F476537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 318 | 1414 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10000108|Ga0114129_1000010845 |
| Length | 100 |
| Sequence | LEPLVNALHAAGEEGVRMAILSWILFGLVVGIIAKLLMPGRDPGGFIVTILLGIAGALVGGFIGRAMGFYGQGQGAGWLMSILGAIVLLFIYRLAVRRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 211 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 212 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 213 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 214 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 239 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 270 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 271 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 275 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 281 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 284 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 289 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 307 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.46 |
| Metatranscriptomes | 3.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 1.7 |
| Rhizosphere | 97.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10000108 | 3300009147 | Bacteria | 81939 |
| 2 | JGI24751J29686_10022043 | 3300002459 | Unclassified | 1321 |
| 3 | rootL2_10084844 | 3300003322 | Bacteria | 2678 |
| 4 | Ga0007429J51699_1031697 | 3300003579 | Bacteria | 1152 |
| 5 | Ga0032354_1023873 | 3300003693 | Unclassified | 1272 |
| 6 | Ga0032354_1069567 | 3300003693 | Unclassified | 621 |
| 7 | Ga0058863_11770274 | 3300004799 | Bacteria | 1592 |
| 8 | Ga0058860_10038317 | 3300004801 | Bacteria | 744 |
| 9 | Ga0058860_12191695 | 3300004801 | Bacteria | 993 |
| 10 | Ga0065715_10016006 | 3300005293 | Unclassified | 2664 |
| 11 | Ga0065715_11187906 | 3300005293 | Unclassified | 501 |
| 12 | Ga0065707_10191511 | 3300005295 | Bacteria | 1351 |
| 13 | Ga0065707_10444521 | 3300005295 | Unclassified | 807 |
| 14 | Ga0070676_10171884 | 3300005328 | Bacteria | 1402 |
| 15 | Ga0070683_101037738 | 3300005329 | Unclassified | 787 |
| 16 | Ga0070690_100061669 | 3300005330 | Bacteria | 2416 |
| 17 | Ga0070690_100201567 | 3300005330 | Bacteria | 1385 |
| 18 | Ga0070690_100219113 | 3300005330 | Bacteria | 1333 |
| 19 | Ga0070677_10162402 | 3300005333 | Bacteria | 1049 |
| 20 | Ga0070677_10246974 | 3300005333 | Bacteria | 884 |
| 21 | Ga0068869_100001674 | 3300005334 | Bacteria | 13247 |
| 22 | Ga0068869_100410367 | 3300005334 | Bacteria | 1116 |
| 23 | Ga0070666_10707800 | 3300005335 | Bacteria | 739 |
| 24 | Ga0070666_10974504 | 3300005335 | Unclassified | 628 |
| 25 | Ga0070680_100080493 | 3300005336 | Unclassified | 2686 |
| 26 | Ga0070680_101437142 | 3300005336 | Bacteria | 597 |
| 27 | Ga0070682_100774650 | 3300005337 | Bacteria | 777 |
| 28 | Ga0070682_100993087 | 3300005337 | Unclassified | 696 |
| 29 | Ga0070682_101683982 | 3300005337 | Unclassified | 550 |
| 30 | Ga0068868_100660301 | 3300005338 | Bacteria | 932 |
| 31 | Ga0068868_100815873 | 3300005338 | Bacteria | 843 |
| 32 | Ga0070660_100396098 | 3300005339 | Bacteria | 1141 |
| 33 | Ga0070660_100421828 | 3300005339 | Bacteria | 1105 |
| 34 | Ga0070689_100197218 | 3300005340 | Bacteria | 1642 |
| 35 | Ga0070689_101287585 | 3300005340 | Unclassified | 658 |
| 36 | Ga0070691_10084898 | 3300005341 | Bacteria | 1555 |
| 37 | Ga0070691_10312296 | 3300005341 | Bacteria | 862 |
| 38 | Ga0070691_10352081 | 3300005341 | Bacteria | 818 |
| 39 | Ga0070687_100005613 | 3300005343 | Bacteria | 5087 |
| 40 | Ga0070687_100032707 | 3300005343 | Bacteria | 2561 |
| 41 | Ga0070661_100250350 | 3300005344 | Unclassified | 1367 |
| 42 | Ga0070661_101120393 | 3300005344 | Bacteria | 656 |
| 43 | Ga0070661_101125079 | 3300005344 | Bacteria | 655 |
| 44 | Ga0070692_10438670 | 3300005345 | Bacteria | 833 |
| 45 | Ga0070668_100544169 | 3300005347 | Bacteria | 1010 |
| 46 | Ga0070669_100059046 | 3300005353 | Bacteria | 2816 |
| 47 | Ga0070669_100095918 | 3300005353 | Bacteria | 2231 |
| 48 | Ga0070675_100003298 | 3300005354 | Bacteria | 12241 |
| 49 | Ga0070675_100462629 | 3300005354 | Unclassified | 1139 |
| 50 | Ga0070675_101165299 | 3300005354 | Bacteria | 709 |
| 51 | Ga0070671_100003192 | 3300005355 | Bacteria | 12777 |
| 52 | Ga0070671_100125111 | 3300005355 | Bacteria | 2164 |
| 53 | Ga0070674_100061558 | 3300005356 | Bacteria | 2620 |
| 54 | Ga0070673_100007029 | 3300005364 | Bacteria | 7380 |
| 55 | Ga0070673_100008047 | 3300005364 | Bacteria | 6986 |
| 56 | Ga0070673_100030664 | 3300005364 | Bacteria | 4028 |
| 57 | Ga0070673_100348703 | 3300005364 | Bacteria | 1313 |
| 58 | Ga0070659_100030095 | 3300005366 | Bacteria | 4200 |
| 59 | Ga0070659_100734893 | 3300005366 | Unclassified | 855 |
| 60 | Ga0070667_101298210 | 3300005367 | Bacteria | 682 |
| 61 | Ga0070709_10395092 | 3300005434 | Bacteria | 1031 |
| 62 | Ga0070709_10737456 | 3300005434 | Unclassified | 769 |
| 63 | Ga0070713_100010625 | 3300005436 | Bacteria | 6658 |
| 64 | Ga0070713_100660089 | 3300005436 | Unclassified | 996 |
| 65 | Ga0070701_10140980 | 3300005438 | Bacteria | 1378 |
| 66 | Ga0070701_10663021 | 3300005438 | Bacteria | 698 |
| 67 | Ga0070711_101124712 | 3300005439 | Bacteria | 677 |
| 68 | Ga0070705_100039072 | 3300005440 | Bacteria | 2690 |
| 69 | Ga0070700_100023523 | 3300005441 | Bacteria | 3604 |
| 70 | Ga0070700_101115243 | 3300005441 | Bacteria | 655 |
| 71 | Ga0070700_101809435 | 3300005441 | Unclassified | 526 |
| 72 | Ga0070694_101705383 | 3300005444 | Bacteria | 536 |
| 73 | Ga0070663_101129575 | 3300005455 | Bacteria | 686 |
| 74 | Ga0070678_100027465 | 3300005456 | Bacteria | 3864 |
| 75 | Ga0070678_101103254 | 3300005456 | Bacteria | 733 |
| 76 | Ga0070662_100322602 | 3300005457 | Bacteria | 1260 |
| 77 | Ga0070662_100909011 | 3300005457 | Unclassified | 751 |
| 78 | Ga0070681_10016257 | 3300005458 | Bacteria | 7423 |
| 79 | Ga0070681_10058263 | 3300005458 | Bacteria | 3843 |
| 80 | Ga0070681_10364088 | 3300005458 | Unclassified | 1356 |
| 81 | Ga0068867_100001597 | 3300005459 | Bacteria | 15742 |
| 82 | Ga0068867_100039709 | 3300005459 | Bacteria | 3432 |
| 83 | Ga0070685_10297435 | 3300005466 | Bacteria | 1087 |
| 84 | Ga0070706_100353372 | 3300005467 | Bacteria | 1370 |
| 85 | Ga0070707_100025801 | 3300005468 | Bacteria | 5578 |
| 86 | Ga0070707_100356585 | 3300005468 | Bacteria | 1420 |
| 87 | Ga0070698_100091463 | 3300005471 | Bacteria | 3025 |
| 88 | Ga0070698_100435061 | 3300005471 | Bacteria | 1247 |
| 89 | Ga0070698_100522805 | 3300005471 | Bacteria | 1125 |
| 90 | Ga0070699_101528832 | 3300005518 | Unclassified | 612 |
| 91 | Ga0070699_101631306 | 3300005518 | Bacteria | 591 |
| 92 | Ga0070679_100108978 | 3300005530 | Unclassified | 2756 |
| 93 | Ga0070697_100058323 | 3300005536 | Bacteria | 3142 |
| 94 | Ga0070697_101530310 | 3300005536 | Bacteria | 596 |
| 95 | Ga0068853_100933488 | 3300005539 | Bacteria | 834 |
| 96 | Ga0068853_102477963 | 3300005539 | Unclassified | 502 |
| 97 | Ga0070672_100001819 | 3300005543 | Bacteria | 13310 |
| 98 | Ga0070672_100018874 | 3300005543 | Bacteria | 4995 |
| 99 | Ga0070672_100162737 | 3300005543 | Bacteria | 1852 |
| 100 | Ga0070686_100042129 | 3300005544 | Bacteria | 2858 |
| 101 | Ga0070686_100062156 | 3300005544 | Bacteria | 2415 |
| 102 | Ga0070686_100173598 | 3300005544 | Bacteria | 1526 |
| 103 | Ga0070695_100230477 | 3300005545 | Bacteria | 1339 |
| 104 | Ga0070695_100236216 | 3300005545 | Bacteria | 1324 |
| 105 | Ga0070695_100593218 | 3300005545 | Unclassified | 869 |
| 106 | Ga0070695_101629377 | 3300005545 | Unclassified | 539 |
| 107 | Ga0070696_101083633 | 3300005546 | Bacteria | 673 |
| 108 | Ga0070693_100073368 | 3300005547 | Bacteria | 2021 |
| 109 | Ga0070693_100098783 | 3300005547 | Bacteria | 1775 |
| 110 | Ga0070665_101201309 | 3300005548 | Bacteria | 769 |
| 111 | Ga0070704_100249258 | 3300005549 | Bacteria | 1457 |
| 112 | Ga0068855_100121726 | 3300005563 | Bacteria | 2986 |
| 113 | Ga0070664_100021383 | 3300005564 | Bacteria | 5331 |
| 114 | Ga0068857_100433049 | 3300005577 | Bacteria | 1228 |
| 115 | Ga0068857_100445299 | 3300005577 | Bacteria | 1210 |
| 116 | Ga0068854_100280881 | 3300005578 | Bacteria | 1341 |
| 117 | Ga0068854_100363515 | 3300005578 | Bacteria | 1188 |
| 118 | Ga0068856_100867038 | 3300005614 | Unclassified | 922 |
| 119 | Ga0068856_101986975 | 3300005614 | Bacteria | 592 |
| 120 | Ga0070702_100006598 | 3300005615 | Bacteria | 5505 |
| 121 | Ga0070702_100078746 | 3300005615 | Bacteria | 1968 |
