F476547

General Info

Members Datasets Scaffolds Average Seq Length
707 517 1414 209

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10168700|Ga0157376_101687002
Length 248
Sequence MTSLSPGSADALLFDLGRVVLDIDFSKAIACWAGHAGLKPEAILTRYVRDSEAYRLHEVGKISDEDYFQSLRSSLGIRISDAQFLEGWNAIFAGEMPDIAELLPRAAKQMPVYAFSNTNRPHVNYFSKEYAGLLGHFRELYLSSSIGLRKPDVEAFDHVVAAIGVPVNRIVFFDDLAENIEGARSRGLTTVHVTSPRDVGNALKALNLISGRQADGPRMELFCPGARNQNPLCIFIQSSRNDCPSQDS

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
66 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
90 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
91 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
92 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
142 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
143 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
321 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
322 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
325 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
333 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
336 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
337 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
342 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
343 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
344 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
345 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
346 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
347 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
348 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
349 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
350 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
351 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
352 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
353 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
354 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
355 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
356 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
357 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
358 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
359 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
360 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
361 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
362 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
363 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
364 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
365 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
366 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
367 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
368 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
369 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
370 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
371 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
372 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
373 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
374 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
375 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
376 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
377 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
378 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
379 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
380 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
381 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
382 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
383 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
384 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
385 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
386 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
387 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
388 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
389 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
390 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
391 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
392 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
393 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
394 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
395 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
396 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
397 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
398 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
399 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
400 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
401 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
402 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
403 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
404 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
405 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
406 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
407 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
408 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
409 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
410 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
411 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
412 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
413 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
414 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
415 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
416 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
417 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
418 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
419 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
420 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
421 2906610324
422 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
423 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
424 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
425 2922368715
426 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
427 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
428 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
429 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
430 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
431 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
432 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
433 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
434 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
435 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
436 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
437 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
438 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
439 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
440 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
441 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
442 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
443 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
444 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
445 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
446 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
447 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
448 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
449 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
450 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
451 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
452 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
453 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
