga0495618_0010063_2842_3567 241
642 3300046516 Ga0495628_0039577 Ga0495628_0039577_2568_3344 241
643 3300046516 Ga0495628_0070321 Ga0495628_0070321_1067_1891 241
644 3300046517 Ga0495630_0001458 Ga0495630_0001458_13079_13804 241
645 3300046517 Ga0495630_0012098 Ga0495630_0012098_3047_3871 241
646 3300046517 Ga0495630_0259490 Ga0495630_0259490_394_1119 241
647 3300046524 Ga0495648_0043908 Ga0495648_0043908_53_778 241
648 3300046524 Ga0495648_0102751 Ga0495648_0102751_621_1346 241
649 3300046526 Ga0495666_0007246 Ga0495666_0007246_482_1207 241
650 3300046526 Ga0495666_0014061 Ga0495666_0014061_838_1662 241
651 3300046526 Ga0495666_0018617 Ga0495666_0018617_2274_2999 241
652 3300046529 Ga0495652_0074918 Ga0495652_0074918_245_970 241
653 3300046531 Ga0495665_0000581 Ga0495665_0000581_6458_7183 241
654 3300046531 Ga0495665_0017430 Ga0495665_0017430_1115_1939 241
655 3300046531 Ga0495665_0116383 Ga0495665_0116383_49_774 241
656 3300046533 Ga0495640_0006005 Ga0495640_0006005_8394_9119 241
657 3300046533 Ga0495640_0017324 Ga0495640_0017324_3227_4051 241
658 3300046535 Ga0495586_0007335 Ga0495586_0007335_4265_4990 241
659 3300046536 Ga0495587_0011727 Ga0495587_0011727_2303_3028 241
660 3300046557 Ga0495622_0000031 Ga0495622_0000031_104675_105400 241
661 3300046642 Ga0495634_0006573 Ga0495634_0006573_2282_3007 241
662 3300046642 Ga0495634_0113250 Ga0495634_0113250_418_1242 241
663 3300046663 Ga0495635_0005627 Ga0495635_0005627_2377_3201 241
664 3300046665 Ga0495661_0004712 Ga0495661_0004712_8445_9170 241
665 3300046665 Ga0495661_0025430 Ga0495661_0025430_1668_2393 241
666 3300046678 Ga0495599_0025119 Ga0495599_0025119_865_1590 241
667 3300046678 Ga0495599_0091528 Ga0495599_0091528_66_842 241
668 3300046678 Ga0495599_0203592 Ga0495599_0203592_384_1109 241
669 3300046679 Ga0495623_0000861 Ga0495623_0000861_2576_3301 241
670 3300046679 Ga0495623_0013447 Ga0495623_0013447_937_1761 241
671 3300046680 Ga0495646_0000655 Ga0495646_0000655_455_1180 241
672 3300046680 Ga0495646_0001183 Ga0495646_0001183_6578_7303 241
673 3300046680 Ga0495646_0018898 Ga0495646_0018898_3012_3737 241
674 3300046689 Ga0495613_0014070 Ga0495613_0014070_3403_4128 241
675 3300046690 Ga0495624_0309081 Ga0495624_0309081_49_873 241
676 3300046692 Ga0495671_0134609 Ga0495671_0134609_201_926 241
677 3300046809 Ga0495600_0058911 Ga0495600_0058911_1157_1882 241
678 3300047315 Ga0495581_0001228 Ga0495581_0001228_2384_3208 241
679 3300047315 Ga0495581_0030485 Ga0495581_0030485_534_1259 241
680 3300047317 Ga0495604_0004144 Ga0495604_0004144_5359_6084 241
681 3300047317 Ga0495604_0088636 Ga0495604_0088636_524_1300 241
682 3300047319 Ga0495674_0112010 Ga0495674_0112010_422_1246 241
683 3300047320 Ga0495672_0030414 Ga0495672_0030414_1822_2547 241
684 3300047322 Ga0495680_0010571 Ga0495680_0010571_1206_1931 241
685 3300047322 Ga0495680_0024259 Ga0495680_0024259_1174_1899 241
686 3300047322 Ga0495680_0033513 Ga0495680_0033513_517_1293 241
687 3300047323 Ga0495683_0000746 Ga0495683_0000746_2765_3490 241
688 3300047444 Ga0495675_0003273 Ga0495675_0003273_1946_2770 241
689 3300047444 Ga0495675_0003327 Ga0495675_0003327_5686_6411 241
690 3300047444 Ga0495675_0007996 Ga0495675_0007996_5000_5725 241
691 3300047444 Ga0495675_0033793 Ga0495675_0033793_2145_2870 241
692 3300047446 Ga0495679_001681 Ga0495679_001681_6574_7299 241
693 3300047469 Ga0495673_0013387 Ga0495673_0013387_3185_3910 241
694 3300047469 Ga0495673_0045036 Ga0495673_0045036_938_1663 241
695 3300047673 Ga0495593_0011089 Ga0495593_0011089_710_1435 241
696 3300047673 Ga0495593_0016593 Ga0495593_0016593_2387_3211 241
697 3300048088 Ga0495602_0012144 Ga0495602_0012144_2250_2975 241
698 3300048088 Ga0495602_0142045 Ga0495602_0142045_96_920 241
699 3300048088 Ga0495602_0214375 Ga0495602_0214375_655_1380 241
700 3300048089 Ga0495614_0032669 Ga0495614_0032669_810_1634 241
701 3300048907 Ga0496104_0266262 Ga0496104_0266262_496_1221 241
702 3300048919 Ga0496116_0020316 Ga0496116_0020316_3746_4471 241
703 3300048920 Ga0496117_0016111 Ga0496117_0016111_2931_3728 241
704 3300048920 Ga0496117_0046765 Ga0496117_0046765_2374_3099 241
705 3300048921 Ga0496118_0000316 Ga0496118_0000316_76656_77381 241
706 3300048921 Ga0496118_0000365 Ga0496118_0000365_73006_73803 241
707 3300048929 Ga0496126_0000629 Ga0496126_0000629_25397_26122 241
708 3300049460 Ga0495682_0019414 Ga0495682_0019414_1781_2506 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

193

278

0.99

PF02678

Pirin

Pirin

50

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.972 1 235
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9719 1 234
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9677 1 234
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9599 1 235
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8778 38 120
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9961 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9906 11 134 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9797 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9743 11 134 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9607 40 120 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0B6S415-F1-model_v4 Quercetin 2,3-dioxygenase 1.002 2 241 GO:0046872
AF-A0A354XYT3-F1-model_v4 Pirin N-terminal domain-containing protein 1.002 5 136
AF-A0A7Z0V0A2-F1-model_v4 Putative Pirin family protein 1.001 5 135 GO:0046872
AF-A0A3B0T399-F1-model_v4 Pirin 1.001 5 134
AF-X1XEF8-F1-model_v4 deleted 0.9995 20 235

Feature Viewer

pLDDT pTM Quality
96.84 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map