| 122 | Ga0068852_101720111 | 3300005616 | Unclassified | 650 |
| 123 | Ga0068859_100036569 | 3300005617 | Bacteria | 4930 |
| 124 | Ga0068859_100291034 | 3300005617 | Bacteria | 1726 |
| 125 | Ga0068864_100183871 | 3300005618 | Unclassified | 1912 |
| 126 | Ga0068864_100291514 | 3300005618 | Bacteria | 1525 |
| 127 | Ga0068864_100350842 | 3300005618 | Bacteria | 1392 |
| 128 | Ga0068866_10280122 | 3300005718 | Bacteria | 1033 |
| 129 | Ga0068861_100301086 | 3300005719 | Unclassified | 1389 |
| 130 | Ga0068861_100403355 | 3300005719 | Bacteria | 1214 |
| 131 | Ga0068861_102534306 | 3300005719 | Unclassified | 516 |
| 132 | Ga0068870_10172997 | 3300005840 | Unclassified | 1290 |
| 133 | Ga0068870_10208516 | 3300005840 | Bacteria | 1189 |
| 134 | Ga0068863_100225097 | 3300005841 | Bacteria | 1808 |
| 135 | Ga0068863_102389584 | 3300005841 | Bacteria | 538 |
| 136 | Ga0068858_100031356 | 3300005842 | Bacteria | 4936 |
| 137 | Ga0068860_100039032 | 3300005843 | Bacteria | 4542 |
| 138 | Ga0068860_100376546 | 3300005843 | Bacteria | 1401 |
| 139 | Ga0068862_101510654 | 3300005844 | Unclassified | 677 |
| 140 | Ga0081538_10104394 | 3300005981 | Bacteria | 1414 |
| 141 | Ga0081538_10265635 | 3300005981 | Bacteria | 645 |
| 142 | Ga0081538_10358995 | 3300005981 | Bacteria | 527 |
| 143 | Ga0070716_101561458 | 3300006173 | Bacteria | 541 |
| 144 | Ga0075367_10388341 | 3300006178 | Bacteria | 882 |
| 145 | Ga0097621_100411119 | 3300006237 | Bacteria | 1213 |
| 146 | Ga0068871_100213179 | 3300006358 | Unclassified | 1671 |
| 147 | Ga0068871_100534694 | 3300006358 | Unclassified | 1060 |
| 148 | Ga0075428_100002414 | 3300006844 | Bacteria | 20301 |
| 149 | Ga0075428_100012091 | 3300006844 | Bacteria | 9604 |
| 150 | Ga0075428_100013706 | 3300006844 | Bacteria | 9026 |
| 151 | Ga0075430_100005581 | 3300006846 | Bacteria | 10628 |
| 152 | Ga0075430_100055669 | 3300006846 | Bacteria | 3326 |
| 153 | Ga0075430_100073011 | 3300006846 | Bacteria | 2877 |
| 154 | Ga0075430_100685456 | 3300006846 | Unclassified | 845 |
| 155 | Ga0075430_100803468 | 3300006846 | Bacteria | 775 |
| 156 | Ga0075430_101518730 | 3300006846 | Bacteria | 550 |
| 157 | Ga0075431_100037021 | 3300006847 | Bacteria | 5026 |
| 158 | Ga0075431_100052713 | 3300006847 | Bacteria | 4195 |
| 159 | Ga0075431_100089620 | 3300006847 | Bacteria | 3175 |
| 160 | Ga0075431_100119432 | 3300006847 | Bacteria | 2720 |
| 161 | Ga0075431_100956950 | 3300006847 | Bacteria | 824 |
| 162 | Ga0075433_10012184 | 3300006852 | Bacteria | 6933 |
| 163 | Ga0075433_10032242 | 3300006852 | Bacteria | 4487 |
| 164 | Ga0075433_10167145 | 3300006852 | Unclassified | 1958 |
| 165 | Ga0075433_10179068 | 3300006852 | Unclassified | 1886 |
| 166 | Ga0075434_100053167 | 3300006871 | Unclassified | 4025 |
| 167 | Ga0075434_100190575 | 3300006871 | Bacteria | 2071 |
| 168 | Ga0075434_100281975 | 3300006871 | Bacteria | 1681 |
| 169 | Ga0075434_100380259 | 3300006871 | Bacteria | 1433 |
| 170 | Ga0075434_100438355 | 3300006871 | Bacteria | 1328 |
| 171 | Ga0075429_100004168 | 3300006880 | Bacteria | 12374 |
| 172 | Ga0075429_100028977 | 3300006880 | Bacteria | 4809 |
| 173 | Ga0075429_100200964 | 3300006880 | Bacteria | 1746 |
| 174 | Ga0068865_100024604 | 3300006881 | Bacteria | 3952 |
| 175 | Ga0068865_100237179 | 3300006881 | Bacteria | 1433 |
| 176 | Ga0075436_100458265 | 3300006914 | Bacteria | 929 |
| 177 | Ga0097620_100036568 | 3300006931 | Bacteria | 4930 |
| 178 | Ga0097620_100291031 | 3300006931 | Bacteria | 1726 |
| 179 | Ga0075435_100002272 | 3300007076 | Bacteria | 12689 |
| 180 | Ga0075435_100061311 | 3300007076 | Unclassified | 3051 |
| 181 | Ga0075435_100191544 | 3300007076 | Bacteria | 1731 |
| 182 | Ga0105240_10282156 | 3300009093 | Unclassified | 1907 |
| 183 | Ga0105240_10650625 | 3300009093 | Bacteria | 1155 |
| 184 | Ga0111539_10002069 | 3300009094 | Bacteria | 26819 |
| 185 | Ga0111539_10190074 | 3300009094 | Bacteria | 2396 |
| 186 | Ga0111539_11444706 | 3300009094 | Bacteria | 798 |
| 187 | Ga0111539_11762540 | 3300009094 | Bacteria | 718 |
| 188 | Ga0111539_11905564 | 3300009094 | Bacteria | 689 |
| 189 | Ga0111539_12185067 | 3300009094 | Unclassified | 642 |
| 190 | Ga0111539_12819318 | 3300009094 | Unclassified | 563 |
| 191 | Ga0111539_13402790 | 3300009094 | Bacteria | 511 |
| 192 | Ga0105245_10102895 | 3300009098 | Bacteria | 2645 |
| 193 | Ga0105245_10909590 | 3300009098 | Bacteria | 922 |
| 194 | Ga0105247_10745339 | 3300009101 | Unclassified | 742 |
| 195 | Ga0114129_10001729 | 3300009147 | Bacteria | 29783 |
| 196 | Ga0114129_10006049 | 3300009147 | Bacteria | 17157 |
| 197 | Ga0114129_10014363 | 3300009147 | Bacteria | 11287 |
| 198 | Ga0114129_10045184 | 3300009147 | Bacteria | 6192 |
| 199 | Ga0114129_10069154 | 3300009147 | Bacteria | 4922 |
| 200 | Ga0114129_10660749 | 3300009147 | Bacteria | 1348 |
| 201 | Ga0114129_10674367 | 3300009147 | Bacteria | 1332 |
| 202 | Ga0114129_11051161 | 3300009147 | Bacteria | 1022 |
| 203 | Ga0114129_12329636 | 3300009147 | Bacteria | 642 |
| 204 | Ga0105243_10023921 | 3300009148 | Bacteria | 4655 |
| 205 | Ga0105243_10861816 | 3300009148 | Bacteria | 898 |
| 206 | Ga0105243_10880381 | 3300009148 | Bacteria | 889 |
| 207 | Ga0105241_10032705 | 3300009174 | Bacteria | 3901 |
| 208 | Ga0105241_10378402 | 3300009174 | Unclassified | 1236 |
| 209 | Ga0105242_10004553 | 3300009176 | Bacteria | 10757 |
| 210 | Ga0105242_10031487 | 3300009176 | Bacteria | 4237 |
| 211 | Ga0105248_10141249 | 3300009177 | Bacteria | 2716 |
| 212 | Ga0105248_10301462 | 3300009177 | Unclassified | 1804 |
| 213 | Ga0105248_11296568 | 3300009177 | Unclassified | 824 |
| 214 | Ga0105248_11393406 | 3300009177 | Bacteria | 793 |
| 215 | Ga0105238_10704008 | 3300009551 | Bacteria | 1022 |
| 216 | Ga0105238_12452573 | 3300009551 | Bacteria | 557 |
| 217 | Ga0105249_10384371 | 3300009553 | Bacteria | 1430 |
| 218 | Ga0105249_11136173 | 3300009553 | Unclassified | 852 |
| 219 | Ga0105239_10749446 | 3300010375 | Bacteria | 1118 |
| 220 | Ga0105239_11131389 | 3300010375 | Unclassified | 902 |
| 221 | Ga0105239_11511107 | 3300010375 | Unclassified | 776 |
| 222 | Ga0105246_10027680 | 3300011119 | Bacteria | 3717 |
| 223 | Ga0157370_10350413 | 3300013104 | Unclassified | 1361 |
| 224 | Ga0157369_10872825 | 3300013105 | Unclassified | 923 |
| 225 | Ga0157374_11345868 | 3300013296 | Bacteria | 736 |
| 226 | Ga0157378_10103101 | 3300013297 | Bacteria | 2606 |
| 227 | Ga0157378_10217193 | 3300013297 | Bacteria | 1816 |
| 228 | Ga0163162_11203185 | 3300013306 | Bacteria | 860 |
| 229 | Ga0157372_10294183 | 3300013307 | Unclassified | 1888 |
| 230 | Ga0157372_10989019 | 3300013307 | Bacteria | 974 |
| 231 | Ga0157375_10475973 | 3300013308 | Bacteria | 1414 |
| 232 | Ga0163163_10067487 | 3300014325 | Unclassified | 3556 |
| 233 | Ga0163163_12933670 | 3300014325 | Unclassified | 532 |
| 234 | Ga0157380_10037696 | 3300014326 | Bacteria | 3747 |
| 235 | Ga0157380_10112192 | 3300014326 | Bacteria | 2293 |
| 236 | Ga0157380_10887399 | 3300014326 | Bacteria | 917 |
| 237 | Ga0157380_11601320 | 3300014326 | Bacteria | 707 |
| 238 | Ga0157377_10045177 | 3300014745 | Bacteria | 2460 |
| 239 | Ga0157376_11381310 | 3300014969 | Bacteria | 735 |
| 240 | Ga0157376_11825767 | 3300014969 | Bacteria | 644 |
| 241 | Ga0163161_10859478 | 3300017792 | Bacteria | 766 |
| 242 | Ga0163161_11010897 | 3300017792 | Unclassified | 710 |
| 243 | Ga0206356_10232510 | 3300020070 | Bacteria | 2470 |
| 244 | Ga0206356_11185460 | 3300020070 | Unclassified | 2220 |
| 245 | Ga0207682_10018981 | 3300025893 | Bacteria | 2691 |
| 246 | Ga0207682_10179880 | 3300025893 | Bacteria | 966 |
| 247 | Ga0207642_10359933 | 3300025899 | Bacteria | 861 |
| 248 | Ga0207710_10712391 | 3300025900 | Unclassified | 527 |
| 249 | Ga0207688_10011198 | 3300025901 | Bacteria | 4883 |
| 250 | Ga0207647_10116730 | 3300025904 | Bacteria | 1576 |
| 251 | Ga0207699_10488517 | 3300025906 | Unclassified | 887 |
| 252 | Ga0207699_10847544 | 3300025906 | Unclassified | 673 |
| 253 | Ga0207645_10002224 | 3300025907 | Bacteria | 15472 |
| 254 | Ga0207645_10021376 | 3300025907 | Bacteria | 4220 |
| 255 | Ga0207645_10797123 | 3300025907 | Unclassified | 642 |
| 256 | Ga0207643_10152707 | 3300025908 | Bacteria | 1385 |
| 257 | Ga0207643_10262774 | 3300025908 | Bacteria | 1066 |
| 258 | Ga0207684_11561969 | 3300025910 | Bacteria | 535 |
| 259 | Ga0207654_10016288 | 3300025911 | Bacteria | 3868 |