454 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
455 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
456 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
457 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
458 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
459 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
460 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
461 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
462 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
463 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
464 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
465 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
466 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
467 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
468 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
469 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
470 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
471 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
472 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
473 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
474 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
475 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
476 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
477 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
478 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
479 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
480 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
481 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
482 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
483 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
484 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
485 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
486 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
487 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
488 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
489 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
490 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
491 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
492 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
493 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
494 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
495 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
496 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
497 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
498 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
499 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
500 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
501 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
502 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
503 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
504 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
505 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
506 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
507 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
508 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
509 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
510 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
511 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
512 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
513 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
514 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
515 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
516 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
517 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.32
Metatranscriptomes 0
Isolates 24.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.44
Nodule 20.08
Rhizoplane 4.38
Rhizosphere 50.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10168700 3300014969 Bacteria 1991
2 LJQas_1003448 3300000549 Bacteria 2117
3 JGI25165J46597_1003401 3300003214 Bacteria 4000
4 JGI25153J46596_10000453 3300003215 Bacteria 26261
5 JGI25153J46596_10000935 3300003215 Bacteria 17768
6 JGI25153J46596_10001003 3300003215 Bacteria 17167
7 JGI25153J46596_10001107 3300003215 Bacteria 16358
8 rootH1_10143344 3300003323 Bacteria 1407
9 rootH1_10223957 3300003323 Bacteria 1799
10 JGI25160J50197_1015923 3300003354 Bacteria 2446
11 JGI25160J50197_1022282 3300003354 Bacteria 1860
12 JGI25404J52841_10030551 3300003659 Bacteria 1153
13 Ga0055542_1019795 3300003762 Bacteria 998
14 Ga0055526_1038099 3300003771 Bacteria 1245
15 Ga0055524_1031677 3300003775 Bacteria 1515
16 Ga0055531_10022792 3300003794 Bacteria 2373
17 Ga0055543_1006339 3300004625 Bacteria 2872
18 Ga0065165_1003099 3300005262 Bacteria 12366
19 Ga0065165_1003661 3300005262 Bacteria 10494
20 Ga0065165_1031865 3300005262 Bacteria 1660
21 Ga0070658_10052361 3300005327 Bacteria 3310
22 Ga0070683_100004954 3300005329 Bacteria 11048
23 Ga0070666_10366375 3300005335 Bacteria 1033
24 Ga0070666_10592356 3300005335 Bacteria 809
25 Ga0068868_100272992 3300005338 Bacteria 1429
26 Ga0070668_100027107 3300005347 Bacteria 4349
27 Ga0070668_100659930 3300005347 Bacteria 920
28 Ga0070674_100231296 3300005356 Bacteria 1443
29 Ga0070659_100531509 3300005366 Bacteria 1005
30 Ga0070659_100889603 3300005366 Bacteria 778
31 Ga0070667_100127135 3300005367 Bacteria 2222
32 Ga0070709_10000211 3300005434 Bacteria 37791
33 Ga0070714_100053658 3300005435 Bacteria 3442
34 Ga0070714_100385754 3300005435 Bacteria 1321
35 Ga0070713_100049760 3300005436 Bacteria 3459
36 Ga0070713_100064710 3300005436 Bacteria 3070
37 Ga0070710_10000132 3300005437 Bacteria 34897
38 Ga0070711_100002262 3300005439 Bacteria 10925
39 Ga0070663_100048654 3300005455 Bacteria 3007
40 Ga0070663_100216338 3300005455 Bacteria 1502
41 Ga0070678_100359674 3300005456 Bacteria 1254
42 Ga0070662_100183897 3300005457 Bacteria 1649
43 Ga0070681_10014748 3300005458 Bacteria 7769
44 Ga0070707_100084981 3300005468 Bacteria 3058
45 Ga0070698_100674877 3300005471 Bacteria 975
46 Ga0070697_100097561 3300005536 Bacteria 2439
47 Ga0068853_100278382 3300005539 Bacteria 1542
48 Ga0070665_100053381 3300005548 Bacteria 4053
49 Ga0070665_100239344 3300005548 Bacteria 1816
50 Ga0070665_100278102 3300005548 Bacteria 1676
51 Ga0070665_100336193 3300005548 Bacteria 1515
52 Ga0068855_100040288 3300005563 Bacteria 5544
53 Ga0068855_100482192 3300005563 Bacteria 1350
54 Ga0068854_100055571 3300005578 Bacteria 2850
55 Ga0068854_100242174 3300005578 Bacteria 1437
56 Ga0068856_100028913 3300005614 Bacteria 5416
57 Ga0068852_100005484 3300005616 Bacteria 9080
58 Ga0068864_100273841 3300005618 Bacteria 1574
59 Ga0068863_100927071 3300005841 Bacteria 872
60 Ga0068860_100242978 3300005843 Bacteria 1751
61 Ga0068860_101033672 3300005843 Bacteria 840
62 Ga0081455_10001700 3300005937 Bacteria 26650
63 Ga0081455_10015870 3300005937 Bacteria 7293
64 Ga0081455_10042374 3300005937 Bacteria 3994
65 Ga0081538_10182576 3300005981 Bacteria 895
66 Ga0081540_1001668 3300005983 Bacteria 18902
67 Ga0075365_10009318 3300006038 Bacteria 5635
68 Ga0075365_10071194 3300006038 Bacteria 2340
69 Ga0075365_10110479 3300006038 Bacteria 1889
70 Ga0075365_10419835 3300006038 Bacteria 944
71 Ga0075368_10001505 3300006042 Bacteria 7461
72 Ga0075363_100048650 3300006048 Bacteria 2255
73 Ga0075363_100182289 3300006048 Bacteria 1195
74 Ga0075364_10024165 3300006051 Bacteria 3855
75 Ga0070715_10305288 3300006163 Bacteria 853
76 Ga0070716_100020132 3300006173 Bacteria 3499
77 Ga0070716_100170206 3300006173 Bacteria 1421
78 Ga0070716_100215141 3300006173 Bacteria 1287