| 260 | Ga0207707_10255144 | 3300025912 | Unclassified | 1523 |
| 261 | Ga0207707_10315235 | 3300025912 | Bacteria | 1351 |
| 262 | Ga0207707_10861562 | 3300025912 | Bacteria | 751 |
| 263 | Ga0207695_10656391 | 3300025913 | Unclassified | 930 |
| 264 | Ga0207695_11159929 | 3300025913 | Bacteria | 653 |
| 265 | Ga0207695_11530782 | 3300025913 | Bacteria | 547 |
| 266 | Ga0207693_10243868 | 3300025915 | Unclassified | 1410 |
| 267 | Ga0207663_10247707 | 3300025916 | Bacteria | 1310 |
| 268 | Ga0207660_10093558 | 3300025917 | Unclassified | 2233 |
| 269 | Ga0207662_10006368 | 3300025918 | Bacteria | 6368 |
| 270 | Ga0207662_10088825 | 3300025918 | Bacteria | 1898 |
| 271 | Ga0207657_10192107 | 3300025919 | Unclassified | 1646 |
| 272 | Ga0207657_10346381 | 3300025919 | Bacteria | 1172 |
| 273 | Ga0207649_10744983 | 3300025920 | Bacteria | 762 |
| 274 | Ga0207652_10166919 | 3300025921 | Unclassified | 1974 |
| 275 | Ga0207652_11437341 | 3300025921 | Unclassified | 593 |
| 276 | Ga0207646_10405675 | 3300025922 | Unclassified | 1231 |
| 277 | Ga0207681_10012902 | 3300025923 | Bacteria | 5167 |
| 278 | Ga0207681_11373618 | 3300025923 | Unclassified | 593 |
| 279 | Ga0207681_11510043 | 3300025923 | Unclassified | 563 |
| 280 | Ga0207694_10633826 | 3300025924 | Bacteria | 900 |
| 281 | Ga0207650_10220718 | 3300025925 | Bacteria | 1525 |
| 282 | Ga0207659_10004161 | 3300025926 | Bacteria | 8735 |
| 283 | Ga0207659_10508070 | 3300025926 | Unclassified | 1021 |
| 284 | Ga0207659_11135061 | 3300025926 | Bacteria | 672 |
| 285 | Ga0207687_10966925 | 3300025927 | Bacteria | 730 |
| 286 | Ga0207700_10172364 | 3300025928 | Unclassified | 1806 |
| 287 | Ga0207644_10112774 | 3300025931 | Bacteria | 2058 |
| 288 | Ga0207644_10287894 | 3300025931 | Bacteria | 1320 |
| 289 | Ga0207690_10324881 | 3300025932 | Bacteria | 1210 |
| 290 | Ga0207706_10137407 | 3300025933 | Unclassified | 2150 |
| 291 | Ga0207686_10030357 | 3300025934 | Bacteria | 3199 |
| 292 | Ga0207686_10047658 | 3300025934 | Bacteria | 2650 |
| 293 | Ga0207709_10018302 | 3300025935 | Bacteria | 3922 |
| 294 | Ga0207669_10002689 | 3300025937 | Bacteria | 7604 |
| 295 | Ga0207669_10008948 | 3300025937 | Bacteria | 4734 |
| 296 | Ga0207704_10025065 | 3300025938 | Bacteria | 3249 |
| 297 | Ga0207704_10422441 | 3300025938 | Bacteria | 1057 |
| 298 | Ga0207704_11743583 | 3300025938 | Bacteria | 535 |
| 299 | Ga0207691_10030277 | 3300025940 | Bacteria | 5059 |
| 300 | Ga0207691_10069390 | 3300025940 | Bacteria | 3184 |
| 301 | Ga0207711_10605492 | 3300025941 | Bacteria | 1022 |
| 302 | Ga0207711_11332750 | 3300025941 | Bacteria | 660 |
| 303 | Ga0207711_11760315 | 3300025941 | Bacteria | 563 |
| 304 | Ga0207689_10000575 | 3300025942 | Bacteria | 35110 |
| 305 | Ga0207689_10045260 | 3300025942 | Bacteria | 3639 |
| 306 | Ga0207689_10268908 | 3300025942 | Bacteria | 1411 |
| 307 | Ga0207689_10479671 | 3300025942 | Bacteria | 1041 |
| 308 | Ga0207679_10064923 | 3300025945 | Unclassified | 2730 |
| 309 | Ga0207679_10818388 | 3300025945 | Bacteria | 850 |
| 310 | Ga0207679_11106468 | 3300025945 | Bacteria | 727 |
| 311 | Ga0207651_10015429 | 3300025960 | Bacteria | 4438 |
| 312 | Ga0207651_10028373 | 3300025960 | Bacteria | 3529 |
| 313 | Ga0207651_10053832 | 3300025960 | Bacteria | 2753 |
| 314 | Ga0207651_10164609 | 3300025960 | Bacteria | 1742 |
| 315 | Ga0207712_10590914 | 3300025961 | Bacteria | 959 |
| 316 | Ga0207712_11588707 | 3300025961 | Unclassified | 586 |
| 317 | Ga0207640_10163432 | 3300025981 | Unclassified | 1650 |
| 318 | Ga0207640_10231184 | 3300025981 | Bacteria | 1423 |
| 319 | Ga0207658_10395372 | 3300025986 | Bacteria | 1214 |
| 320 | Ga0207677_10582964 | 3300026023 | Bacteria | 979 |
| 321 | Ga0207703_10326767 | 3300026035 | Bacteria | 1406 |
| 322 | Ga0207708_10017092 | 3300026075 | Bacteria | 5459 |
| 323 | Ga0207708_11465526 | 3300026075 | Unclassified | 599 |
| 324 | Ga0207702_10682772 | 3300026078 | Archaea | 1011 |
| 325 | Ga0207641_10124960 | 3300026088 | Bacteria | 2302 |
| 326 | Ga0207641_10241316 | 3300026088 | Bacteria | 1684 |
| 327 | Ga0207641_12559622 | 3300026088 | Bacteria | 508 |
| 328 | Ga0207648_10003018 | 3300026089 | Bacteria | 17776 |
| 329 | Ga0207648_10018781 | 3300026089 | Bacteria | 6250 |
| 330 | Ga0207676_10014129 | 3300026095 | Bacteria | 5736 |
| 331 | Ga0207676_10133678 | 3300026095 | Unclassified | 2113 |
| 332 | Ga0207676_10280060 | 3300026095 | Bacteria | 1514 |
| 333 | Ga0207674_10369447 | 3300026116 | Bacteria | 1387 |
| 334 | Ga0207674_11248021 | 3300026116 | Bacteria | 713 |
| 335 | Ga0207675_100026353 | 3300026118 | Bacteria | 5411 |
| 336 | Ga0207675_100047690 | 3300026118 | Bacteria | 3999 |
| 337 | Ga0207675_100976508 | 3300026118 | Bacteria | 865 |
| 338 | Ga0207675_101690629 | 3300026118 | Unclassified | 653 |
| 339 | Ga0207675_102155464 | 3300026118 | Unclassified | 573 |
| 340 | Ga0207675_102639144 | 3300026118 | Unclassified | 511 |
| 341 | Ga0207683_10049436 | 3300026121 | Bacteria | 3681 |
| 342 | Ga0207683_10167708 | 3300026121 | Bacteria | 1987 |
| 343 | Ga0207683_10221631 | 3300026121 | Bacteria | 1723 |
| 344 | Ga0207698_11433681 | 3300026142 | Unclassified | 706 |
| 345 | Ga0207698_11672620 | 3300026142 | Unclassified | 652 |
| 346 | Ga0209967_1078416 | 3300027364 | Bacteria | 518 |
| 347 | Ga0210002_1016288 | 3300027617 | Bacteria | 1176 |
| 348 | Ga0209983_1059836 | 3300027665 | Bacteria | 841 |
| 349 | Ga0209971_1009574 | 3300027682 | Unclassified | 2295 |
| 350 | Ga0209971_1149676 | 3300027682 | Unclassified | 576 |
| 351 | Ga0209974_10004233 | 3300027876 | Bacteria | 5125 |
| 352 | Ga0207428_10001602 | 3300027907 | Bacteria | 23525 |
| 353 | Ga0268264_10044498 | 3300028381 | Bacteria | 3683 |
| 354 | Ga0268264_10393724 | 3300028381 | Bacteria | 1330 |
| 355 | Ga0268264_10892336 | 3300028381 | Unclassified | 892 |
| 356 | Ga0316182_1119089 | 3300030745 | Bacteria | 850 |
| 357 | Ga0307408_100060340 | 3300031548 | Bacteria | 2764 |
| 358 | Ga0307408_100077797 | 3300031548 | Bacteria | 2471 |
| 359 | Ga0307408_100247512 | 3300031548 | Bacteria | 1468 |
| 360 | Ga0307408_100328190 | 3300031548 | Bacteria | 1291 |
| 361 | Ga0307408_101089981 | 3300031548 | Bacteria | 740 |
| 362 | Ga0307408_101113427 | 3300031548 | Bacteria | 733 |
| 363 | Ga0307408_101275919 | 3300031548 | Unclassified | 688 |
| 364 | Ga0307408_102034862 | 3300031548 | Unclassified | 553 |
| 365 | Ga0307408_102147642 | 3300031548 | Bacteria | 539 |
| 366 | Ga0307405_10032778 | 3300031731 | Bacteria | 3074 |
| 367 | Ga0307405_10076533 | 3300031731 | Unclassified | 2171 |
| 368 | Ga0307405_10740983 | 3300031731 | Bacteria | 818 |
| 369 | Ga0307413_10665829 | 3300031824 | Bacteria | 860 |
| 370 | Ga0307413_11192191 | 3300031824 | Bacteria | 662 |
| 371 | Ga0307413_11278635 | 3300031824 | Bacteria | 641 |
| 372 | Ga0307413_11706552 | 3300031824 | Unclassified | 562 |
| 373 | Ga0307413_12142709 | 3300031824 | Bacteria | 506 |
| 374 | Ga0307410_11039893 | 3300031852 | Bacteria | 708 |
| 375 | Ga0307410_11204030 | 3300031852 | Bacteria | 660 |
| 376 | Ga0307410_11892514 | 3300031852 | Unclassified | 531 |
| 377 | Ga0307406_10088574 | 3300031901 | Bacteria | 2077 |
| 378 | Ga0307406_10191217 | 3300031901 | Bacteria | 1498 |
| 379 | Ga0307406_11137253 | 3300031901 | Bacteria | 676 |
| 380 | Ga0307407_10105628 | 3300031903 | Bacteria | 1757 |
| 381 | Ga0307407_10425417 | 3300031903 | Bacteria | 958 |
| 382 | Ga0307407_11541064 | 3300031903 | Bacteria | 526 |
| 383 | Ga0307412_10332287 | 3300031911 | Unclassified | 1213 |
| 384 | Ga0307412_10378723 | 3300031911 | Bacteria | 1145 |
| 385 | Ga0307412_10640290 | 3300031911 | Bacteria | 905 |
| 386 | Ga0307409_100410631 | 3300031995 | Bacteria | 1296 |
| 387 | Ga0307409_100586330 | 3300031995 | Bacteria | 1100 |
| 388 | Ga0307409_100811134 | 3300031995 | Bacteria | 944 |
| 389 | Ga0307409_101015425 | 3300031995 | Bacteria | 848 |
| 390 | Ga0307409_101580431 | 3300031995 | Bacteria | 684 |
| 391 | Ga0307409_101901164 | 3300031995 | Bacteria | 625 |
| 392 | Ga0307416_100008497 | 3300032002 | Bacteria | 6633 |
| 393 | Ga0307416_100034119 | 3300032002 | Unclassified | 3868 |
| 394 | Ga0307416_100144668 | 3300032002 | Bacteria | 2168 |
| 395 | Ga0307416_100567721 | 3300032002 | Unclassified | 1210 |
| 396 | Ga0307416_101025052 | 3300032002 | Unclassified | 929 |
| 397 | Ga0307416_103709468 | 3300032002 | Unclassified | 511 |
| 398 | Ga0307414_10130948 | 3300032004 | Bacteria | 1947 |
| 399 | Ga0307411_10003896 | 3300032005 | Bacteria | 7036 |
| 400 | Ga0307411_10146191 | 3300032005 | Archaea | 1750 |
| 401 | Ga0307411_10485379 | 3300032005 | Bacteria | 1041 |
| 402 | Ga0307411_10494413 | 3300032005 | Bacteria | 1033 |
| 403 | Ga0307411_10726025 | 3300032005 | Unclassified | 868 |
| 404 | Ga0307411_11008001 | 3300032005 | Bacteria | 746 |
| 405 | Ga0307411_11909086 | 3300032005 | Bacteria | 553 |
| 406 | Ga0307415_100070743 | 3300032126 | Unclassified | 2451 |
| 407 | Ga0307415_100791876 | 3300032126 | Bacteria | 864 |
| 408 | Ga0373930_0186793 | 3300034816 | Bacteria | 534 |
| 409 | Ga0373958_0129588 | 3300034819 | Unclassified | 616 |
| 410 | Ga0373959_0014428 | 3300034820 | Bacteria | 1438 |
| 411 | Ga0373926_0046374 | 3300035083 | Bacteria | 1559 |
| 412 | Ga0373929_0053848 | 3300035085 | Bacteria | 926 |
| 413 | Ga0373940_0060862 | 3300035088 | Bacteria | 1080 |
| 414 | Ga0373944_0045344 | 3300035089 | Bacteria | 1372 |
| 415 | Ga0373941_0305604 | 3300035115 | Bacteria | 636 |
| 416 | Ga0373960_0060413 | 3300035121 | Bacteria | 1149 |
| 417 | Ga0373943_0141942 | 3300035170 | Unclassified | 1295 |
| 418 | Ga0373946_0321930 | 3300035171 | Bacteria | 768 |
| 419 | Ga0373955_0746693 | 3300035172 | Bacteria | 601 |
| 420 | Ga0373942_0167540 | 3300035207 | Bacteria | 714 |
| 421 | Ga0373931_0161719 | 3300035691 | Bacteria | 1313 |
| 422 | Ga0373931_0590058 | 3300035691 | Bacteria | 725 |
| 423 | Ga0373935_0244852 | 3300035692 | Bacteria | 1253 |
| 424 | Ga0373935_0869004 | 3300035692 | Bacteria | 667 |
| 425 | Ga0373933_0047765 | 3300035724 | Bacteria | 2547 |
| 426 | Ga0373933_0371422 | 3300035724 | Unclassified | 931 |
| 427 | Ga0373947_0626472 | 3300035725 | Bacteria | 733 |
| 428 | Ga0373937_0058112 | 3300036401 | Bacteria | 3553 |
| 429 | Ga0373937_0064114 | 3300036401 | Bacteria | 3380 |
| 430 | Ga0373925_0095224 | 3300037068 | Bacteria | 2280 |
| 431 | Ga0373925_1318097 | 3300037068 | Bacteria | 592 |
| 432 | Ga0439453_0027317 | 3300041408 | Unclassified | 1062 |
| 433 | Ga0451807_1884642 | 3300041486 | Bacteria | 852 |
| 434 | Ga0451853_3503131 | 3300041512 | Bacteria | 1022 |
| 435 | Ga0439450_008296 | 3300042008 | Bacteria | 1935 |
| 436 | Ga0450890_090191 | 3300042127 | Unclassified | 508 |
| 437 | Ga0439446_0037412 | 3300042156 | Bacteria | 1420 |
| 438 | Ga0439446_0100387 | 3300042156 | Unclassified | 915 |
| 439 | Ga0439446_0341363 | 3300042156 | Bacteria | 532 |
| 440 | Ga0439435_0122703 | 3300042436 | Bacteria | 815 |
| 441 | Ga0439444_0019270 | 3300042437 | Bacteria | 1189 |
| 442 | Ga0439444_0170571 | 3300042437 | Unclassified | 536 |
| 443 | Ga0439464_0000364 | 3300042439 | Bacteria | 8810 |
| 444 | Ga0439460_0025770 | 3300042461 | Unclassified | 1640 |
| 445 | Ga0439460_0065914 | 3300042461 | Bacteria | 1113 |
| 446 | Ga0451577_1440980 | 3300042876 | Unclassified | 610 |
| 447 | Ga0451576_0271573 | 3300045051 | Unclassified | 1773 |
| 448 | Ga0466967_0055727 | 3300045976 | Bacteria | 3483 |
| 449 | Ga0466967_1298342 | 3300045976 | Bacteria | 725 |
| 450 | Ga0495580_0228182 | 3300046472 | Bacteria | 1279 |
| 451 | Ga0495608_0258654 | 3300046511 | Bacteria | 1084 |
| 452 | Ga0495643_0004737 | 3300046522 | Bacteria | 9411 |
| 453 | Ga0495598_0303022 | 3300046537 | Bacteria | 605 |
| 454 | Ga0495623_0107631 | 3300046679 | Bacteria | 1693 |
| 455 | Ga0495658_0792196 | 3300046683 | Unclassified | 607 |
| 456 | Ga0495674_0098480 | 3300047319 | Bacteria | 2490 |
| 457 | Ga0496100_0085415 | 3300048903 | Unclassified | 2142 |
| 458 | Ga0496101_0336461 | 3300048904 | Unclassified | 1185 |
| 459 | Ga0496102_0021433 | 3300048905 | Bacteria | 5714 |
| 460 | Ga0496102_0211340 | 3300048905 | Bacteria | 1829 |
| 461 | Ga0496103_0382415 | 3300048906 | Unclassified | 904 |
| 462 | Ga0496104_0615527 | 3300048907 | Unclassified | 996 |
| 463 | Ga0496106_1194720 | 3300048909 | Bacteria | 593 |
| 464 | Ga0496106_1247154 | 3300048909 | Unclassified | 578 |
| 465 | Ga0496107_0377844 | 3300048910 | Bacteria | 1054 |
| 466 | Ga0496109_0371395 | 3300048912 | Unclassified | 1351 |
| 467 | Ga0496112_0190408 | 3300048915 | Unclassified | 2013 |
| 468 | Ga0501307_087270 | 3300049162 | Unclassified | 517 |
| 469 | Ga0501291_120187 | 3300049514 | Unclassified | 569 |
| 470 | Ga0501292_124425 | 3300049515 | Bacteria | 528 |
| 471 | Ga0501315_075279 | 3300049531 | Bacteria | 566 |
| 472 | Ga0501317_070841 | 3300049533 | Unclassified | 588 |
| 473 | Ga0501320_016867 | 3300049536 | Unclassified | 812 |
| 474 | Ga0501320_068540 | 3300049536 | Unclassified | 510 |
| 475 | Ga0501325_059341 | 3300049541 | Unclassified | 502 |
| 476 | Ga0501336_035427 | 3300049552 | Unclassified | 504 |
| 477 | Ga0501031_0398281 | 3300049568 | Bacteria | 890 |
| 478 | Ga0501032_0136983 | 3300049569 | Bacteria | 1613 |
| 479 | Ga0501032_0262937 | 3300049569 | Bacteria | 1119 |
| 480 | Ga0501032_0799288 | 3300049569 | Bacteria | 596 |
| 481 | Ga0501033_0037831 | 3300049570 | Unclassified | 3610 |
| 482 | Ga0501033_0466515 | 3300049570 | Bacteria | 876 |
| 483 | Ga0501034_0510183 | 3300049571 | Bacteria | 1115 |
| 484 | Ga0501034_0852450 | 3300049571 | Unclassified | 801 |
| 485 | Ga0501036_0297063 | 3300049572 | Bacteria | 1351 |
| 486 | Ga0501036_0352694 | 3300049572 | Bacteria | 1228 |
| 487 | Ga0501036_0505386 | 3300049572 | Bacteria | 1006 |
| 488 | Ga0501036_0648444 | 3300049572 | Bacteria | 874 |
| 489 | Ga0501036_0842566 | 3300049572 | Bacteria | 754 |
| 490 | Ga0501036_0852614 | 3300049572 | Bacteria | 749 |
| 491 | Ga0501037_0130313 | 3300049573 | Bacteria | 1803 |
| 492 | Ga0501037_0246983 | 3300049573 | Unclassified | 1250 |
| 493 | Ga0501037_0249700 | 3300049573 | Bacteria | 1242 |
| 494 | Ga0501038_0009435 | 3300049574 | Bacteria | 8955 |
| 495 | Ga0501038_0094176 | 3300049574 | Bacteria | 2504 |
| 496 | Ga0501038_0124901 | 3300049574 | Bacteria | 2119 |
| 497 | Ga0501038_1032408 | 3300049574 | Unclassified | 602 |
| 498 | Ga0501039_0219881 | 3300049575 | Bacteria | 1493 |
| 499 | Ga0501039_0304233 | 3300049575 | Bacteria | 1253 |
| 500 | Ga0501039_0405841 | 3300049575 | Bacteria | 1070 |
| 501 | Ga0501039_1408506 | 3300049575 | Bacteria | 536 |
| 502 | Ga0501040_0050995 | 3300049576 | Bacteria | 2831 |
| 503 | Ga0501040_0070321 | 3300049576 | Bacteria | 2415 |
| 504 | Ga0501040_0073049 | 3300049576 | Bacteria | 2370 |
| 505 | Ga0501040_0094101 | 3300049576 | Bacteria | 2084 |
| 506 | Ga0501040_0566535 | 3300049576 | Bacteria | 820 |
| 507 | Ga0501040_0793171 | 3300049576 | Bacteria | 685 |
| 508 | Ga0501041_0098512 | 3300049577 | Bacteria | 1808 |
| 509 | Ga0501041_0123754 | 3300049577 | Bacteria | 1608 |
| 510 | Ga0501041_0221188 | 3300049577 | Bacteria | 1188 |
| 511 | Ga0501041_0335943 | 3300049577 | Unclassified | 954 |
| 512 | Ga0501042_0024011 | 3300049578 | Bacteria | 4273 |
| 513 | Ga0501042_0030726 | 3300049578 | Bacteria | 3797 |
| 514 | Ga0501042_0137724 | 3300049578 | Bacteria | 1759 |
| 515 | Ga0501042_0275207 | 3300049578 | Bacteria | 1215 |
| 516 | Ga0501042_0526228 | 3300049578 | Bacteria | 859 |
| 517 | Ga0501043_0176076 | 3300049579 | Bacteria | 1667 |
| 518 | Ga0501043_1017564 | 3300049579 | Bacteria | 589 |
| 519 | Ga0501046_0128112 | 3300049580 | Bacteria | 1926 |
| 520 | Ga0501046_0417076 | 3300049580 | Bacteria | 968 |
| 521 | Ga0501046_0915643 | 3300049580 | Unclassified | 611 |
| 522 | Ga0501048_0011907 | 3300049582 | Bacteria | 6486 |
| 523 | Ga0501048_0221789 | 3300049582 | Bacteria | 1341 |
| 524 | Ga0501048_0305345 | 3300049582 | Bacteria | 1132 |
| 525 | Ga0501048_0487102 | 3300049582 | Bacteria | 884 |
| 526 | Ga0501067_0876513 | 3300049583 | Bacteria | 506 |
| 527 | Ga0501068_0113168 | 3300049584 | Bacteria | 1688 |
| 528 | Ga0501068_0173190 | 3300049584 | Unclassified | 1363 |
| 529 | Ga0501068_0280858 | 3300049584 | Bacteria | 1064 |
| 530 | Ga0501068_0512608 | 3300049584 | Bacteria | 778 |
| 531 | Ga0501069_0095340 | 3300049585 | Bacteria | 1685 |
| 532 | Ga0501070_0591540 | 3300049586 | Bacteria | 885 |
| 533 | Ga0501070_0766282 | 3300049586 | Bacteria | 760 |
| 534 | Ga0501070_0933660 | 3300049586 | Bacteria | 675 |
| 535 | Ga0501071_0028350 | 3300049587 | Bacteria | 3946 |
| 536 | Ga0501071_0032321 | 3300049587 | Bacteria | 3715 |
| 537 | Ga0501071_0095385 | 3300049587 | Bacteria | 2189 |
| 538 | Ga0501071_0123590 | 3300049587 | Bacteria | 1919 |
| 539 | Ga0501071_0221483 | 3300049587 | Bacteria | 1424 |
| 540 | Ga0501071_0386993 | 3300049587 | Unclassified | 1067 |
| 541 | Ga0501071_0571381 | 3300049587 | Bacteria | 869 |