79 Ga0070716_100397763 3300006173 Bacteria 990
80 Ga0070716_100420117 3300006173 Bacteria 967
81 Ga0070712_100225707 3300006175 Bacteria 1485
82 Ga0075362_10042692 3300006177 Bacteria 2006
83 Ga0075367_10172640 3300006178 Bacteria 1347
84 Ga0075367_10495622 3300006178 Bacteria 775
85 Ga0075369_10000490 3300006186 Bacteria 12265
86 Ga0075369_10013139 3300006186 Bacteria 3279
87 Ga0075366_10004974 3300006195 Bacteria 7172
88 Ga0097621_100881086 3300006237 Bacteria 833
89 Ga0075370_10008145 3300006353 Bacteria 5379
90 Ga0075428_100035675 3300006844 Bacteria 5481
91 Ga0075430_100318024 3300006846 Bacteria 1287
92 Ga0075434_100018948 3300006871 Bacteria 6651
93 Ga0068865_100356814 3300006881 Bacteria 1186
94 Ga0075436_100224409 3300006914 Bacteria 1334
95 Ga0099824_1032313 3300006942 Bacteria 1883
96 Ga0099822_1052604 3300006943 Bacteria 1615
97 Ga0099823_1080950 3300006944 Bacteria 1256
98 Ga0099794_10131427 3300007265 Bacteria 1264
99 Ga0105240_10024214 3300009093 Bacteria 8011
100 Ga0111539_11544408 3300009094 Bacteria 770
101 Ga0105245_10017488 3300009098 Bacteria 6256
102 Ga0105245_10389223 3300009098 Bacteria 1390
103 Ga0105247_10018505 3300009101 Bacteria 4178
104 Ga0105247_10316787 3300009101 Bacteria 1087
105 Ga0105243_10152207 3300009148 Bacteria 1985
106 Ga0105241_10039995 3300009174 Bacteria 3538
107 Ga0105241_10108940 3300009174 Bacteria 2215
108 Ga0105242_11402246 3300009176 Bacteria 726
109 Ga0105242_11697185 3300009176 Bacteria 668
110 Ga0105237_10006896 3300009545 Bacteria 12524
111 Ga0105237_10020477 3300009545 Bacteria 6815
112 Ga0105237_10141373 3300009545 Bacteria 2401
113 Ga0105238_10056091 3300009551 Bacteria 3953
114 Ga0105238_10416799 3300009551 Bacteria 1337
115 Ga0105249_10145882 3300009553 Bacteria 2274
116 Ga0099796_10152466 3300010159 Bacteria 911
117 Ga0105239_10029408 3300010375 Bacteria 6040
118 Ga0105239_10039342 3300010375 Bacteria 5182
119 Ga0105239_10263791 3300010375 Bacteria 1936
120 Ga0157369_10334230 3300013105 Bacteria 1574
121 Ga0157374_10041837 3300013296 Bacteria 4224
122 Ga0157378_10556382 3300013297 Bacteria 1153
123 Ga0163162_11438328 3300013306 Bacteria 785
124 Ga0157372_10791633 3300013307 Bacteria 1102
125 Ga0163163_10086400 3300014325 Bacteria 3146
126 Ga0163163_10943214 3300014325 Bacteria 926
127 Ga0157380_11289780 3300014326 Bacteria 777
128 Ga0157379_10221334 3300014968 Bacteria 1715
129 Ga0163161_10186296 3300017792 Bacteria 1593
130 Ga0214544_1014130 3300021320 Bacteria 9186
131 Ga0214542_1005735 3300021321 Bacteria 23325
132 Ga0214545_1005338 3300021324 Bacteria 23325
133 Ga0214543_1005480 3300021327 Bacteria 23325
134 Ga0213873_10043248 3300021358 Bacteria 1168
135 Ga0213876_10001750 3300021384 Bacteria 13177
136 Ga0213876_10030008 3300021384 Bacteria 2867
137 Ga0213876_10201995 3300021384 Bacteria 1057
138 Ga0209563_102991 3300025230 Bacteria 3630
139 Ga0207425_1019863 3300025245 Bacteria 1443
140 Ga0209148_1000155 3300025254 Bacteria 143807
141 Ga0209148_1019602 3300025254 Bacteria 1121
142 Ga0209233_1025524 3300025261 Bacteria 1460
143 Ga0209455_1003253 3300025272 Bacteria 5850
144 Ga0209455_1012199 3300025272 Bacteria 2071
145 Ga0209564_1005928 3300025295 Bacteria 6768
146 Ga0209758_1000021 3300025297 Bacteria 697691
147 Ga0209758_1000371 3300025297 Bacteria 78923
148 Ga0209758_1001143 3300025297 Bacteria 34037
149 Ga0209758_1001291 3300025297 Bacteria 30796
150 Ga0209758_1013219 3300025297 Bacteria 4530
151 Ga0209758_1017478 3300025297 Bacteria 3568
152 Ga0209758_1029215 3300025297 Bacteria 2310
153 Ga0209758_1032520 3300025297 Bacteria 2115
154 Ga0209256_1006784 3300025299 Bacteria 5914
155 Ga0209256_1078967 3300025299 Bacteria 723
156 Ga0207426_1000352 3300025302 Bacteria 84141
157 Ga0207426_1003318 3300025302 Bacteria 8917
158 Ga0207426_1013312 3300025302 Bacteria 3053
159 Ga0207426_1053368 3300025302 Bacteria 1193
160 Ga0207426_1057495 3300025302 Bacteria 1132
161 Ga0209257_1001227 3300025304 Bacteria 31899
162 Ga0209257_1027370 3300025304 Bacteria 1899
163 Ga0207692_10001099 3300025898 Bacteria 9905
164 Ga0207710_10045612 3300025900 Bacteria 1955
165 Ga0207688_10279439 3300025901 Bacteria 1017
166 Ga0207647_10001318 3300025904 Bacteria 19063
167 Ga0207685_10147782 3300025905 Bacteria 1060
168 Ga0207699_10000361 3300025906 Bacteria 24053
169 Ga0207699_10081493 3300025906 Bacteria 2007
170 Ga0207699_10523049 3300025906 Bacteria 858
171 Ga0207705_10161204 3300025909 Bacteria 1685
172 Ga0207654_10007993 3300025911 Bacteria 5334
173 Ga0207707_10024685 3300025912 Bacteria 5260
174 Ga0207695_10000015 3300025913 Bacteria 803205
175 Ga0207671_10001316 3300025914 Bacteria 29070
176 Ga0207671_10035749 3300025914 Bacteria 3684
177 Ga0207671_10083220 3300025914 Bacteria 2402
178 Ga0207671_10127741 3300025914 Bacteria 1949
179 Ga0207693_10106971 3300025915 Bacteria 2194
180 Ga0207693_10121706 3300025915 Bacteria 2049
181 Ga0207663_10007866 3300025916 Bacteria 5556
182 Ga0207663_10054493 3300025916 Bacteria 2504
183 Ga0207660_10160827 3300025917 Bacteria 1732
184 Ga0207657_10452468 3300025919 Bacteria 1007
185 Ga0207646_10029729 3300025922 Bacteria 4961
186 Ga0207694_10043499 3300025924 Bacteria 3467
187 Ga0207694_10195171 3300025924 Bacteria 1646
188 Ga0207700_10011229 3300025928 Bacteria 5702
189 Ga0207700_10103948 3300025928 Bacteria 2272
190 Ga0207664_10119349 3300025929 Bacteria 2205
191 Ga0207690_10311911 3300025932 Bacteria 1234
192 Ga0207690_10392304 3300025932 Bacteria 1105
193 Ga0207706_10176049 3300025933 Bacteria 1879
194 Ga0207706_10217334 3300025933 Bacteria 1674
195 Ga0207686_10029159 3300025934 Bacteria 3253
196 Ga0207709_10099846 3300025935 Bacteria 1916
197 Ga0207704_10275269 3300025938 Bacteria 1277
198 Ga0207665_10024686 3300025939 Bacteria 3964
199 Ga0207665_10130821 3300025939 Bacteria 1781
200 Ga0207665_10187808 3300025939 Bacteria 1500
201 Ga0207665_10256332 3300025939 Bacteria 1294
202 Ga0207665_10481182 3300025939 Bacteria 956
203 Ga0207711_10122541 3300025941 Bacteria 2322
204 Ga0207667_10459248 3300025949 Bacteria 1294
205 Ga0207712_10048359 3300025961 Bacteria 2958
206 Ga0207677_10546795 3300026023 Bacteria 1009
207 Ga0207639_10075032 3300026041 Bacteria 2658
208 Ga0207639_10278425 3300026041 Bacteria 1470
209 Ga0207639_10519673 3300026041 Bacteria 1090
210 Ga0207639_10947407 3300026041 Bacteria 805
211 Ga0207678_10045701 3300026067 Bacteria 3786
212 Ga0207678_10045898 3300026067 Bacteria 3778
213 Ga0207702_10369797 3300026078 Bacteria 1376
214 Ga0207676_10258204 3300026095 Bacteria 1572
215 Ga0207675_100126992 3300026118 Bacteria 2416
216 Ga0207698_10416457 3300026142 Bacteria 1288
217 Ga0209389_1000026 3300027296 Bacteria 147580
218 Ga0209389_1000132 3300027296 Bacteria 66230
219 Ga0209589_1000022 3300027357 Bacteria 180757
220 Ga0209489_100058 3300027361 Bacteria 147117
221 Ga0209489_103912 3300027361 Bacteria 28301
222 Ga0209700_100281 3300027363 Bacteria 90519
223 Ga0268266_10021024 3300028379 Bacteria 5563
224 Ga0268266_10097720 3300028379 Bacteria 2583
225 Ga0268266_10195901 3300028379 Bacteria 1847
226 Ga0268266_10217718 3300028379 Bacteria 1754
227 Ga0268266_10262156 3300028379 Bacteria 1602
228 Ga0268265_10048516 3300028380 Bacteria 3188
229 Ga0268264_10248728 3300028381 Bacteria 1650
230 Ga0265334_10014621 3300028573 Bacteria 3270
231 Ga0265330_10027490 3300031235 Bacteria 2570
232 Ga0265332_10016317 3300031238 Bacteria 3277
233 Ga0265332_10018778 3300031238 Bacteria 3052
234 Ga0265325_10020267 3300031241 Bacteria 3666
235 Ga0265339_10037045 3300031249 Bacteria 2727
236 Ga0265331_10014869 3300031250 Bacteria 4128
237 Ga0307513_10053443 3300031456 Bacteria 4342