| 542 | Ga0501072_0022761 | 3300049588 | Unclassified | 4863 |
| 543 | Ga0501072_0023578 | 3300049588 | Bacteria | 4780 |
| 544 | Ga0501072_0036993 | 3300049588 | Bacteria | 3829 |
| 545 | Ga0501072_0104486 | 3300049588 | Bacteria | 2252 |
| 546 | Ga0501072_0294765 | 3300049588 | Bacteria | 1289 |
| 547 | Ga0501072_0377538 | 3300049588 | Bacteria | 1125 |
| 548 | Ga0501072_0549188 | 3300049588 | Unclassified | 912 |
| 549 | Ga0501072_1283760 | 3300049588 | Bacteria | 568 |
| 550 | Ga0501072_1411048 | 3300049588 | Bacteria | 538 |
| 551 | Ga0501073_0169741 | 3300049589 | Bacteria | 1510 |
| 552 | Ga0501074_0113658 | 3300049590 | Unclassified | 1937 |
| 553 | Ga0501074_0181534 | 3300049590 | Bacteria | 1501 |
| 554 | Ga0501074_0240857 | 3300049590 | Bacteria | 1286 |
| 555 | Ga0501074_0730496 | 3300049590 | Bacteria | 698 |
| 556 | Ga0501074_0996783 | 3300049590 | Bacteria | 589 |
| 557 | Ga0501075_0021328 | 3300049591 | Bacteria | 4721 |
| 558 | Ga0501075_0089005 | 3300049591 | Bacteria | 2341 |
| 559 | Ga0501075_0089646 | 3300049591 | Bacteria | 2332 |
| 560 | Ga0501075_0331633 | 3300049591 | Bacteria | 1159 |
| 561 | Ga0501075_0374526 | 3300049591 | Bacteria | 1085 |
| 562 | Ga0501075_0386527 | 3300049591 | Unclassified | 1067 |
| 563 | Ga0501075_0447170 | 3300049591 | Unclassified | 985 |
| 564 | Ga0501075_0456807 | 3300049591 | Bacteria | 974 |
| 565 | Ga0501075_1301308 | 3300049591 | Unclassified | 551 |
| 566 | Ga0501075_1321447 | 3300049591 | Bacteria | 546 |
| 567 | Ga0501076_0007570 | 3300049592 | Bacteria | 7905 |
| 568 | Ga0501076_0070349 | 3300049592 | Bacteria | 2797 |
| 569 | Ga0501076_0070593 | 3300049592 | Bacteria | 2793 |
| 570 | Ga0501076_0312162 | 3300049592 | Bacteria | 1289 |
| 571 | Ga0501076_0414499 | 3300049592 | Bacteria | 1108 |
| 572 | Ga0501076_0563972 | 3300049592 | Unclassified | 939 |
| 573 | Ga0501076_0656598 | 3300049592 | Bacteria | 865 |
| 574 | Ga0501076_0659909 | 3300049592 | Bacteria | 863 |
| 575 | Ga0501076_1560875 | 3300049592 | Unclassified | 542 |
| 576 | Ga0501077_0017907 | 3300049593 | Bacteria | 4477 |
| 577 | Ga0501077_0168697 | 3300049593 | Bacteria | 1391 |
| 578 | Ga0501077_0974141 | 3300049593 | Bacteria | 546 |
| 579 | Ga0501077_0991248 | 3300049593 | Bacteria | 541 |
| 580 | Ga0501077_1067156 | 3300049593 | Unclassified | 520 |
| 581 | Ga0501202_037547 | 3300049652 | Bacteria | 1035 |
| 582 | Ga0501217_124934 | 3300049661 | Bacteria | 750 |
| 583 | Ga0501233_004398 | 3300049668 | Bacteria | 2583 |
| 584 | Ga0501233_035892 | 3300049668 | Bacteria | 1144 |
| 585 | Ga0501233_215021 | 3300049668 | Unclassified | 565 |
| 586 | Ga0501235_080697 | 3300049669 | Unclassified | 777 |
| 587 | Ga0501253_020253 | 3300049683 | Bacteria | 1158 |
| 588 | Ga0501253_181581 | 3300049683 | Bacteria | 547 |
| 589 | Ga0501257_264677 | 3300049686 | Bacteria | 513 |
| 590 | Ga0501261_090950 | 3300049690 | Bacteria | 567 |
| 591 | Ga0501079_0046585 | 3300049741 | Bacteria | 3345 |
| 592 | Ga0501079_0058797 | 3300049741 | Unclassified | 2967 |
| 593 | Ga0501079_0166920 | 3300049741 | Bacteria | 1717 |
| 594 | Ga0501079_0240103 | 3300049741 | Bacteria | 1416 |
| 595 | Ga0501079_0365818 | 3300049741 | Bacteria | 1130 |
| 596 | Ga0501079_1096589 | 3300049741 | Bacteria | 627 |
| 597 | Ga0501080_0078012 | 3300049742 | Unclassified | 3081 |
| 598 | Ga0501080_0285673 | 3300049742 | Bacteria | 1499 |
| 599 | Ga0501080_0379381 | 3300049742 | Bacteria | 1274 |
| 600 | Ga0501080_0381690 | 3300049742 | Bacteria | 1270 |
| 601 | Ga0501080_0704649 | 3300049742 | Bacteria | 890 |
| 602 | Ga0501080_0834846 | 3300049742 | Unclassified | 806 |
| 603 | Ga0501081_0060981 | 3300049743 | Bacteria | 2615 |
| 604 | Ga0501081_0064916 | 3300049743 | Bacteria | 2536 |
| 605 | Ga0501081_0304896 | 3300049743 | Bacteria | 1168 |
| 606 | Ga0501081_0695607 | 3300049743 | Bacteria | 763 |
| 607 | Ga0501081_0707577 | 3300049743 | Unclassified | 756 |
| 608 | Ga0501081_1428890 | 3300049743 | Bacteria | 525 |
| 609 | Ga0501081_1472265 | 3300049743 | Unclassified | 517 |
| 610 | Ga0501083_0152024 | 3300049744 | Bacteria | 1515 |
| 611 | Ga0501083_0344309 | 3300049744 | Bacteria | 969 |
| 612 | Ga0501083_0489865 | 3300049744 | Unclassified | 800 |
| 613 | Ga0501083_0598374 | 3300049744 | Bacteria | 717 |
| 614 | Ga0501266_038921 | 3300049763 | Unclassified | 702 |
| 615 | Ga0501270_126691 | 3300049767 | Unclassified | 561 |
| 616 | Ga0501272_043042 | 3300049769 | Bacteria | 608 |
| 617 | Ga0501273_058508 | 3300049770 | Unclassified | 603 |
| 618 | Ga0501283_014362 | 3300049779 | Bacteria | 1209 |
| 619 | Ga0501035_0110640 | 3300049822 | Unclassified | 2407 |
| 620 | Ga0501035_0321204 | 3300049822 | Bacteria | 1301 |
| 621 | Ga0501044_0820280 | 3300049823 | Bacteria | 808 |
| 622 | Ga0501045_0043317 | 3300049824 | Bacteria | 3277 |
| 623 | Ga0501045_0104700 | 3300049824 | Bacteria | 2096 |
| 624 | Ga0501045_0278838 | 3300049824 | Bacteria | 1244 |
| 625 | Ga0501045_0292477 | 3300049824 | Bacteria | 1212 |
| 626 | Ga0501045_0319493 | 3300049824 | Bacteria | 1155 |
| 627 | Ga0501045_0324579 | 3300049824 | Bacteria | 1145 |
| 628 | Ga0501045_0397317 | 3300049824 | Bacteria | 1026 |
| 629 | Ga0501045_1420180 | 3300049824 | Bacteria | 504 |
| 630 | Ga0501204_076236 | 3300049850 | Bacteria | 562 |
| 631 | Ga0501212_100948 | 3300049851 | Bacteria | 542 |
| 632 | nmdc:mga06z11_549999_c1 | 3300050494 | Bacteria | 701 |
| 633 | nmdc:mga04h51_176098_c1 | 3300050495 | Bacteria | 830 |
| 634 | nmdc:mga05p37_1200596_c1 | 3300050507 | Unclassified | 784 |
| 635 | nmdc:mga05p37_1431_c1 | 3300050507 | Bacteria | 27718 |
| 636 | nmdc:mga05p37_14385_c1 | 3300050507 | Bacteria | 9501 |
| 637 | nmdc:mga05p37_32181_c1 | 3300050507 | Bacteria | 6413 |
| 638 | nmdc:mga05p37_35887_c1 | 3300050507 | Bacteria | 6083 |
| 639 | nmdc:mga05p37_546212_c1 | 3300050507 | Bacteria | 1320 |
| 640 | nmdc:mga05p37_670474_c1 | 3300050507 | Bacteria | 1158 |
| 641 | nmdc:mga05p37_7701_c1 | 3300050507 | Bacteria | 12708 |
| 642 | nmdc:mga05p37_7758_c1 | 3300050507 | Bacteria | 12668 |
| 643 | nmdc:mga09592_134896_c1 | 3300050508 | Bacteria | 2126 |
| 644 | nmdc:mga09592_279956_c1 | 3300050508 | Bacteria | 1447 |
| 645 | nmdc:mga09592_572762_c1 | 3300050508 | Unclassified | 969 |
| 646 | nmdc:mga0qj67_2107_c1 | 3300050509 | Bacteria | 14176 |
| 647 | nmdc:mga0qj67_22280_c1 | 3300050509 | Unclassified | 4866 |
| 648 | nmdc:mga0qj67_49170_c1 | 3300050509 | Bacteria | 3333 |
| 649 | nmdc:mga0qj67_633558_c1 | 3300050509 | Unclassified | 854 |
| 650 | nmdc:mga06r32_102832_c1 | 3300050510 | Bacteria | 2805 |
| 651 | nmdc:mga06r32_148304_c1 | 3300050510 | Bacteria | 2323 |
| 652 | nmdc:mga06r32_50060_c1 | 3300050510 | Unclassified | 3996 |
| 653 | nmdc:mga06r32_503177_c1 | 3300050510 | Bacteria | 1188 |
| 654 | nmdc:mga06r32_660984_c1 | 3300050510 | Unclassified | 1013 |
| 655 | nmdc:mga08y16_159524_c1 | 3300050511 | Bacteria | 2343 |
| 656 | nmdc:mga08y16_1714413_c1 | 3300050511 | Bacteria | 583 |
| 657 | nmdc:mga08y16_1864_c1 | 3300050511 | Bacteria | 21429 |
| 658 | nmdc:mga08y16_453603_c1 | 3300050511 | Bacteria | 1307 |
| 659 | nmdc:mga0n895_65852_c1 | 3300050512 | Bacteria | 3587 |
| 660 | nmdc:mga0n895_72520_c1 | 3300050512 | Bacteria | 3416 |
| 661 | nmdc:mga0rr50_136675_c1 | 3300050513 | Bacteria | 1968 |
| 662 | nmdc:mga0rr50_40565_c1 | 3300050513 | Bacteria | 3386 |
| 663 | nmdc:mga08x19_436031_c1 | 3300050514 | Bacteria | 921 |
| 664 | nmdc:mga0a205_174852_c1 | 3300050515 | Unclassified | 2043 |
| 665 | nmdc:mga0a205_299359_c1 | 3300050515 | Bacteria | 1482 |
| 666 | nmdc:mga0a205_41857_c1 | 3300050515 | Bacteria | 4413 |
| 667 | nmdc:mga0a205_87169_c1 | 3300050515 | Unclassified | 3016 |
| 668 | Ga0495601_0229237 | 3300053077 | Bacteria | 1213 |
| 669 | Ga0495595_0292068 | 3300053084 | Bacteria | 819 |
| 670 | Ga0495619_1050087 | 3300053085 | Unclassified | 543 |
| 671 | Ga0501084_0069837 | 3300054114 | Bacteria | 2941 |
| 672 | Ga0501084_0110725 | 3300054114 | Bacteria | 2307 |
| 673 | Ga0501084_0231060 | 3300054114 | Bacteria | 1561 |
| 674 | Ga0501084_0295201 | 3300054114 | Bacteria | 1369 |
| 675 | Ga0501084_0545694 | 3300054114 | Bacteria | 979 |
| 676 | Ga0501084_1589235 | 3300054114 | Unclassified | 547 |
| 677 | Ga0501084_1811598 | 3300054114 | Unclassified | 510 |
| 678 | Ga0590071_001774 | 3300059421 | Bacteria | 5571 |
| 679 | Ga0590071_011932 | 3300059421 | Bacteria | 2036 |
| 680 | Ga0590071_087786 | 3300059421 | Bacteria | 777 |