238 Ga0265314_10011870 3300031711 Bacteria 7157
239 Ga0265342_10005586 3300031712 Bacteria 9536
240 Ga0265342_10020879 3300031712 Bacteria 4190
241 Ga0307412_10021329 3300031911 Bacteria 3956
242 Ga0307510_10242002 3300033180 Bacteria 1298
243 Ga0373934_0001797 3300035086 Bacteria 7882
244 Ga0373944_0010745 3300035089 Bacteria 2500
245 Ga0373952_0075024 3300035092 Bacteria 853
246 Ga0373923_0173957 3300035111 Bacteria 987
247 Ga0373936_0005899 3300035113 Bacteria 4611
248 Ga0373953_0000300 3300035117 Bacteria 13444
249 Ga0373956_0002257 3300035119 Bacteria 7936
250 Ga0373956_0235054 3300035119 Bacteria 871
251 Ga0373943_0031564 3300035170 Bacteria 2514
252 Ga0373955_0000134 3300035172 Bacteria 29165
253 Ga0373955_0006732 3300035172 Bacteria 5248
254 Ga0373955_0136108 3300035172 Bacteria 1437
255 Ga0373924_0019019 3300035410 Bacteria 2656
256 Ga0373931_0408845 3300035691 Bacteria 861
257 Ga0373935_0000860 3300035692 Bacteria 16370
258 Ga0373927_0000657 3300035695 Bacteria 26223
259 Ga0373933_0000117 3300035724 Bacteria 51348
260 Ga0373933_0000983 3300035724 Bacteria 17420
261 Ga0373947_0000174 3300035725 Bacteria 35061
262 Ga0373947_0067624 3300035725 Bacteria 2183
263 Ga0373937_0002366 3300036401 Bacteria 15700
264 Ga0373937_0187077 3300036401 Bacteria 1945
265 Ga0373937_0341192 3300036401 Bacteria 1419
266 Ga0373937_0661237 3300036401 Bacteria 990
267 Ga0373925_0000748 3300037068 Bacteria 29849
268 Ga0373925_0272011 3300037068 Bacteria 1363
269 Ga0395900_0067791 3300037418 Bacteria 3666
270 Ga0395900_0337161 3300037418 Bacteria 1484
271 Ga0395898_0042839 3300037466 Bacteria 4464
272 Ga0395905_0025581 3300037471 Bacteria 5566
273 Ga0395905_0301268 3300037471 Bacteria 1490
274 Ga0395905_0432094 3300037471 Bacteria 1214
275 Ga0395901_0143723 3300038443 Bacteria 2508
276 Ga0395901_0188560 3300038443 Bacteria 2163
277 Ga0436365_0533200 3300039437 Bacteria 910
278 Ga0436365_0675556 3300039437 Bacteria 34604
279 Ga0436365_1894951 3300039437 Bacteria 2758
280 Ga0436360_0233776 3300039438 Bacteria 1486
281 Ga0436363_1478588 3300039450 Bacteria 688
282 Ga0436362_0204753 3300039453 Bacteria 4170
283 Ga0451807_0806367 3300041486 Bacteria 760
284 Ga0451839_1529781 3300041496 Bacteria 797
285 Ga0439431_0031376 3300041997 Bacteria 1321
286 Ga0439459_0012465 3300042438 Bacteria 1515
287 Ga0466972_0000125 3300044658 Bacteria 65105
288 Ga0466972_0001805 3300044658 Bacteria 10491
289 Ga0466972_0050843 3300044658 Bacteria 2000
290 Ga0466972_0227588 3300044658 Bacteria 873
291 Ga0466965_0010797 3300044683 Bacteria 4271
292 Ga0466965_0206349 3300044683 Bacteria 1044
293 Ga0466961_0000015 3300044693 Bacteria 112812
294 Ga0466963_0032172 3300044694 Bacteria 3395
295 Ga0466964_0023291 3300044706 Bacteria 2408
296 Ga0466968_0074159 3300044735 Bacteria 1485
297 Ga0466960_0002553 3300044901 Bacteria 6842
298 Ga0466960_0017888 3300044901 Bacteria 3099
299 Ga0466959_0022728 3300045049 Bacteria 4636
300 Ga0466959_0041554 3300045049 Bacteria 3394
301 Ga0466967_0134274 3300045976 Bacteria 2300
302 Ga0466967_0156229 3300045976 Bacteria 2137
303 Ga0466967_0190585 3300045976 Bacteria 1937
304 Ga0495603_0000011 3300046455 Bacteria 69832
305 Ga0495603_0039894 3300046455 Bacteria 2811
306 Ga0495629_0000251 3300046459 Bacteria 46643
307 Ga0495629_0006321 3300046459 Bacteria 8790
308 Ga0495629_0552263 3300046459 Bacteria 773
309 Ga0495641_0005653 3300046461 Bacteria 8343
310 Ga0495651_0022069 3300046462 Bacteria 4950
311 Ga0495651_0047446 3300046462 Bacteria 3321
312 Ga0495653_0001031 3300046463 Bacteria 21478
313 Ga0495650_0126925 3300046471 Bacteria 934
314 Ga0495580_0000174 3300046472 Bacteria 47868
315 Ga0495580_0173130 3300046472 Bacteria 1491
316 Ga0495582_0000225 3300046473 Bacteria 31246
317 Ga0495605_0070491 3300046474 Bacteria 1653
318 Ga0495605_0075571 3300046474 Bacteria 1584
319 Ga0495605_0188827 3300046474 Bacteria 903
320 Ga0495639_0000017 3300046475 Bacteria 76508
321 Ga0495639_0230276 3300046475 Bacteria 913
322 Ga0495662_0000326 3300046476 Bacteria 20671
323 Ga0495664_0025987 3300046477 Bacteria 3409
324 Ga0495585_0075135 3300046492 Bacteria 1837
325 Ga0495585_0101305 3300046492 Bacteria 1540
326 Ga0495585_0125296 3300046492 Bacteria 1356
327 Ga0495594_0000094 3300046499 Bacteria 41090
328 Ga0495594_0092636 3300046499 Bacteria 1694
329 Ga0495607_0084961 3300046501 Bacteria 1730
330 Ga0495606_0087932 3300046507 Bacteria 1917
331 Ga0495608_0207927 3300046511 Bacteria 1231
332 Ga0495610_0123682 3300046512 Bacteria 1130
333 Ga0495616_0051634 3300046513 Bacteria 2050
334 Ga0495616_0270875 3300046513 Bacteria 724
335 Ga0495620_0013575 3300046515 Bacteria 4167
336 Ga0495620_0030701 3300046515 Bacteria 2471
337 Ga0495628_0103152 3300046516 Bacteria 2199
338 Ga0495628_0117101 3300046516 Bacteria 2046
339 Ga0495628_0313440 3300046516 Bacteria 1159
340 Ga0495630_0016681 3300046517 Bacteria 5370
341 Ga0495630_0227289 3300046517 Bacteria 1425
342 Ga0495643_0122726 3300046522 Bacteria 1311
343 Ga0495643_0124762 3300046522 Bacteria 1297
344 Ga0495663_0078543 3300046525 Bacteria 1060
345 Ga0495652_0014946 3300046529 Bacteria 6957
346 Ga0495652_0100837 3300046529 Bacteria 2341
347 Ga0495652_0211602 3300046529 Bacteria 1463
348 Ga0495654_0210726 3300046530 Bacteria 827
349 Ga0495665_0000032 3300046531 Bacteria 53670
350 Ga0495640_0014833 3300046533 Bacteria 5880
351 Ga0495640_0030581 3300046533 Bacteria 3854
352 Ga0495598_0039042 3300046537 Bacteria 1378
353 Ga0495597_0109810 3300046542 Bacteria 1157
354 Ga0495622_0008993 3300046557 Bacteria 4627
355 Ga0495622_0038369 3300046557 Bacteria 2230
356 Ga0495622_0170677 3300046557 Bacteria 978
357 Ga0495633_0085704 3300046558 Bacteria 1465
358 Ga0495667_0000309 3300046559 Bacteria 31068
359 Ga0495667_0012873 3300046559 Bacteria 5668
360 Ga0495668_0078156 3300046616 Bacteria 1817
361 Ga0495634_0002289 3300046642 Bacteria 16018
362 Ga0495611_0152661 3300046648 Bacteria 1078
363 Ga0495635_0000133 3300046663 Bacteria 44583
364 Ga0495635_0026277 3300046663 Bacteria 4052
365 Ga0495661_0162242 3300046665 Bacteria 1199
366 Ga0495588_0072969 3300046674 Bacteria 1786
367 Ga0495588_0110917 3300046674 Bacteria 1445
368 Ga0495657_0161878 3300046675 Bacteria 1384
369 Ga0495657_0280745 3300046675 Bacteria 997
370 Ga0495599_0000486 3300046678 Bacteria 22676
371 Ga0495623_0002760 3300046679 Bacteria 11601
372 Ga0495646_0000464 3300046680 Bacteria 21530
373 Ga0495646_0033061 3300046680 Bacteria 3217
374 Ga0495646_0048000 3300046680 Bacteria 2596
375 Ga0495647_0000073 3300046681 Bacteria 24384
376 Ga0495647_0074243 3300046681 Bacteria 1367
377 Ga0495658_0000921 3300046683 Bacteria 15691
378 Ga0495613_0015132 3300046689 Bacteria 5730
379 Ga0495613_0047340 3300046689 Bacteria 3177
380 Ga0495624_0000384 3300046690 Bacteria 35148
381 Ga0495624_0098340 3300046690 Bacteria 1802
382 Ga0495670_0130359 3300046691 Bacteria 1310
383 Ga0495671_0094962 3300046692 Bacteria 1459
384 Ga0495671_0098119 3300046692 Bacteria 1433
385 Ga0495649_0029691 3300046694 Bacteria 3022
386 Ga0495600_0002022 3300046809 Bacteria 11407
387 Ga0495600_0275363 3300046809 Bacteria 1066
388 Ga0495600_0290422 3300046809 Bacteria 1033
389 Ga0495581_0000343 3300047315 Bacteria 23177
390 Ga0495581_0101428 3300047315 Bacteria 1672
391 Ga0495604_0005063 3300047317 Bacteria 10432
392 Ga0495604_0029676 3300047317 Bacteria 4350
393 Ga0495604_0307739 3300047317 Bacteria 1062
394 Ga0495636_0180299 3300047318 Bacteria 958
395 Ga0495674_0036331 3300047319 Bacteria 4434
396 Ga0495676_0011612 3300047321 Bacteria 7946
397 Ga0495676_0019216 3300047321 Bacteria 6012
398 Ga0495676_0109533 3300047321 Bacteria 2029