| 681 | Ga0590075_000359 | 3300059424 | Bacteria | 12620 |
| 682 | Ga0590075_110226 | 3300059424 | Unclassified | 718 |
| 683 | Ga0590075_202660 | 3300059424 | Bacteria | 525 |
| 684 | Ga0590077_000171 | 3300059426 | Bacteria | 18248 |
| 685 | Ga0587085_128548 | 3300059506 | Unclassified | 564 |
| 686 | Ga0587085_183651 | 3300059506 | Bacteria | 503 |
| 687 | Ga0587091_086180 | 3300059511 | Unclassified | 714 |
| 688 | Ga0587092_131636 | 3300059512 | Unclassified | 544 |
| 689 | Ga0587128_002469 | 3300059630 | Bacteria | 1931 |
| 690 | Ga0587062_055428 | 3300059639 | Bacteria | 682 |
| 691 | Ga0587072_138063 | 3300059643 | Unclassified | 579 |
| 692 | Ga0587107_019575 | 3300059652 | Unclassified | 930 |
| 693 | Ga0587119_052555 | 3300059658 | Unclassified | 612 |
| 694 | Ga0587111_0268034 | 3300060346 | Unclassified | 511 |
| 695 | Ga0501082_0055453 | 3300060353 | Bacteria | 3414 |
| 696 | Ga0501082_0076768 | 3300060353 | Bacteria | 2880 |
| 697 | Ga0501082_0120235 | 3300060353 | Bacteria | 2277 |
| 698 | Ga0501082_0181271 | 3300060353 | Unclassified | 1832 |
| 699 | Ga0501082_0370686 | 3300060353 | Bacteria | 1249 |
| 700 | Ga0501082_1343288 | 3300060353 | Bacteria | 624 |
| 701 | Ga0530510_0032053 | 3300061734 | Bacteria | 3779 |
| 702 | Ga0530510_0066105 | 3300061734 | Bacteria | 2621 |
| 703 | Ga0530510_0391043 | 3300061734 | Bacteria | 1047 |
| 704 | Ga0530510_0444900 | 3300061734 | Bacteria | 979 |
| 705 | Ga0530510_0467460 | 3300061734 | Bacteria | 954 |
| 706 | Ga0530510_0572667 | 3300061734 | Bacteria | 858 |
| 707 | Ga0530510_0641764 | 3300061734 | Unclassified | 808 |
| 708 | Ga0114129_10000108 | |||
| 709 | JGI24751J29686_10022043 | |||
| 710 | rootL2_10084844 | |||
| 711 | Ga0007429J51699_1031697 | |||
| 712 | Ga0032354_1023873 | |||
| 713 | Ga0032354_1069567 | |||
| 714 | Ga0058863_11770274 | |||
| 715 | Ga0058860_10038317 | |||
| 716 | Ga0058860_12191695 | |||
| 717 | Ga0065715_10016006 | |||
| 718 | Ga0065715_11187906 | |||
| 719 | Ga0065707_10191511 | |||
| 720 | Ga0065707_10444521 | |||
| 721 | Ga0070676_10171884 | |||
| 722 | Ga0070683_101037738 | |||
| 723 | Ga0070690_100061669 | |||
| 724 | Ga0070690_100201567 | |||
| 725 | Ga0070690_100219113 | |||
| 726 | Ga0070677_10162402 | |||
| 727 | Ga0070677_10246974 | |||
| 728 | Ga0068869_100001674 | |||
| 729 | Ga0068869_100410367 | |||
| 730 | Ga0070666_10707800 | |||
| 731 | Ga0070666_10974504 | |||
| 732 | Ga0070680_100080493 | |||
| 733 | Ga0070680_101437142 | |||
| 734 | Ga0070682_100774650 | |||
| 735 | Ga0070682_100993087 | |||
| 736 | Ga0070682_101683982 | |||
| 737 | Ga0068868_100660301 | |||
| 738 | Ga0068868_100815873 | |||
| 739 | Ga0070660_100396098 | |||
| 740 | Ga0070660_100421828 | |||
| 741 | Ga0070689_100197218 | |||
| 742 | Ga0070689_101287585 | |||
| 743 | Ga0070691_10084898 | |||
| 744 | Ga0070691_10312296 | |||
| 745 | Ga0070691_10352081 | |||
| 746 | Ga0070687_100005613 | |||
| 747 | Ga0070687_100032707 | |||
| 748 | Ga0070661_100250350 | |||
| 749 | Ga0070661_101120393 | |||
| 750 | Ga0070661_101125079 | |||
| 751 | Ga0070692_10438670 | |||
| 752 | Ga0070668_100544169 | |||
| 753 | Ga0070669_100059046 | |||
| 754 | Ga0070669_100095918 | |||
| 755 | Ga0070675_100003298 | |||
| 756 | Ga0070675_100462629 | |||
| 757 | Ga0070675_101165299 | |||
| 758 | Ga0070671_100003192 | |||
| 759 | Ga0070671_100125111 | |||
| 760 | Ga0070674_100061558 | |||
| 761 | Ga0070673_100007029 | |||
| 762 | Ga0070673_100008047 | |||
| 763 | Ga0070673_100030664 | |||
| 764 | Ga0070673_100348703 | |||
| 765 | Ga0070659_100030095 | |||
| 766 | Ga0070659_100734893 | |||
| 767 | Ga0070667_101298210 | |||
| 768 | Ga0070709_10395092 | |||
| 769 | Ga0070709_10737456 | |||
| 770 | Ga0070713_100010625 | |||
| 771 | Ga0070713_100660089 | |||
| 772 | Ga0070701_10140980 | |||
| 773 | Ga0070701_10663021 | |||
| 774 | Ga0070711_101124712 | |||
| 775 | Ga0070705_100039072 | |||
| 776 | Ga0070700_100023523 | |||
| 777 | Ga0070700_101115243 | |||
| 778 | Ga0070700_101809435 | |||
| 779 | Ga0070694_101705383 | |||
| 780 | Ga0070663_101129575 | |||
| 781 | Ga0070678_100027465 | |||
| 782 | Ga0070678_101103254 | |||
| 783 | Ga0070662_100322602 | |||
| 784 | Ga0070662_100909011 | |||
| 785 | Ga0070681_10016257 | |||
| 786 | Ga0070681_10058263 | |||
| 787 | Ga0070681_10364088 | |||
| 788 | Ga0068867_100001597 | |||
| 789 | Ga0068867_100039709 | |||
| 790 | Ga0070685_10297435 | |||
| 791 | Ga0070706_100353372 | |||
| 792 | Ga0070707_100025801 | |||
| 793 | Ga0070707_100356585 | |||
| 794 | Ga0070698_100091463 | |||
| 795 | Ga0070698_100435061 | |||
| 796 | Ga0070698_100522805 | |||
| 797 | Ga0070699_101528832 | |||
| 798 | Ga0070699_101631306 | |||
| 799 | Ga0070679_100108978 | |||
| 800 | Ga0070697_100058323 | |||
| 801 | Ga0070697_101530310 | |||
| 802 | Ga0068853_100933488 | |||
| 803 | Ga0068853_102477963 | |||
| 804 | Ga0070672_100001819 | |||
| 805 | Ga0070672_100018874 | |||
| 806 | Ga0070672_100162737 | |||
| 807 | Ga0070686_100042129 | |||
| 808 | Ga0070686_100062156 | |||
| 809 | Ga0070686_100173598 | |||
| 810 | Ga0070695_100230477 | |||
| 811 | Ga0070695_100236216 | |||
| 812 | Ga0070695_100593218 | |||
| 813 | Ga0070695_101629377 | |||
| 814 | Ga0070696_101083633 | |||
| 815 | Ga0070693_100073368 | |||
| 816 | Ga0070693_100098783 | |||
| 817 | Ga0070665_101201309 | |||
| 818 | Ga0070704_100249258 | |||
| 819 | Ga0068855_100121726 | |||
| 820 | Ga0070664_100021383 | |||
| 821 | Ga0068857_100433049 | |||
| 822 | Ga0068857_100445299 | |||
| 823 | Ga0068854_100280881 | |||
| 824 | Ga0068854_100363515 | |||
| 825 | Ga0068856_100867038 | |||
| 826 | Ga0068856_101986975 | |||
| 827 | Ga0070702_100006598 | |||
| 828 | Ga0070702_100078746 | |||
| 829 | Ga0068852_101720111 | |||
| 830 | Ga0068859_100036569 | |||
| 831 | Ga0068859_100291034 | |||
| 832 | Ga0068864_100183871 | |||
| 833 | Ga0068864_100291514 | |||
| 834 | Ga0068864_100350842 | |||
| 835 | Ga0068866_10280122 | |||
| 836 | Ga0068861_100301086 | |||
| 837 | Ga0068861_100403355 | |||
| 838 | Ga0068861_102534306 | |||
| 839 | Ga0068870_10172997 | |||
| 840 | Ga0068870_10208516 | |||
| 841 | Ga0068863_100225097 | |||
| 842 | Ga0068863_102389584 | |||
| 843 | Ga0068858_100031356 | |||
| 844 | Ga0068860_100039032 | |||
| 845 | Ga0068860_100376546 | |||
| 846 | Ga0068862_101510654 | |||
| 847 | Ga0081538_10104394 | |||
| 848 | Ga0081538_10265635 | |||
| 849 | Ga0081538_10358995 | |||
| 850 | Ga0070716_101561458 | |||
| 851 | Ga0075367_10388341 | |||
| 852 | Ga0097621_100411119 | |||
| 853 | Ga0068871_100213179 | |||
| 854 | Ga0068871_100534694 | |||
| 855 | Ga0075428_100002414 | |||
| 856 | Ga0075428_100012091 | |||
| 857 | Ga0075428_100013706 | |||
| 858 | Ga0075430_100005581 | |||
| 859 | Ga0075430_100055669 | |||
| 860 | Ga0075430_100073011 | |||
| 861 | Ga0075430_100685456 | |||
| 862 | Ga0075430_100803468 | |||
| 863 | Ga0075430_101518730 | |||
| 864 | Ga0075431_100037021 | |||
| 865 | Ga0075431_100052713 | |||
| 866 | Ga0075431_100089620 | |||
| 867 | Ga0075431_100119432 | |||
| 868 | Ga0075431_100956950 | |||
| 869 | Ga0075433_10012184 | |||
| 870 | Ga0075433_10032242 | |||
| 871 | Ga0075433_10167145 | |||
| 872 | Ga0075433_10179068 | |||
| 873 | Ga0075434_100053167 | |||
| 874 | Ga0075434_100190575 | |||
| 875 | Ga0075434_100281975 | |||
| 876 | Ga0075434_100380259 | |||
| 877 | Ga0075434_100438355 | |||
| 878 | Ga0075429_100004168 | |||
| 879 | Ga0075429_100028977 | |||
| 880 | Ga0075429_100200964 | |||
| 881 | Ga0068865_100024604 | |||
| 882 | Ga0068865_100237179 | |||
| 883 | Ga0075436_100458265 | |||
| 884 | Ga0097620_100036568 | |||
| 885 | Ga0097620_100291031 | |||
| 886 | Ga0075435_100002272 | |||
| 887 | Ga0075435_100061311 | |||
| 888 | Ga0075435_100191544 | |||
| 889 | Ga0105240_10282156 | |||
| 890 | Ga0105240_10650625 | |||
| 891 | Ga0111539_10002069 | |||
| 892 | Ga0111539_10190074 | |||
| 893 | Ga0111539_11444706 | |||
| 894 | Ga0111539_11762540 | |||
| 895 | Ga0111539_11905564 | |||
| 896 | Ga0111539_12185067 | |||
| 897 | Ga0111539_12819318 | |||
| 898 | Ga0111539_13402790 | |||
| 899 | Ga0105245_10102895 | |||
| 900 | Ga0105245_10909590 | |||
| 901 | Ga0105247_10745339 | |||
| 902 | Ga0114129_10001729 | |||
| 903 | Ga0114129_10006049 | |||
| 904 | Ga0114129_10014363 | |||
| 905 | Ga0114129_10045184 | |||
| 906 | Ga0114129_10069154 | |||
| 907 | Ga0114129_10660749 | |||
| 908 | Ga0114129_10674367 | |||
| 909 | Ga0114129_11051161 | |||
| 910 | Ga0114129_12329636 | |||
| 911 | Ga0105243_10023921 | |||