399 Ga0495687_083810 3300047443 Bacteria 1240
400 Ga0495673_0203483 3300047469 Bacteria 739
401 Ga0495684_0001150 3300047471 Bacteria 21305
402 Ga0495684_0039529 3300047471 Bacteria 3617
403 Ga0495686_0120369 3300047472 Bacteria 1565
404 Ga0495593_0000077 3300047673 Bacteria 41818
405 Ga0495602_0012406 3300048088 Bacteria 8763
406 Ga0495602_0112746 3300048088 Bacteria 2206
407 Ga0496101_0272596 3300048904 Bacteria 1321
408 Ga0496101_0311339 3300048904 Bacteria 1234
409 Ga0496102_0026259 3300048905 Bacteria 5192
410 Ga0496102_0229055 3300048905 Bacteria 1752
411 Ga0496102_0446087 3300048905 Bacteria 1214
412 Ga0496102_0583406 3300048905 Bacteria 1041
413 Ga0496103_0006966 3300048906 Bacteria 6748
414 Ga0496104_0061246 3300048907 Bacteria 3567
415 Ga0496104_0576817 3300048907 Bacteria 1035
416 Ga0496105_0000873 3300048908 Bacteria 20637
417 Ga0496105_0481293 3300048908 Bacteria 976
418 Ga0496106_0018447 3300048909 Bacteria 5159
419 Ga0496108_0038051 3300048911 Bacteria 4008
420 Ga0496108_0038964 3300048911 Bacteria 3961
421 Ga0496109_0024649 3300048912 Bacteria 5350
422 Ga0496109_0357224 3300048912 Bacteria 1380
423 Ga0496109_0398219 3300048912 Bacteria 1301
424 Ga0496111_0067902 3300048914 Bacteria 2591
425 Ga0496112_0254716 3300048915 Bacteria 1705
426 Ga0496112_0454490 3300048915 Bacteria 1218
427 Ga0496113_0087673 3300048916 Bacteria 2393
428 Ga0496113_0403523 3300048916 Bacteria 1097
429 Ga0496113_0462499 3300048916 Bacteria 1019
430 Ga0496113_0471097 3300048916 Bacteria 1009
431 Ga0496113_0653943 3300048916 Bacteria 840
432 Ga0496114_0360360 3300048917 Bacteria 1286
433 Ga0496114_0838326 3300048917 Bacteria 799
434 Ga0496115_0237517 3300048918 Bacteria 1502
435 Ga0496115_0291401 3300048918 Bacteria 1339
436 Ga0496116_0055588 3300048919 Bacteria 2599
437 Ga0496117_0146824 3300048920 Bacteria 1403
438 Ga0496118_0031976 3300048921 Bacteria 4347
439 Ga0496118_0040154 3300048921 Bacteria 3724
440 Ga0496118_0227867 3300048921 Bacteria 1078
441 Ga0496119_0036444 3300048922 Bacteria 3210
442 Ga0496120_0073729 3300048923 Bacteria 1867
443 Ga0496121_0093380 3300048924 Bacteria 2343
444 Ga0496121_0166493 3300048924 Bacteria 1606
445 Ga0496121_0197953 3300048924 Bacteria 1434
446 Ga0496122_0101563 3300048925 Bacteria 1921
447 Ga0496122_0331469 3300048925 Bacteria 804
448 Ga0496123_0208778 3300048926 Bacteria 994
449 Ga0496124_0096395 3300048927 Bacteria 2403
450 Ga0496125_0071251 3300048928 Bacteria 2717
451 Ga0496125_0080505 3300048928 Bacteria 2492
452 Ga0496126_0009866 3300048929 Bacteria 10104
453 Ga0496126_0010363 3300048929 Bacteria 9784
454 Ga0496126_0075620 3300048929 Bacteria 2989
455 Ga0496126_0087793 3300048929 Bacteria 2740
456 Ga0496126_0090313 3300048929 Bacteria 2695
457 Ga0501031_0000253 3300049568 Bacteria 29955
458 Ga0501032_0000273 3300049569 Bacteria 43466
459 Ga0501033_0000098 3300049570 Bacteria 82803
460 Ga0501034_0000175 3300049571 Bacteria 119465
461 Ga0501036_0000049 3300049572 Bacteria 75400
462 Ga0501037_0000069 3300049573 Bacteria 95277
463 Ga0501038_0000034 3300049574 Bacteria 128854
464 Ga0501039_0000090 3300049575 Bacteria 63919
465 Ga0501042_0010773 3300049578 Bacteria 6147
466 Ga0501043_0007385 3300049579 Bacteria 8719
467 Ga0501046_0001187 3300049580 Bacteria 25318
468 Ga0501047_0000255 3300049581 Bacteria 62993
469 Ga0501048_0000252 3300049582 Bacteria 35941
470 Ga0501067_0001929 3300049583 Bacteria 11405
471 Ga0501068_0028062 3300049584 Bacteria 3325
472 Ga0501069_0014774 3300049585 Bacteria 4177
473 Ga0501069_0061819 3300049585 Bacteria 2092
474 Ga0501070_0052322 3300049586 Bacteria 3389
475 Ga0501070_0077302 3300049586 Bacteria 2755
476 Ga0501072_0000146 3300049588 Bacteria 52958
477 Ga0501073_0000035 3300049589 Bacteria 94077
478 Ga0501074_0007973 3300049590 Bacteria 7668
479 Ga0501076_0121053 3300049592 Bacteria 2119
480 Ga0501079_0038604 3300049741 Bacteria 3682
481 Ga0501080_0003144 3300049742 Bacteria 14530
482 Ga0501044_0000461 3300049823 Bacteria 49470
483 nmdc:mga03683_5421_c3 3300050489 Bacteria 2144
484 nmdc:mga03n38_103503_c1 3300050490 Bacteria 1376
485 nmdc:mga03n38_497616_c1 3300050490 Bacteria 684
486 nmdc:mga00v17_134364_c1 3300050491 Bacteria 1583
487 nmdc:mga00v17_313969_c1 3300050491 Bacteria 1018
488 nmdc:mga0yw44_229344_c1 3300050492 Bacteria 1232
489 nmdc:mga0yw44_353951_c1 3300050492 Bacteria 989
490 nmdc:mga0k408_216882_c1 3300050493 Bacteria 1142
491 nmdc:mga06z11_313153_c1 3300050494 Bacteria 935
492 nmdc:mga06z11_323336_c1 3300050494 Bacteria 920
493 nmdc:mga07m45_112598_c1 3300050496 Bacteria 1568
494 nmdc:mga05p37_39112_c1 3300050507 Bacteria 5820
495 nmdc:mga0n895_17054_c1 3300050512 Bacteria 6685
496 nmdc:mga0sz30_16042_c1 3300050516 Bacteria 2967
497 nmdc:mga0sz30_202409_c1 3300050516 Bacteria 882
498 nmdc:mga0sz30_24369_c1 3300050516 Bacteria 2469
499 nmdc:mga0sz30_49810_c1 3300050516 Bacteria 1775
500 Ga0495601_0005265 3300053077 Bacteria 7526
501 Ga0495655_0008715 3300053083 Bacteria 1939
502 Ga0495595_0002338 3300053084 Bacteria 7391
503 Ga0495619_0002871 3300053085 Bacteria 11205
504 Ga0500578_0067604 3300053086 Bacteria 2279
505 Ga0500647_0045813 3300053091 Bacteria 2101
506 Ga0500651_0007272 3300053093 Bacteria 6458
507 Ga0500566_0000091 3300053094 Bacteria 45305
508 Ga0500566_0000990 3300053094 Bacteria 16360
509 Ga0500650_0133932 3300053098 Bacteria 1151
510 Ga0500557_000024 3300053105 Bacteria 84960
511 Ga0500569_000307 3300053109 Bacteria 7851
512 Ga0500595_012475 3300053119 Bacteria 3286
513 Ga0500595_013688 3300053119 Bacteria 3102
514 Ga0500608_001204 3300053122 Bacteria 9253
515 Ga0500642_0000107 3300053130 Bacteria 40189
516 Ga0500559_0000512 3300053136 Bacteria 27276
517 Ga0500559_0034341 3300053136 Bacteria 2187
518 Ga0500559_0153568 3300053136 Bacteria 1081
519 Ga0500559_0188751 3300053136 Bacteria 971
520 Ga0500634_0104048 3300053161 Bacteria 1415
521 Ga0500638_047614 3300053162 Bacteria 2075
522 Ga0500639_039890 3300053163 Bacteria 2471
523 Ga0500636_0144485 3300053177 Bacteria 1313
524 Ga0500625_010563 3300053729 Bacteria 4156
525 Ga0500609_004418 3300053731 Bacteria 1944
526 Ga0500601_000621 3300053737 Bacteria 5032
527 Ga0501084_0035038 3300054114 Bacteria 4196
528 Ga0500661_004622 3300055283 Bacteria 2571
529 Ga0500661_019413 3300055283 Bacteria 1210
530 Ga0501082_0003415 3300060353 Bacteria 13868
531 Ga0530510_0185691 3300061734 Bacteria 1543
532 2507509248 2507262055 Bacteria 8048963
533 2508543316 2508501009 Bacteria 7784016
534 2508690930 2508501042 Bacteria 8719808
535 2513625729 2513237092 Bacteria 8341956
536 2513637821 2513237094 Bacteria 8789602
537 2513646752 2513237095 Bacteria 8976980
538 2513700588 2513237102 Bacteria 7703324
539 2513717235 2513237104 Bacteria 10034502
540 2513876570 2513237139 Bacteria 8737671
541 2514010915 2513237161 Bacteria 8871253
542 2515626664 2515154112 Bacteria 8294334
543 2517101900 2517093001 Bacteria 9002274
544 2524436672 2524023205 Bacteria 8918781
545 2528852259 2528768022 Bacteria 10457665
546 2617352858 2617270735 Bacteria 9163226
547 2617376362 2617270741 Bacteria 8201522
548 2671117626 2667528175 Bacteria 7532676
549 2745079259 2744054633 Bacteria 8678936
550 2793063955 2791355196 Bacteria 7323613
551 2793073003 2791355197 Bacteria 8420563
552 2805919825 2802429603 Bacteria 8777136
553 2818242868 2816332527 Bacteria 8933356
554 2824606026 2824600985 Bacteria 8488197
555 2824615965 2824609381 Bacteria 8672835
556 2824621908 2824617872 Bacteria 8814715
557 2824633494 2824626560 Bacteria 8813858
558 2824640437 2824635225 Bacteria 8785348
559 2824649989 2824644064 Bacteria 8743947
560 2824658888 2824653114 Bacteria 8493680
561 2824667777 2824661429 Bacteria 9877870
562 2824676142 2824671348 Bacteria 8369588
563 2824683149 2824679649 Bacteria 8248951
564 2824691841 2824687955 Bacteria 8360029
565 2824699418 2824696289 Bacteria 8335049
566 2824721027 2824714736 Bacteria 8717648
567 2824730238 2824723954 Bacteria 8758240
568 2824734458 2824732956 Bacteria 7810675
569 2824751447 2824746037 Bacteria 7911610
570 2824779347 2824773399 Bacteria 8360218
571 2838126424 2838122688 Bacteria 8803140
572 2841943501 2841941048 Bacteria 8688029
573 2841950551 2841949485 Bacteria 8680857
574 2841958073 2841957949 Bacteria 8652217
575 2841966865 2841966195 Bacteria 8673214
576 2841975615 2841974524 Bacteria 8931498
577 2841988178 2841983080 Bacteria 8395090
578 2842039671 2842038055 Bacteria 8002051
579 2842047383 2842045827 Bacteria 8006841
580 2844318467 2844315083 Bacteria 8138177
581 2847935358 2847930680 Bacteria 9342022
582 2847945951 2847939898 Bacteria 8606328
583 2849079927 2849076700 Bacteria 7039503
584 2857513680 2857509624 Bacteria 7472071
585 2874597371 2874590934 Bacteria 8299676
586 2874616411 2874612657 Bacteria 8252029
587 2874626724 2874620515 Bacteria 8290088
588 2874631144 2874628541 Bacteria 8630250
589 2874649295 2874645413 Bacteria 8214782
590 2876768880 2876761206 Bacteria 10111113
591 2876777832 2876771140 Bacteria 8287509
592 2876823147 2876818435 Bacteria 8274608
593 2879078589 2879074833 Bacteria 8279565
594 2879088567 2879083081 Bacteria 8587928
595 2879108045 2879099564 Bacteria 10442239
596 2879132934 2879127579 Bacteria 8294491
597 2879148733 2879142872 Bacteria 8267021
598 2881366774 2881364244 Bacteria 7710352
599 2885371891 2885366525 Bacteria 8326213
600 2885380071 2885374607 Bacteria 8927485
601 2885391697 2885383462 Bacteria 9473874
602 2885415977 2885409591 Bacteria 9235467
603 2888383416 2888378607 Bacteria 9652610
604 2888394511 2888388044 Bacteria 7304136
605 2888423813 2888419890 Bacteria 7857137
606 2893068389 2893066018 Bacteria 6158120
607 2903730169 2903727486 Bacteria 8281579
608 2903776148 2903768456 Bacteria 9749579
609 2904668302 2904666416 Bacteria 8226587
610 2906603553 2906602504 Bacteria 8295279
611 2906618010
612 2906646310 2906643746 Bacteria 8722424
613 2908760899 2908756301 Bacteria 8864324
614 2908779516 2908775508 Bacteria 8092255
615 2922373607
616 2922395729 2922393267 Bacteria 8285685
617 2929617341 2929615660 Bacteria 9193770
618 2929627046 2929624759 Bacteria 9339455
619 2932787623 2932784394 Bacteria 9704911
620 2932800795 2932794094 Bacteria 7915132
621 2932803412 2932801729 Bacteria 7987968
622 2932813196 2932809354 Bacteria 9135765
623 2932820889 2932818245 Bacteria 9955613
624 2932835324 2932828146 Bacteria 9745859
625 2933579298 2933577622 Bacteria 9116884
626 2935611862 2935608549 Bacteria 8203142
627 2935621703 2935616580 Bacteria 9032984
628 2935633634 2935630451 Bacteria 8169952
629 2935642652 2935638405 Bacteria 10015038
630 2935655105 2935648319 Bacteria 8801166
631 2935663963 2935656913 Bacteria 8965014
632 2935667755 2935665750 Bacteria 9571747
633 2935682245 2935675223 Bacteria 9928132
634 2935688501 2935684952 Bacteria 9590419
635 2935695850 2935694250 Bacteria 9291695
636 2935706595 2935703347 Bacteria 10242284
637 2935715520 2935713505 Bacteria 9608509
638 2935725916 2935722832 Bacteria 9608746
639 2935734339 2935732158 Bacteria 9706831
640 2935743718 2935741537 Bacteria 9707219
641 2935754245 2935750917 Bacteria 9590372
642 2935768394 2935760218 Bacteria 9817913
643 2935772660 2935769743 Bacteria 7878163
644 2935783210 2935777560 Bacteria 8077691
645 2935790953 2935785616 Bacteria 7962367
646 2935799346 2935793552 Bacteria 8012592
647 2935806438 2935801545 Bacteria 9301974
648 2935813030 2935810662 Bacteria 9401221
649 2935821342 2935819856 Bacteria 8261050
650 2935830683 2935827899 Bacteria 10038562
651 2935840711 2935837841 Bacteria 9454360
652 2935850399 2935847175 Bacteria 8228321
653 2935859950 2935855204 Bacteria 9035059
654 2935869415 2935864058 Bacteria 9784707
655 2935880424 2935873716 Bacteria 9632195
656 2935886484 2935883170 Bacteria 7964738
657 2935914016 2935908558 Bacteria 8568796
658 2935921157 2935916978 Bacteria 9113783
659 2935931796 2935926038 Bacteria 8601059
660 2935940269 2935934488 Bacteria 8602579
661 2935947906 2935942939 Bacteria 8599779
662 2935956553 2935951376 Bacteria 8602333
663 2935973347 2935967501 Bacteria 8603075
664 2935977594 2935975950 Bacteria 8347125
665 2935989509 2935984226 Bacteria 8302647
666 2935999479 2935992306 Bacteria 9802711
667 2936006539 2936002035 Bacteria 9362176
668 2936018119 2936011229 Bacteria 8801034
669 2936026622 2936019824 Bacteria 8804134
670 2936035365 2936028420 Bacteria 8965941
671 2936041618 2936037263 Bacteria 9446081
672 2936053514 2936046547 Bacteria 8903709
673 2936057047 2936055302 Bacteria 8785755
674 2940560379 2940556831 Bacteria 9590747
675 2941534216 2941531003 Bacteria 7653939
676 2941541159 2941538514 Bacteria 9402094
677 3005479656 3005474847 Bacteria 9259049
678 3005489543 3005483717 Bacteria 7877331
679 3005511966 3005506211 Bacteria 6943378
680 3005588691 3005587118 Bacteria 7794411
681 3005598572 3005594810 Bacteria 8716512
682 8006927630 8006926726 Bacteria 6749210
683 8016530264 8016522445 Bacteria 8156687
684 8016535523 8016530956 Bacteria 8155261
685 8016548720 8016539877 Bacteria 8155419
686 8016553416 8016548790 Bacteria 8155074
687 8016561795 8016557553 Bacteria 8154380
688 8016577979 8016575299 Bacteria 8154085
689 8016599629 8016595262 Bacteria 8149947
690 8016611294 8016603502 Bacteria 8731218
691 8016622414 8016613128 Bacteria 8794220
692 8016627370 8016622563 Bacteria 7999408
693 8017062333 8017057580 Bacteria 10023680
694 8019535254 8019530166 Bacteria 8155624
695 8019544226 8019538911 Bacteria 7872763
696 8019554473 8019547302 Bacteria 7996444
697 8019581789 8019576017 Bacteria 10049540
698 8019589460 8019586578 Bacteria 10212056
699 8019601804 8019597564 Bacteria 10041141
700 8019616749 8019608314 Bacteria 10042931
701 8019644596 8019638758 Bacteria 9062356
702 8019657617 8019648815 Bacteria 10014479
703 8019662974 8019659431 Bacteria 8577854
704 8019672572 8019668869 Bacteria 8791617
705 8019683586 8019678201 Bacteria 8863603
706 8019689326 8019687851 Bacteria 8712826
707 8055747044 8055742211 Bacteria 9226248
708 Ga0157376_10168700
709 LJQas_1003448
710 JGI25165J46597_1003401
711 JGI25153J46596_10000453
712 JGI25153J46596_10000935
713 JGI25153J46596_10001003
714 JGI25153J46596_10001107
715 rootH1_10143344
716 rootH1_10223957
717 JGI25160J50197_1015923
718 JGI25160J50197_1022282
719 JGI25404J52841_10030551
720 Ga0055542_1019795
721 Ga0055526_1038099
722 Ga0055524_1031677
723 Ga0055531_10022792
724 Ga0055543_1006339
725 Ga0065165_1003099
726 Ga0065165_1003661
727 Ga0065165_1031865
728 Ga0070658_10052361
729 Ga0070683_100004954
730 Ga0070666_10366375
731 Ga0070666_10592356
732 Ga0068868_100272992
733 Ga0070668_100027107
734 Ga0070668_100659930
735 Ga0070674_100231296
736 Ga0070659_100531509
737 Ga0070659_100889603
738 Ga0070667_100127135
739 Ga0070709_10000211
740 Ga0070714_100053658
741 Ga0070714_100385754
742 Ga0070713_100049760
743 Ga0070713_100064710
744 Ga0070710_10000132
745 Ga0070711_100002262
746 Ga0070663_100048654
747 Ga0070663_100216338
748 Ga0070678_100359674
749 Ga0070662_100183897
750 Ga0070681_10014748
751 Ga0070707_100084981
752 Ga0070698_100674877
753 Ga0070697_100097561
754 Ga0068853_100278382
755 Ga0070665_100053381
756 Ga0070665_100239344
757 Ga0070665_100278102
758 Ga0070665_100336193
759 Ga0068855_100040288
760 Ga0068855_100482192
761 Ga0068854_100055571