| 912 | Ga0105243_10861816 | |||
| 913 | Ga0105243_10880381 | |||
| 914 | Ga0105241_10032705 | |||
| 915 | Ga0105241_10378402 | |||
| 916 | Ga0105242_10004553 | |||
| 917 | Ga0105242_10031487 | |||
| 918 | Ga0105248_10141249 | |||
| 919 | Ga0105248_10301462 | |||
| 920 | Ga0105248_11296568 | |||
| 921 | Ga0105248_11393406 | |||
| 922 | Ga0105238_10704008 | |||
| 923 | Ga0105238_12452573 | |||
| 924 | Ga0105249_10384371 | |||
| 925 | Ga0105249_11136173 | |||
| 926 | Ga0105239_10749446 | |||
| 927 | Ga0105239_11131389 | |||
| 928 | Ga0105239_11511107 | |||
| 929 | Ga0105246_10027680 | |||
| 930 | Ga0157370_10350413 | |||
| 931 | Ga0157369_10872825 | |||
| 932 | Ga0157374_11345868 | |||
| 933 | Ga0157378_10103101 | |||
| 934 | Ga0157378_10217193 | |||
| 935 | Ga0163162_11203185 | |||
| 936 | Ga0157372_10294183 | |||
| 937 | Ga0157372_10989019 | |||
| 938 | Ga0157375_10475973 | |||
| 939 | Ga0163163_10067487 | |||
| 940 | Ga0163163_12933670 | |||
| 941 | Ga0157380_10037696 | |||
| 942 | Ga0157380_10112192 | |||
| 943 | Ga0157380_10887399 | |||
| 944 | Ga0157380_11601320 | |||
| 945 | Ga0157377_10045177 | |||
| 946 | Ga0157376_11381310 | |||
| 947 | Ga0157376_11825767 | |||
| 948 | Ga0163161_10859478 | |||
| 949 | Ga0163161_11010897 | |||
| 950 | Ga0206356_10232510 | |||
| 951 | Ga0206356_11185460 | |||
| 952 | Ga0207682_10018981 | |||
| 953 | Ga0207682_10179880 | |||
| 954 | Ga0207642_10359933 | |||
| 955 | Ga0207710_10712391 | |||
| 956 | Ga0207688_10011198 | |||
| 957 | Ga0207647_10116730 | |||
| 958 | Ga0207699_10488517 | |||
| 959 | Ga0207699_10847544 | |||
| 960 | Ga0207645_10002224 | |||
| 961 | Ga0207645_10021376 | |||
| 962 | Ga0207645_10797123 | |||
| 963 | Ga0207643_10152707 | |||
| 964 | Ga0207643_10262774 | |||
| 965 | Ga0207684_11561969 | |||
| 966 | Ga0207654_10016288 | |||
| 967 | Ga0207707_10255144 | |||
| 968 | Ga0207707_10315235 | |||
| 969 | Ga0207707_10861562 | |||
| 970 | Ga0207695_10656391 | |||
| 971 | Ga0207695_11159929 | |||
| 972 | Ga0207695_11530782 | |||
| 973 | Ga0207693_10243868 | |||
| 974 | Ga0207663_10247707 | |||
| 975 | Ga0207660_10093558 | |||
| 976 | Ga0207662_10006368 | |||
| 977 | Ga0207662_10088825 | |||
| 978 | Ga0207657_10192107 | |||
| 979 | Ga0207657_10346381 | |||
| 980 | Ga0207649_10744983 | |||
| 981 | Ga0207652_10166919 | |||
| 982 | Ga0207652_11437341 | |||
| 983 | Ga0207646_10405675 | |||
| 984 | Ga0207681_10012902 | |||
| 985 | Ga0207681_11373618 | |||
| 986 | Ga0207681_11510043 | |||
| 987 | Ga0207694_10633826 | |||
| 988 | Ga0207650_10220718 | |||
| 989 | Ga0207659_10004161 | |||
| 990 | Ga0207659_10508070 | |||
| 991 | Ga0207659_11135061 | |||
| 992 | Ga0207687_10966925 | |||
| 993 | Ga0207700_10172364 | |||
| 994 | Ga0207644_10112774 | |||
| 995 | Ga0207644_10287894 | |||
| 996 | Ga0207690_10324881 | |||
| 997 | Ga0207706_10137407 | |||
| 998 | Ga0207686_10030357 | |||
| 999 | Ga0207686_10047658 | |||
| 1000 | Ga0207709_10018302 | |||
| 1001 | Ga0207669_10002689 | |||
| 1002 | Ga0207669_10008948 | |||
| 1003 | Ga0207704_10025065 | |||
| 1004 | Ga0207704_10422441 | |||
| 1005 | Ga0207704_11743583 | |||
| 1006 | Ga0207691_10030277 | |||
| 1007 | Ga0207691_10069390 | |||
| 1008 | Ga0207711_10605492 | |||
| 1009 | Ga0207711_11332750 | |||
| 1010 | Ga0207711_11760315 | |||
| 1011 | Ga0207689_10000575 | |||
| 1012 | Ga0207689_10045260 | |||
| 1013 | Ga0207689_10268908 | |||
| 1014 | Ga0207689_10479671 | |||
| 1015 | Ga0207679_10064923 | |||
| 1016 | Ga0207679_10818388 | |||
| 1017 | Ga0207679_11106468 | |||
| 1018 | Ga0207651_10015429 | |||
| 1019 | Ga0207651_10028373 | |||
| 1020 | Ga0207651_10053832 | |||
| 1021 | Ga0207651_10164609 | |||
| 1022 | Ga0207712_10590914 | |||
| 1023 | Ga0207712_11588707 | |||
| 1024 | Ga0207640_10163432 | |||
| 1025 | Ga0207640_10231184 | |||
| 1026 | Ga0207658_10395372 | |||
| 1027 | Ga0207677_10582964 | |||
| 1028 | Ga0207703_10326767 | |||
| 1029 | Ga0207708_10017092 | |||
| 1030 | Ga0207708_11465526 | |||
| 1031 | Ga0207702_10682772 | |||
| 1032 | Ga0207641_10124960 | |||
| 1033 | Ga0207641_10241316 | |||
| 1034 | Ga0207641_12559622 | |||
| 1035 | Ga0207648_10003018 | |||
| 1036 | Ga0207648_10018781 | |||
| 1037 | Ga0207676_10014129 | |||
| 1038 | Ga0207676_10133678 | |||
| 1039 | Ga0207676_10280060 | |||
| 1040 | Ga0207674_10369447 | |||
| 1041 | Ga0207674_11248021 | |||
| 1042 | Ga0207675_100026353 | |||
| 1043 | Ga0207675_100047690 | |||
| 1044 | Ga0207675_100976508 | |||
| 1045 | Ga0207675_101690629 | |||
| 1046 | Ga0207675_102155464 | |||
| 1047 | Ga0207675_102639144 | |||
| 1048 | Ga0207683_10049436 | |||
| 1049 | Ga0207683_10167708 | |||
| 1050 | Ga0207683_10221631 | |||
| 1051 | Ga0207698_11433681 | |||
| 1052 | Ga0207698_11672620 | |||
| 1053 | Ga0209967_1078416 | |||
| 1054 | Ga0210002_1016288 | |||
| 1055 | Ga0209983_1059836 | |||
| 1056 | Ga0209971_1009574 | |||
| 1057 | Ga0209971_1149676 | |||
| 1058 | Ga0209974_10004233 | |||
| 1059 | Ga0207428_10001602 | |||
| 1060 | Ga0268264_10044498 | |||
| 1061 | Ga0268264_10393724 | |||
| 1062 | Ga0268264_10892336 | |||
| 1063 | Ga0316182_1119089 | |||
| 1064 | Ga0307408_100060340 | |||
| 1065 | Ga0307408_100077797 | |||
| 1066 | Ga0307408_100247512 | |||
| 1067 | Ga0307408_100328190 | |||
| 1068 | Ga0307408_101089981 | |||
| 1069 | Ga0307408_101113427 | |||
| 1070 | Ga0307408_101275919 | |||
| 1071 | Ga0307408_102034862 | |||
| 1072 | Ga0307408_102147642 | |||
| 1073 | Ga0307405_10032778 | |||
| 1074 | Ga0307405_10076533 | |||
| 1075 | Ga0307405_10740983 | |||
| 1076 | Ga0307413_10665829 | |||
| 1077 | Ga0307413_11192191 | |||
| 1078 | Ga0307413_11278635 | |||
| 1079 | Ga0307413_11706552 | |||
| 1080 | Ga0307413_12142709 | |||
| 1081 | Ga0307410_11039893 | |||
| 1082 | Ga0307410_11204030 | |||
| 1083 | Ga0307410_11892514 | |||
| 1084 | Ga0307406_10088574 | |||
| 1085 | Ga0307406_10191217 | |||
| 1086 | Ga0307406_11137253 | |||
| 1087 | Ga0307407_10105628 | |||
| 1088 | Ga0307407_10425417 | |||
| 1089 | Ga0307407_11541064 | |||
| 1090 | Ga0307412_10332287 | |||
| 1091 | Ga0307412_10378723 | |||
| 1092 | Ga0307412_10640290 | |||
| 1093 | Ga0307409_100410631 | |||
| 1094 | Ga0307409_100586330 | |||
| 1095 | Ga0307409_100811134 | |||
| 1096 | Ga0307409_101015425 | |||
| 1097 | Ga0307409_101580431 | |||
| 1098 | Ga0307409_101901164 | |||
| 1099 | Ga0307416_100008497 | |||
| 1100 | Ga0307416_100034119 | |||
| 1101 | Ga0307416_100144668 | |||
| 1102 | Ga0307416_100567721 | |||
| 1103 | Ga0307416_101025052 | |||
| 1104 | Ga0307416_103709468 | |||
| 1105 | Ga0307414_10130948 | |||
| 1106 | Ga0307411_10003896 | |||
| 1107 | Ga0307411_10146191 | |||
| 1108 | Ga0307411_10485379 | |||
| 1109 | Ga0307411_10494413 | |||
| 1110 | Ga0307411_10726025 | |||
| 1111 | Ga0307411_11008001 | |||
| 1112 | Ga0307411_11909086 | |||
| 1113 | Ga0307415_100070743 | |||
| 1114 | Ga0307415_100791876 | |||
| 1115 | Ga0373930_0186793 | |||
| 1116 | Ga0373958_0129588 | |||
| 1117 | Ga0373959_0014428 | |||
| 1118 | Ga0373926_0046374 | |||
| 1119 | Ga0373929_0053848 | |||
| 1120 | Ga0373940_0060862 | |||
| 1121 | Ga0373944_0045344 | |||
| 1122 | Ga0373941_0305604 | |||
| 1123 | Ga0373960_0060413 | |||
| 1124 | Ga0373943_0141942 | |||
| 1125 | Ga0373946_0321930 | |||
| 1126 | Ga0373955_0746693 | |||
| 1127 | Ga0373942_0167540 | |||
| 1128 | Ga0373931_0161719 | |||
| 1129 | Ga0373931_0590058 | |||
| 1130 | Ga0373935_0244852 | |||
| 1131 | Ga0373935_0869004 | |||
| 1132 | Ga0373933_0047765 | |||
| 1133 | Ga0373933_0371422 | |||
| 1134 | Ga0373947_0626472 | |||
| 1135 | Ga0373937_0058112 | |||
| 1136 | Ga0373937_0064114 | |||
| 1137 | Ga0373925_0095224 | |||
| 1138 | Ga0373925_1318097 | |||
| 1139 | Ga0439453_0027317 | |||
| 1140 | Ga0451807_1884642 | |||
| 1141 | Ga0451853_3503131 | |||
| 1142 | Ga0439450_008296 | |||
| 1143 | Ga0450890_090191 | |||
| 1144 | Ga0439446_0037412 | |||
| 1145 | Ga0439446_0100387 | |||
| 1146 | Ga0439446_0341363 | |||
| 1147 | Ga0439435_0122703 | |||
| 1148 | Ga0439444_0019270 | |||
| 1149 | Ga0439444_0170571 | |||
| 1150 | Ga0439464_0000364 | |||
| 1151 | Ga0439460_0025770 | |||
| 1152 | Ga0439460_0065914 | |||
| 1153 | Ga0451577_1440980 | |||
| 1154 | Ga0451576_0271573 | |||
| 1155 | Ga0466967_0055727 | |||
| 1156 | Ga0466967_1298342 | |||
| 1157 | Ga0495580_0228182 | |||
| 1158 | Ga0495608_0258654 | |||
| 1159 | Ga0495643_0004737 | |||
| 1160 | Ga0495598_0303022 | |||
| 1161 | Ga0495623_0107631 | |||
| 1162 | Ga0495658_0792196 | |||
| 1163 | Ga0495674_0098480 | |||