762 Ga0068854_100242174
763 Ga0068856_100028913
764 Ga0068852_100005484
765 Ga0068864_100273841
766 Ga0068863_100927071
767 Ga0068860_100242978
768 Ga0068860_101033672
769 Ga0081455_10001700
770 Ga0081455_10015870
771 Ga0081455_10042374
772 Ga0081538_10182576
773 Ga0081540_1001668
774 Ga0075365_10009318
775 Ga0075365_10071194
776 Ga0075365_10110479
777 Ga0075365_10419835
778 Ga0075368_10001505
779 Ga0075363_100048650
780 Ga0075363_100182289
781 Ga0075364_10024165
782 Ga0070715_10305288
783 Ga0070716_100020132
784 Ga0070716_100170206
785 Ga0070716_100215141
786 Ga0070716_100397763
787 Ga0070716_100420117
788 Ga0070712_100225707
789 Ga0075362_10042692
790 Ga0075367_10172640
791 Ga0075367_10495622
792 Ga0075369_10000490
793 Ga0075369_10013139
794 Ga0075366_10004974
795 Ga0097621_100881086
796 Ga0075370_10008145
797 Ga0075428_100035675
798 Ga0075430_100318024
799 Ga0075434_100018948
800 Ga0068865_100356814
801 Ga0075436_100224409
802 Ga0099824_1032313
803 Ga0099822_1052604
804 Ga0099823_1080950
805 Ga0099794_10131427
806 Ga0105240_10024214
807 Ga0111539_11544408
808 Ga0105245_10017488
809 Ga0105245_10389223
810 Ga0105247_10018505
811 Ga0105247_10316787
812 Ga0105243_10152207
813 Ga0105241_10039995
814 Ga0105241_10108940
815 Ga0105242_11402246
816 Ga0105242_11697185
817 Ga0105237_10006896
818 Ga0105237_10020477
819 Ga0105237_10141373
820 Ga0105238_10056091
821 Ga0105238_10416799
822 Ga0105249_10145882
823 Ga0099796_10152466
824 Ga0105239_10029408
825 Ga0105239_10039342
826 Ga0105239_10263791
827 Ga0157369_10334230
828 Ga0157374_10041837
829 Ga0157378_10556382
830 Ga0163162_11438328
831 Ga0157372_10791633
832 Ga0163163_10086400
833 Ga0163163_10943214
834 Ga0157380_11289780
835 Ga0157379_10221334
836 Ga0163161_10186296
837 Ga0214544_1014130
838 Ga0214542_1005735
839 Ga0214545_1005338
840 Ga0214543_1005480
841 Ga0213873_10043248
842 Ga0213876_10001750
843 Ga0213876_10030008
844 Ga0213876_10201995
845 Ga0209563_102991
846 Ga0207425_1019863
847 Ga0209148_1000155
848 Ga0209148_1019602
849 Ga0209233_1025524
850 Ga0209455_1003253
851 Ga0209455_1012199
852 Ga0209564_1005928
853 Ga0209758_1000021
854 Ga0209758_1000371
855 Ga0209758_1001143
856 Ga0209758_1001291
857 Ga0209758_1013219
858 Ga0209758_1017478
859 Ga0209758_1029215
860 Ga0209758_1032520
861 Ga0209256_1006784
862 Ga0209256_1078967
863 Ga0207426_1000352
864 Ga0207426_1003318
865 Ga0207426_1013312
866 Ga0207426_1053368
867 Ga0207426_1057495
868 Ga0209257_1001227
869 Ga0209257_1027370
870 Ga0207692_10001099
871 Ga0207710_10045612
872 Ga0207688_10279439
873 Ga0207647_10001318
874 Ga0207685_10147782
875 Ga0207699_10000361
876 Ga0207699_10081493
877 Ga0207699_10523049
878 Ga0207705_10161204
879 Ga0207654_10007993
880 Ga0207707_10024685
881 Ga0207695_10000015
882 Ga0207671_10001316
883 Ga0207671_10035749
884 Ga0207671_10083220
885 Ga0207671_10127741
886 Ga0207693_10106971
887 Ga0207693_10121706
888 Ga0207663_10007866
889 Ga0207663_10054493
890 Ga0207660_10160827
891 Ga0207657_10452468
892 Ga0207646_10029729
893 Ga0207694_10043499
894 Ga0207694_10195171
895 Ga0207700_10011229
896 Ga0207700_10103948
897 Ga0207664_10119349
898 Ga0207690_10311911
899 Ga0207690_10392304
900 Ga0207706_10176049
901 Ga0207706_10217334
902 Ga0207686_10029159
903 Ga0207709_10099846
904 Ga0207704_10275269
905 Ga0207665_10024686
906 Ga0207665_10130821
907 Ga0207665_10187808
908 Ga0207665_10256332
909 Ga0207665_10481182
910 Ga0207711_10122541
911 Ga0207667_10459248
912 Ga0207712_10048359
913 Ga0207677_10546795
914 Ga0207639_10075032
915 Ga0207639_10278425
916 Ga0207639_10519673
917 Ga0207639_10947407
918 Ga0207678_10045701
919 Ga0207678_10045898
920 Ga0207702_10369797
921 Ga0207676_10258204
922 Ga0207675_100126992
923 Ga0207698_10416457
924 Ga0209389_1000026
925 Ga0209389_1000132
926 Ga0209589_1000022
927 Ga0209489_100058
928 Ga0209489_103912
929 Ga0209700_100281
930 Ga0268266_10021024
931 Ga0268266_10097720
932 Ga0268266_10195901
933 Ga0268266_10217718
934 Ga0268266_10262156
935 Ga0268265_10048516
936 Ga0268264_10248728
937 Ga0265334_10014621
938 Ga0265330_10027490
939 Ga0265332_10016317
940 Ga0265332_10018778
941 Ga0265325_10020267
942 Ga0265339_10037045
943 Ga0265331_10014869
944 Ga0307513_10053443
945 Ga0265314_10011870
946 Ga0265342_10005586
947 Ga0265342_10020879
948 Ga0307412_10021329
949 Ga0307510_10242002
950 Ga0373934_0001797
951 Ga0373944_0010745
952 Ga0373952_0075024
953 Ga0373923_0173957
954 Ga0373936_0005899
955 Ga0373953_0000300
956 Ga0373956_0002257
957 Ga0373956_0235054
958 Ga0373943_0031564
959 Ga0373955_0000134
960 Ga0373955_0006732
961 Ga0373955_0136108
962 Ga0373924_0019019
963 Ga0373931_0408845
964 Ga0373935_0000860
965 Ga0373927_0000657
966 Ga0373933_0000117
967 Ga0373933_0000983
968 Ga0373947_0000174
969 Ga0373947_0067624
970 Ga0373937_0002366
971 Ga0373937_0187077
972 Ga0373937_0341192
973 Ga0373937_0661237
974 Ga0373925_0000748
975 Ga0373925_0272011
976 Ga0395900_0067791
977 Ga0395900_0337161
978 Ga0395898_0042839
979 Ga0395905_0025581
980 Ga0395905_0301268
981 Ga0395905_0432094
982 Ga0395901_0143723
983 Ga0395901_0188560
984 Ga0436365_0533200
985 Ga0436365_0675556
986 Ga0436365_1894951
987 Ga0436360_0233776
988 Ga0436363_1478588
989 Ga0436362_0204753
990 Ga0451807_0806367
991 Ga0451839_1529781
992 Ga0439431_0031376
993 Ga0439459_0012465
994 Ga0466972_0000125
995 Ga0466972_0001805
996 Ga0466972_0050843
997 Ga0466972_0227588
998 Ga0466965_0010797
999 Ga0466965_0206349
1000 Ga0466961_0000015
1001 Ga0466963_0032172
1002 Ga0466964_0023291
1003 Ga0466968_0074159
1004 Ga0466960_0002553
1005 Ga0466960_0017888
1006 Ga0466959_0022728
1007 Ga0466959_0041554
1008 Ga0466967_0134274
1009 Ga0466967_0156229
1010 Ga0466967_0190585
1011 Ga0495603_0000011
1012 Ga0495603_0039894
1013 Ga0495629_0000251
1014 Ga0495629_0006321
1015 Ga0495629_0552263
1016 Ga0495641_0005653
1017 Ga0495651_0022069
1018 Ga0495651_0047446
1019 Ga0495653_0001031
1020 Ga0495650_0126925
1021 Ga0495580_0000174
1022 Ga0495580_0173130
1023 Ga0495582_0000225
1024 Ga0495605_0070491
1025 Ga0495605_0075571
1026 Ga0495605_0188827
1027 Ga0495639_0000017
1028 Ga0495639_0230276
1029 Ga0495662_0000326
1030 Ga0495664_0025987
1031 Ga0495585_0075135
1032 Ga0495585_0101305
1033 Ga0495585_0125296
1034 Ga0495594_0000094
1035 Ga0495594_0092636
1036 Ga0495607_0084961
1037 Ga0495606_0087932
1038 Ga0495608_0207927
1039 Ga0495610_0123682
1040 Ga0495616_0051634
1041 Ga0495616_0270875
1042 Ga0495620_0013575
1043 Ga0495620_0030701
1044 Ga0495628_0103152
1045 Ga0495628_0117101
1046 Ga0495628_0313440
1047 Ga0495630_0016681
1048 Ga0495630_0227289
1049 Ga0495643_0122726
1050 Ga0495643_0124762
1051 Ga0495663_0078543
1052 Ga0495652_0014946
1053 Ga0495652_0100837
1054 Ga0495652_0211602
1055 Ga0495654_0210726
1056 Ga0495665_0000032
1057 Ga0495640_0014833
1058 Ga0495640_0030581
1059 Ga0495598_0039042
1060 Ga0495597_0109810
1061 Ga0495622_0008993
1062 Ga0495622_0038369
1063 Ga0495622_0170677
1064 Ga0495633_0085704
1065 Ga0495667_0000309
1066 Ga0495667_0012873
1067 Ga0495668_0078156
1068 Ga0495634_0002289
1069 Ga0495611_0152661
1070 Ga0495635_0000133
1071 Ga0495635_0026277
1072 Ga0495661_0162242
1073 Ga0495588_0072969
1074 Ga0495588_0110917
1075 Ga0495657_0161878
1076 Ga0495657_0280745
1077 Ga0495599_0000486
1078 Ga0495623_0002760
1079 Ga0495646_0000464
1080 Ga0495646_0033061
1081 Ga0495646_0048000
1082 Ga0495647_0000073
1083 Ga0495647_0074243
1084 Ga0495658_0000921
1085 Ga0495613_0015132
1086 Ga0495613_0047340
1087 Ga0495624_0000384
1088 Ga0495624_0098340
1089 Ga0495670_0130359
1090 Ga0495671_0094962
1091 Ga0495671_0098119
1092 Ga0495649_0029691
1093 Ga0495600_0002022
1094 Ga0495600_0275363
1095 Ga0495600_0290422
1096 Ga0495581_0000343
1097 Ga0495581_0101428
1098 Ga0495604_0005063
1099 Ga0495604_0029676
1100 Ga0495604_0307739
1101 Ga0495636_0180299
1102 Ga0495674_0036331
1103 Ga0495676_0011612
1104 Ga0495676_0019216
1105 Ga0495676_0109533
1106 Ga0495687_083810
1107 Ga0495673_0203483
1108 Ga0495684_0001150
1109 Ga0495684_0039529
1110 Ga0495686_0120369
1111 Ga0495593_0000077
1112 Ga0495602_0012406
1113 Ga0495602_0112746
1114 Ga0496101_0272596
1115 Ga0496101_0311339
1116 Ga0496102_0026259
1117 Ga0496102_0229055
1118 Ga0496102_0446087
1119 Ga0496102_0583406
1120 Ga0496103_0006966
1121 Ga0496104_0061246
1122 Ga0496104_0576817
1123 Ga0496105_0000873
1124 Ga0496105_0481293
1125 Ga0496106_0018447
1126 Ga0496108_0038051
1127 Ga0496108_0038964
1128 Ga0496109_0024649
1129 Ga0496109_0357224
1130 Ga0496109_0398219
1131 Ga0496111_0067902
1132 Ga0496112_0254716
1133 Ga0496112_0454490
1134 Ga0496113_0087673
1135 Ga0496113_0403523
1136 Ga0496113_0462499
1137 Ga0496113_0471097
1138 Ga0496113_0653943
1139 Ga0496114_0360360
1140 Ga0496114_0838326
1141 Ga0496115_0237517
1142 Ga0496115_0291401
1143 Ga0496116_0055588
1144 Ga0496117_0146824
1145 Ga0496118_0031976
1146 Ga0496118_0040154
1147 Ga0496118_0227867
1148 Ga0496119_0036444
1149 Ga0496120_0073729
1150 Ga0496121_0093380
1151 Ga0496121_0166493
1152 Ga0496121_0197953
1153 Ga0496122_0101563
1154 Ga0496122_0331469
1155 Ga0496123_0208778
1156 Ga0496124_0096395
1157 Ga0496125_0071251
1158 Ga0496125_0080505
1159 Ga0496126_0009866
1160 Ga0496126_0010363
1161 Ga0496126_0075620
1162 Ga0496126_0087793
1163 Ga0496126_0090313
1164 Ga0501031_0000253
1165 Ga0501032_0000273
1166 Ga0501033_0000098
1167 Ga0501034_0000175
1168 Ga0501036_0000049
1169 Ga0501037_0000069
1170 Ga0501038_0000034
1171 Ga0501039_0000090
1172 Ga0501042_0010773
1173 Ga0501043_0007385
1174 Ga0501046_0001187
1175 Ga0501047_0000255
1176 Ga0501048_0000252
1177 Ga0501067_0001929
1178 Ga0501068_0028062
1179 Ga0501069_0014774
1180 Ga0501069_0061819
1181 Ga0501070_0052322
1182 Ga0501070_0077302
1183 Ga0501072_0000146
1184 Ga0501073_0000035
1185 Ga0501074_0007973
1186 Ga0501076_0121053
1187 Ga0501079_0038604
1188 Ga0501080_0003144
1189 Ga0501044_0000461
1190 nmdc:mga03683_5421_c3
1191 nmdc:mga03n38_103503_c1
1192 nmdc:mga03n38_497616_c1
1193 nmdc:mga00v17_134364_c1
1194 nmdc:mga00v17_313969_c1
1195 nmdc:mga0yw44_229344_c1
1196 nmdc:mga0yw44_353951_c1
1197 nmdc:mga0k408_216882_c1
1198 nmdc:mga06z11_313153_c1
1199 nmdc:mga06z11_323336_c1
1200 nmdc:mga07m45_112598_c1
1201 nmdc:mga05p37_39112_c1
1202 nmdc:mga0n895_17054_c1
1203 nmdc:mga0sz30_16042_c1
1204 nmdc:mga0sz30_202409_c1
1205 nmdc:mga0sz30_24369_c1
1206 nmdc:mga0sz30_49810_c1
1207 Ga0495601_0005265
1208 Ga0495655_0008715
1209 Ga0495595_0002338
1210 Ga0495619_0002871
1211 Ga0500578_0067604
1212 Ga0500647_0045813
1213 Ga0500651_0007272
1214 Ga0500566_0000091
1215 Ga0500566_0000990
1216 Ga0500650_0133932
1217 Ga0500557_000024
1218 Ga0500569_000307
1219 Ga0500595_012475
1220 Ga0500595_013688
1221 Ga0500608_001204
1222 Ga0500642_0000107
1223 Ga0500559_0000512
1224 Ga0500559_0034341
1225 Ga0500559_0153568
1226 Ga0500559_0188751
1227 Ga0500634_0104048
1228 Ga0500638_047614
1229 Ga0500639_039890
1230 Ga0500636_0144485
1231 Ga0500625_010563
1232 Ga0500609_004418
1233 Ga0500601_000621
1234 Ga0501084_0035038
1235 Ga0500661_004622
1236 Ga0500661_019413
1237 Ga0501082_0003415
1238 Ga0530510_0185691
1239 2507509248
1240 2508543316
1241 2508690930
1242 2513625729
1243 2513637821
1244 2513646752
1245 2513700588
1246 2513717235
1247 2513876570
1248 2514010915
1249 2515626664
1250 2517101900
1251 2524436672
1252 2528852259
1253 2617352858
1254 2617376362
1255 2671117626
1256 2745079259
1257 2793063955
1258 2793073003
1259 2805919825
1260 2818242868
1261 2824606026
1262 2824615965
1263 2824621908
1264 2824633494
1265 2824640437
1266 2824649989
1267 2824658888
1268 2824667777
1269 2824676142
1270 2824683149
1271 2824691841
1272 2824699418
1273 2824721027
1274 2824730238
1275 2824734458
1276 2824751447
1277 2824779347
1278 2838126424
1279 2841943501
1280 2841950551
1281 2841958073
1282 2841966865
1283 2841975615
1284 2841988178
1285 2842039671
1286 2842047383
1287 2844318467
1288 2847935358
1289 2847945951
1290 2849079927
1291 2857513680
1292 2874597371
1293 2874616411
1294 2874626724
1295 2874631144
1296 2874649295
1297 2876768880
1298 2876777832
1299 2876823147
1300 2879078589
1301 2879088567
1302 2879108045
1303 2879132934
1304 2879148733
1305 2881366774
1306 2885371891
1307 2885380071
1308 2885391697
1309 2885415977
1310 2888383416
1311 2888394511
1312 2888423813
1313 2893068389
1314 2903730169
1315 2903776148
1316 2904668302
1317 2906603553
1318 2906618010
1319 2906646310
1320 2908760899
1321 2908779516
1322 2922373607
1323 2922395729
1324 2929617341
1325 2929627046
1326 2932787623
1327 2932800795
1328 2932803412
1329 2932813196
1330 2932820889
1331 2932835324
1332 2933579298
1333 2935611862
1334 2935621703
1335 2935633634
1336 2935642652
1337 2935655105
1338 2935663963
1339 2935667755
1340 2935682245
1341 2935688501
1342 2935695850
1343 2935706595
1344 2935715520
1345 2935725916
1346 2935734339
1347 2935743718
1348 2935754245
1349 2935768394
1350 2935772660
1351 2935783210
1352 2935790953
1353 2935799346
1354 2935806438
1355 2935813030
1356 2935821342
1357 2935830683
1358 2935840711
1359 2935850399
1360 2935859950
1361 2935869415
1362 2935880424
1363 2935886484
1364 2935914016
1365 2935921157
1366 2935931796
1367 2935940269
1368 2935947906
1369 2935956553
1370 2935973347
1371 2935977594
1372 2935989509
1373 2935999479
1374 2936006539
1375 2936018119
1376 2936026622
1377 2936035365
1378 2936041618
1379 2936053514
1380 2936057047
1381 2940560379
1382 2941534216
1383 2941541159
1384 3005479656
1385 3005489543
1386 3005511966
1387 3005588691
1388 3005598572
1389 8006927630
1390 8016530264
1391 8016535523
1392 8016548720
1393 8016553416
1394 8016561795
1395 8016577979
1396 8016599629
1397 8016611294
1398 8016622414
1399 8016627370
1400 8017062333
1401 8019535254
1402 8019544226
1403 8019554473
1404 8019581789
1405 8019589460
1406 8019601804
1407 8019616749
1408 8019644596
1409 8019657617
1410 8019662974
1411 8019672572
1412 8019683586
1413 8019689326
1414 8055747044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

9

187

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b0c-assembly1.cif.gz_A-2 the crystal structure of the putative phosphatase from escherichia coli 0.9321 32 226
2b0c-assembly1.cif.gz_A-2 the crystal structure of the putative phosphatase from escherichia coli 0.9098 32 226
4f72-assembly2.cif.gz_B crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.8811 32 217
4f71-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate 0.8761 32 217
4f72-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.867 32 217
ID Description Score Start End Superfamily
2b0cA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9616 49 113 1.10.150.240
2b0cA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9341 49 113 1.10.150.240
af_Q58101_1_137_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9101 191 214 3.40.50.150
4dccA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9035 123 220 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8826 116 216 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A6P1R946-F1-model_v4 HAD family phosphatase 0.9912 27 230
AF-A0A1Y6KF93-F1-model_v4 Putative Haloacid dehalogenase-like hydrolase 0.9875 27 230 GO:0016787
AF-A0A523L113-F1-model_v4 deleted 0.9774 32 228
AF-A0A2E5NIZ5-F1-model_v4 Haloacid dehalogenase 0.9734 30 227
AF-A0A0S8JXL4-F1-model_v4 Haloacid dehalogenase 0.97 31 229

Map