| 1164 | Ga0496100_0085415 | |||
| 1165 | Ga0496101_0336461 | |||
| 1166 | Ga0496102_0021433 | |||
| 1167 | Ga0496102_0211340 | |||
| 1168 | Ga0496103_0382415 | |||
| 1169 | Ga0496104_0615527 | |||
| 1170 | Ga0496106_1194720 | |||
| 1171 | Ga0496106_1247154 | |||
| 1172 | Ga0496107_0377844 | |||
| 1173 | Ga0496109_0371395 | |||
| 1174 | Ga0496112_0190408 | |||
| 1175 | Ga0501307_087270 | |||
| 1176 | Ga0501291_120187 | |||
| 1177 | Ga0501292_124425 | |||
| 1178 | Ga0501315_075279 | |||
| 1179 | Ga0501317_070841 | |||
| 1180 | Ga0501320_016867 | |||
| 1181 | Ga0501320_068540 | |||
| 1182 | Ga0501325_059341 | |||
| 1183 | Ga0501336_035427 | |||
| 1184 | Ga0501031_0398281 | |||
| 1185 | Ga0501032_0136983 | |||
| 1186 | Ga0501032_0262937 | |||
| 1187 | Ga0501032_0799288 | |||
| 1188 | Ga0501033_0037831 | |||
| 1189 | Ga0501033_0466515 | |||
| 1190 | Ga0501034_0510183 | |||
| 1191 | Ga0501034_0852450 | |||
| 1192 | Ga0501036_0297063 | |||
| 1193 | Ga0501036_0352694 | |||
| 1194 | Ga0501036_0505386 | |||
| 1195 | Ga0501036_0648444 | |||
| 1196 | Ga0501036_0842566 | |||
| 1197 | Ga0501036_0852614 | |||
| 1198 | Ga0501037_0130313 | |||
| 1199 | Ga0501037_0246983 | |||
| 1200 | Ga0501037_0249700 | |||
| 1201 | Ga0501038_0009435 | |||
| 1202 | Ga0501038_0094176 | |||
| 1203 | Ga0501038_0124901 | |||
| 1204 | Ga0501038_1032408 | |||
| 1205 | Ga0501039_0219881 | |||
| 1206 | Ga0501039_0304233 | |||
| 1207 | Ga0501039_0405841 | |||
| 1208 | Ga0501039_1408506 | |||
| 1209 | Ga0501040_0050995 | |||
| 1210 | Ga0501040_0070321 | |||
| 1211 | Ga0501040_0073049 | |||
| 1212 | Ga0501040_0094101 | |||
| 1213 | Ga0501040_0566535 | |||
| 1214 | Ga0501040_0793171 | |||
| 1215 | Ga0501041_0098512 | |||
| 1216 | Ga0501041_0123754 | |||
| 1217 | Ga0501041_0221188 | |||
| 1218 | Ga0501041_0335943 | |||
| 1219 | Ga0501042_0024011 | |||
| 1220 | Ga0501042_0030726 | |||
| 1221 | Ga0501042_0137724 | |||
| 1222 | Ga0501042_0275207 | |||
| 1223 | Ga0501042_0526228 | |||
| 1224 | Ga0501043_0176076 | |||
| 1225 | Ga0501043_1017564 | |||
| 1226 | Ga0501046_0128112 | |||
| 1227 | Ga0501046_0417076 | |||
| 1228 | Ga0501046_0915643 | |||
| 1229 | Ga0501048_0011907 | |||
| 1230 | Ga0501048_0221789 | |||
| 1231 | Ga0501048_0305345 | |||
| 1232 | Ga0501048_0487102 | |||
| 1233 | Ga0501067_0876513 | |||
| 1234 | Ga0501068_0113168 | |||
| 1235 | Ga0501068_0173190 | |||
| 1236 | Ga0501068_0280858 | |||
| 1237 | Ga0501068_0512608 | |||
| 1238 | Ga0501069_0095340 | |||
| 1239 | Ga0501070_0591540 | |||
| 1240 | Ga0501070_0766282 | |||
| 1241 | Ga0501070_0933660 | |||
| 1242 | Ga0501071_0028350 | |||
| 1243 | Ga0501071_0032321 | |||
| 1244 | Ga0501071_0095385 | |||
| 1245 | Ga0501071_0123590 | |||
| 1246 | Ga0501071_0221483 | |||
| 1247 | Ga0501071_0386993 | |||
| 1248 | Ga0501071_0571381 | |||
| 1249 | Ga0501072_0022761 | |||
| 1250 | Ga0501072_0023578 | |||
| 1251 | Ga0501072_0036993 | |||
| 1252 | Ga0501072_0104486 | |||
| 1253 | Ga0501072_0294765 | |||
| 1254 | Ga0501072_0377538 | |||
| 1255 | Ga0501072_0549188 | |||
| 1256 | Ga0501072_1283760 | |||
| 1257 | Ga0501072_1411048 | |||
| 1258 | Ga0501073_0169741 | |||
| 1259 | Ga0501074_0113658 | |||
| 1260 | Ga0501074_0181534 | |||
| 1261 | Ga0501074_0240857 | |||
| 1262 | Ga0501074_0730496 | |||
| 1263 | Ga0501074_0996783 | |||
| 1264 | Ga0501075_0021328 | |||
| 1265 | Ga0501075_0089005 | |||
| 1266 | Ga0501075_0089646 | |||
| 1267 | Ga0501075_0331633 | |||
| 1268 | Ga0501075_0374526 | |||
| 1269 | Ga0501075_0386527 | |||
| 1270 | Ga0501075_0447170 | |||
| 1271 | Ga0501075_0456807 | |||
| 1272 | Ga0501075_1301308 | |||
| 1273 | Ga0501075_1321447 | |||
| 1274 | Ga0501076_0007570 | |||
| 1275 | Ga0501076_0070349 | |||
| 1276 | Ga0501076_0070593 | |||
| 1277 | Ga0501076_0312162 | |||
| 1278 | Ga0501076_0414499 | |||
| 1279 | Ga0501076_0563972 | |||
| 1280 | Ga0501076_0656598 | |||
| 1281 | Ga0501076_0659909 | |||
| 1282 | Ga0501076_1560875 | |||
| 1283 | Ga0501077_0017907 | |||
| 1284 | Ga0501077_0168697 | |||
| 1285 | Ga0501077_0974141 | |||
| 1286 | Ga0501077_0991248 | |||
| 1287 | Ga0501077_1067156 | |||
| 1288 | Ga0501202_037547 | |||
| 1289 | Ga0501217_124934 | |||
| 1290 | Ga0501233_004398 | |||
| 1291 | Ga0501233_035892 | |||
| 1292 | Ga0501233_215021 | |||
| 1293 | Ga0501235_080697 | |||
| 1294 | Ga0501253_020253 | |||
| 1295 | Ga0501253_181581 | |||
| 1296 | Ga0501257_264677 | |||
| 1297 | Ga0501261_090950 | |||
| 1298 | Ga0501079_0046585 | |||
| 1299 | Ga0501079_0058797 | |||
| 1300 | Ga0501079_0166920 | |||
| 1301 | Ga0501079_0240103 | |||
| 1302 | Ga0501079_0365818 | |||
| 1303 | Ga0501079_1096589 | |||
| 1304 | Ga0501080_0078012 | |||
| 1305 | Ga0501080_0285673 | |||
| 1306 | Ga0501080_0379381 | |||
| 1307 | Ga0501080_0381690 | |||
| 1308 | Ga0501080_0704649 | |||
| 1309 | Ga0501080_0834846 | |||
| 1310 | Ga0501081_0060981 | |||
| 1311 | Ga0501081_0064916 | |||
| 1312 | Ga0501081_0304896 | |||
| 1313 | Ga0501081_0695607 | |||
| 1314 | Ga0501081_0707577 | |||
| 1315 | Ga0501081_1428890 | |||
| 1316 | Ga0501081_1472265 | |||
| 1317 | Ga0501083_0152024 | |||
| 1318 | Ga0501083_0344309 | |||
| 1319 | Ga0501083_0489865 | |||
| 1320 | Ga0501083_0598374 | |||
| 1321 | Ga0501266_038921 | |||
| 1322 | Ga0501270_126691 | |||
| 1323 | Ga0501272_043042 | |||
| 1324 | Ga0501273_058508 | |||
| 1325 | Ga0501283_014362 | |||
| 1326 | Ga0501035_0110640 | |||
| 1327 | Ga0501035_0321204 | |||
| 1328 | Ga0501044_0820280 | |||
| 1329 | Ga0501045_0043317 | |||
| 1330 | Ga0501045_0104700 | |||
| 1331 | Ga0501045_0278838 | |||
| 1332 | Ga0501045_0292477 | |||
| 1333 | Ga0501045_0319493 | |||
| 1334 | Ga0501045_0324579 | |||
| 1335 | Ga0501045_0397317 | |||
| 1336 | Ga0501045_1420180 | |||
| 1337 | Ga0501204_076236 | |||
| 1338 | Ga0501212_100948 | |||
| 1339 | nmdc:mga06z11_549999_c1 | |||
| 1340 | nmdc:mga04h51_176098_c1 | |||
| 1341 | nmdc:mga05p37_1200596_c1 | |||
| 1342 | nmdc:mga05p37_1431_c1 | |||
| 1343 | nmdc:mga05p37_14385_c1 | |||
| 1344 | nmdc:mga05p37_32181_c1 | |||
| 1345 | nmdc:mga05p37_35887_c1 | |||
| 1346 | nmdc:mga05p37_546212_c1 | |||
| 1347 | nmdc:mga05p37_670474_c1 | |||
| 1348 | nmdc:mga05p37_7701_c1 | |||
| 1349 | nmdc:mga05p37_7758_c1 | |||
| 1350 | nmdc:mga09592_134896_c1 | |||
| 1351 | nmdc:mga09592_279956_c1 | |||
| 1352 | nmdc:mga09592_572762_c1 | |||
| 1353 | nmdc:mga0qj67_2107_c1 | |||
| 1354 | nmdc:mga0qj67_22280_c1 | |||
| 1355 | nmdc:mga0qj67_49170_c1 | |||
| 1356 | nmdc:mga0qj67_633558_c1 | |||
| 1357 | nmdc:mga06r32_102832_c1 | |||
| 1358 | nmdc:mga06r32_148304_c1 | |||
| 1359 | nmdc:mga06r32_50060_c1 | |||
| 1360 | nmdc:mga06r32_503177_c1 | |||
| 1361 | nmdc:mga06r32_660984_c1 | |||
| 1362 | nmdc:mga08y16_159524_c1 | |||
| 1363 | nmdc:mga08y16_1714413_c1 | |||
| 1364 | nmdc:mga08y16_1864_c1 | |||
| 1365 | nmdc:mga08y16_453603_c1 | |||
| 1366 | nmdc:mga0n895_65852_c1 | |||
| 1367 | nmdc:mga0n895_72520_c1 | |||
| 1368 | nmdc:mga0rr50_136675_c1 | |||
| 1369 | nmdc:mga0rr50_40565_c1 | |||
| 1370 | nmdc:mga08x19_436031_c1 | |||
| 1371 | nmdc:mga0a205_174852_c1 | |||
| 1372 | nmdc:mga0a205_299359_c1 | |||
| 1373 | nmdc:mga0a205_41857_c1 | |||
| 1374 | nmdc:mga0a205_87169_c1 | |||
| 1375 | Ga0495601_0229237 | |||
| 1376 | Ga0495595_0292068 | |||
| 1377 | Ga0495619_1050087 | |||
| 1378 | Ga0501084_0069837 | |||
| 1379 | Ga0501084_0110725 | |||
| 1380 | Ga0501084_0231060 | |||
| 1381 | Ga0501084_0295201 | |||
| 1382 | Ga0501084_0545694 | |||
| 1383 | Ga0501084_1589235 | |||
| 1384 | Ga0501084_1811598 | |||
| 1385 | Ga0590071_001774 | |||
| 1386 | Ga0590071_011932 | |||
| 1387 | Ga0590071_087786 | |||
| 1388 | Ga0590075_000359 | |||
| 1389 | Ga0590075_110226 | |||
| 1390 | Ga0590075_202660 | |||
| 1391 | Ga0590077_000171 | |||
| 1392 | Ga0587085_128548 | |||
| 1393 | Ga0587085_183651 | |||
| 1394 | Ga0587091_086180 | |||
| 1395 | Ga0587092_131636 | |||
| 1396 | Ga0587128_002469 | |||
| 1397 | Ga0587062_055428 | |||
| 1398 | Ga0587072_138063 | |||
| 1399 | Ga0587107_019575 | |||
| 1400 | Ga0587119_052555 | |||
| 1401 | Ga0587111_0268034 | |||
| 1402 | Ga0501082_0055453 | |||
| 1403 | Ga0501082_0076768 | |||
| 1404 | Ga0501082_0120235 | |||
| 1405 | Ga0501082_0181271 | |||
| 1406 | Ga0501082_0370686 | |||
| 1407 | Ga0501082_1343288 | |||
| 1408 | Ga0530510_0032053 | |||
| 1409 | Ga0530510_0066105 | |||
| 1410 | Ga0530510_0391043 | |||
| 1411 | Ga0530510_0444900 | |||
| 1412 | Ga0530510_0467460 | |||
| 1413 | Ga0530510_0572667 | |||
| 1414 | Ga0530510_0641764 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy