F476537

General Info

Members Datasets Scaffolds Average Seq Length
707 318 1414 84

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000108|Ga0114129_1000010845
Length 100
Sequence LEPLVNALHAAGEEGVRMAILSWILFGLVVGIIAKLLMPGRDPGGFIVTILLGIAGALVGGFIGRAMGFYGQGQGAGWLMSILGAIVLLFIYRLAVRRGA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
238 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
239 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
272 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
273 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
274 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
275 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
281 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
282 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
283 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
284 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
289 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 3.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 1.7
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 24.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10000108 3300009147 Bacteria 81939
2 JGI24751J29686_10022043 3300002459 Unclassified 1321
3 rootL2_10084844 3300003322 Bacteria 2678
4 Ga0007429J51699_1031697 3300003579 Bacteria 1152
5 Ga0032354_1023873 3300003693 Unclassified 1272
6 Ga0032354_1069567 3300003693 Unclassified 621
7 Ga0058863_11770274 3300004799 Bacteria 1592
8 Ga0058860_10038317 3300004801 Bacteria 744
9 Ga0058860_12191695 3300004801 Bacteria 993
10 Ga0065715_10016006 3300005293 Unclassified 2664
11 Ga0065715_11187906 3300005293 Unclassified 501
12 Ga0065707_10191511 3300005295 Bacteria 1351
13 Ga0065707_10444521 3300005295 Unclassified 807
14 Ga0070676_10171884 3300005328 Bacteria 1402
15 Ga0070683_101037738 3300005329 Unclassified 787
16 Ga0070690_100061669 3300005330 Bacteria 2416
17 Ga0070690_100201567 3300005330 Bacteria 1385
18 Ga0070690_100219113 3300005330 Bacteria 1333
19 Ga0070677_10162402 3300005333 Bacteria 1049
20 Ga0070677_10246974 3300005333 Bacteria 884
21 Ga0068869_100001674 3300005334 Bacteria 13247
22 Ga0068869_100410367 3300005334 Bacteria 1116
23 Ga0070666_10707800 3300005335 Bacteria 739
24 Ga0070666_10974504 3300005335 Unclassified 628
25 Ga0070680_100080493 3300005336 Unclassified 2686
26 Ga0070680_101437142 3300005336 Bacteria 597
27 Ga0070682_100774650 3300005337 Bacteria 777
28 Ga0070682_100993087 3300005337 Unclassified 696
29 Ga0070682_101683982 3300005337 Unclassified 550
30 Ga0068868_100660301 3300005338 Bacteria 932
31 Ga0068868_100815873 3300005338 Bacteria 843
32 Ga0070660_100396098 3300005339 Bacteria 1141
33 Ga0070660_100421828 3300005339 Bacteria 1105
34 Ga0070689_100197218 3300005340 Bacteria 1642
35 Ga0070689_101287585 3300005340 Unclassified 658
36 Ga0070691_10084898 3300005341 Bacteria 1555
37 Ga0070691_10312296 3300005341 Bacteria 862
38 Ga0070691_10352081 3300005341 Bacteria 818
39 Ga0070687_100005613 3300005343 Bacteria 5087
40 Ga0070687_100032707 3300005343 Bacteria 2561
41 Ga0070661_100250350 3300005344 Unclassified 1367
42 Ga0070661_101120393 3300005344 Bacteria 656
43 Ga0070661_101125079 3300005344 Bacteria 655
44 Ga0070692_10438670 3300005345 Bacteria 833
45 Ga0070668_100544169 3300005347 Bacteria 1010
46 Ga0070669_100059046 3300005353 Bacteria 2816
47 Ga0070669_100095918 3300005353 Bacteria 2231
48 Ga0070675_100003298 3300005354 Bacteria 12241
49 Ga0070675_100462629 3300005354 Unclassified 1139
50 Ga0070675_101165299 3300005354 Bacteria 709
51 Ga0070671_100003192 3300005355 Bacteria 12777
52 Ga0070671_100125111 3300005355 Bacteria 2164
53 Ga0070674_100061558 3300005356 Bacteria 2620
54 Ga0070673_100007029 3300005364 Bacteria 7380
55 Ga0070673_100008047 3300005364 Bacteria 6986
56 Ga0070673_100030664 3300005364 Bacteria 4028
57 Ga0070673_100348703 3300005364 Bacteria 1313
58 Ga0070659_100030095 3300005366 Bacteria 4200
59 Ga0070659_100734893 3300005366 Unclassified 855
60 Ga0070667_101298210 3300005367 Bacteria 682
61 Ga0070709_10395092 3300005434 Bacteria 1031
62 Ga0070709_10737456 3300005434 Unclassified 769
63 Ga0070713_100010625 3300005436 Bacteria 6658
64 Ga0070713_100660089 3300005436 Unclassified 996
65 Ga0070701_10140980 3300005438 Bacteria 1378
66 Ga0070701_10663021 3300005438 Bacteria 698
67 Ga0070711_101124712 3300005439 Bacteria 677
68 Ga0070705_100039072 3300005440 Bacteria 2690
69 Ga0070700_100023523 3300005441 Bacteria 3604
70 Ga0070700_101115243 3300005441 Bacteria 655
71 Ga0070700_101809435 3300005441 Unclassified 526
72 Ga0070694_101705383 3300005444 Bacteria 536
73 Ga0070663_101129575 3300005455 Bacteria 686
74 Ga0070678_100027465 3300005456 Bacteria 3864
75 Ga0070678_101103254 3300005456 Bacteria 733
76 Ga0070662_100322602 3300005457 Bacteria 1260
77 Ga0070662_100909011 3300005457 Unclassified 751
78 Ga0070681_10016257 3300005458 Bacteria 7423
79 Ga0070681_10058263 3300005458 Bacteria 3843
80 Ga0070681_10364088 3300005458 Unclassified 1356
81 Ga0068867_100001597 3300005459 Bacteria 15742
82 Ga0068867_100039709 3300005459 Bacteria 3432
83 Ga0070685_10297435 3300005466 Bacteria 1087
84 Ga0070706_100353372 3300005467 Bacteria 1370
85 Ga0070707_100025801 3300005468 Bacteria 5578
86 Ga0070707_100356585 3300005468 Bacteria 1420
87 Ga0070698_100091463 3300005471 Bacteria 3025
88 Ga0070698_100435061 3300005471 Bacteria 1247
89 Ga0070698_100522805 3300005471 Bacteria 1125
90 Ga0070699_101528832 3300005518 Unclassified 612
91 Ga0070699_101631306 3300005518 Bacteria 591
92 Ga0070679_100108978 3300005530 Unclassified 2756
93 Ga0070697_100058323 3300005536 Bacteria 3142
94 Ga0070697_101530310 3300005536 Bacteria 596
95 Ga0068853_100933488 3300005539 Bacteria 834
96 Ga0068853_102477963 3300005539 Unclassified 502
97 Ga0070672_100001819 3300005543 Bacteria 13310
98 Ga0070672_100018874 3300005543 Bacteria 4995
99 Ga0070672_100162737 3300005543 Bacteria 1852
100 Ga0070686_100042129 3300005544 Bacteria 2858
101 Ga0070686_100062156 3300005544 Bacteria 2415
102 Ga0070686_100173598 3300005544 Bacteria 1526
103 Ga0070695_100230477 3300005545 Bacteria 1339
104 Ga0070695_100236216 3300005545 Bacteria 1324
105 Ga0070695_100593218 3300005545 Unclassified 869
106 Ga0070695_101629377 3300005545 Unclassified 539
107 Ga0070696_101083633 3300005546 Bacteria 673
108 Ga0070693_100073368 3300005547 Bacteria 2021
109 Ga0070693_100098783 3300005547 Bacteria 1775
110 Ga0070665_101201309 3300005548 Bacteria 769
111 Ga0070704_100249258 3300005549 Bacteria 1457
112 Ga0068855_100121726 3300005563 Bacteria 2986
113 Ga0070664_100021383 3300005564 Bacteria 5331
114 Ga0068857_100433049 3300005577 Bacteria 1228
115 Ga0068857_100445299 3300005577 Bacteria 1210
116 Ga0068854_100280881 3300005578 Bacteria 1341
117 Ga0068854_100363515 3300005578 Bacteria 1188
118 Ga0068856_100867038 3300005614 Unclassified 922
119 Ga0068856_101986975 3300005614 Bacteria 592
120 Ga0070702_100006598 3300005615 Bacteria 5505
121 Ga0070702_100078746 3300005615 Bacteria 1968
122 Ga0068852_101720111 3300005616 Unclassified 650
123 Ga0068859_100036569 3300005617 Bacteria 4930
124 Ga0068859_100291034 3300005617 Bacteria 1726
125 Ga0068864_100183871 3300005618 Unclassified 1912
126 Ga0068864_100291514 3300005618 Bacteria 1525
127 Ga0068864_100350842 3300005618 Bacteria 1392
128 Ga0068866_10280122 3300005718 Bacteria 1033
129 Ga0068861_100301086 3300005719 Unclassified 1389
130 Ga0068861_100403355 3300005719 Bacteria 1214
131 Ga0068861_102534306 3300005719 Unclassified 516
132 Ga0068870_10172997 3300005840 Unclassified 1290
133 Ga0068870_10208516 3300005840 Bacteria 1189
134 Ga0068863_100225097 3300005841 Bacteria 1808
135 Ga0068863_102389584 3300005841 Bacteria 538
136 Ga0068858_100031356 3300005842 Bacteria 4936
137 Ga0068860_100039032 3300005843 Bacteria 4542
138 Ga0068860_100376546 3300005843 Bacteria 1401
139 Ga0068862_101510654 3300005844 Unclassified 677
140 Ga0081538_10104394 3300005981 Bacteria 1414
141 Ga0081538_10265635 3300005981 Bacteria 645
142 Ga0081538_10358995 3300005981 Bacteria 527
143 Ga0070716_101561458 3300006173 Bacteria 541
144 Ga0075367_10388341 3300006178 Bacteria 882
145 Ga0097621_100411119 3300006237 Bacteria 1213
146 Ga0068871_100213179 3300006358 Unclassified 1671
147 Ga0068871_100534694 3300006358 Unclassified 1060
148 Ga0075428_100002414 3300006844 Bacteria 20301
149 Ga0075428_100012091 3300006844 Bacteria 9604
150 Ga0075428_100013706 3300006844 Bacteria 9026
151 Ga0075430_100005581 3300006846 Bacteria 10628
152 Ga0075430_100055669 3300006846 Bacteria 3326
153 Ga0075430_100073011 3300006846 Bacteria 2877
154 Ga0075430_100685456 3300006846 Unclassified 845
155 Ga0075430_100803468 3300006846 Bacteria 775
156 Ga0075430_101518730 3300006846 Bacteria 550
157 Ga0075431_100037021 3300006847 Bacteria 5026
158 Ga0075431_100052713 3300006847 Bacteria 4195
159 Ga0075431_100089620 3300006847 Bacteria 3175
160 Ga0075431_100119432 3300006847 Bacteria 2720
161 Ga0075431_100956950 3300006847 Bacteria 824
162 Ga0075433_10012184 3300006852 Bacteria 6933
163 Ga0075433_10032242 3300006852 Bacteria 4487
164 Ga0075433_10167145 3300006852 Unclassified 1958
165 Ga0075433_10179068 3300006852 Unclassified 1886
166 Ga0075434_100053167 3300006871 Unclassified 4025
167 Ga0075434_100190575 3300006871 Bacteria 2071
168 Ga0075434_100281975 3300006871 Bacteria 1681
169 Ga0075434_100380259 3300006871 Bacteria 1433
170 Ga0075434_100438355 3300006871 Bacteria 1328
171 Ga0075429_100004168 3300006880 Bacteria 12374
172 Ga0075429_100028977 3300006880 Bacteria 4809
173 Ga0075429_100200964 3300006880 Bacteria 1746
174 Ga0068865_100024604 3300006881 Bacteria 3952
175 Ga0068865_100237179 3300006881 Bacteria 1433
176 Ga0075436_100458265 3300006914 Bacteria 929
177 Ga0097620_100036568 3300006931 Bacteria 4930
178 Ga0097620_100291031 3300006931 Bacteria 1726
179 Ga0075435_100002272 3300007076 Bacteria 12689
180 Ga0075435_100061311 3300007076 Unclassified 3051
181 Ga0075435_100191544 3300007076 Bacteria 1731
182 Ga0105240_10282156 3300009093 Unclassified 1907
183 Ga0105240_10650625 3300009093 Bacteria 1155
184 Ga0111539_10002069 3300009094 Bacteria 26819
185 Ga0111539_10190074 3300009094 Bacteria 2396
186 Ga0111539_11444706 3300009094 Bacteria 798
187 Ga0111539_11762540 3300009094 Bacteria 718
188 Ga0111539_11905564 3300009094 Bacteria 689
189 Ga0111539_12185067 3300009094 Unclassified 642
190 Ga0111539_12819318 3300009094 Unclassified 563
191 Ga0111539_13402790 3300009094 Bacteria 511
192 Ga0105245_10102895 3300009098 Bacteria 2645
193 Ga0105245_10909590 3300009098 Bacteria 922
194 Ga0105247_10745339 3300009101 Unclassified 742
195 Ga0114129_10001729 3300009147 Bacteria 29783
196 Ga0114129_10006049 3300009147 Bacteria 17157
197 Ga0114129_10014363 3300009147 Bacteria 11287
198 Ga0114129_10045184 3300009147 Bacteria 6192
199 Ga0114129_10069154 3300009147 Bacteria 4922
200 Ga0114129_10660749 3300009147 Bacteria 1348
201 Ga0114129_10674367 3300009147 Bacteria 1332
202 Ga0114129_11051161 3300009147 Bacteria 1022
203 Ga0114129_12329636 3300009147 Bacteria 642
204 Ga0105243_10023921 3300009148 Bacteria 4655
205 Ga0105243_10861816 3300009148 Bacteria 898
206 Ga0105243_10880381 3300009148 Bacteria 889
207 Ga0105241_10032705 3300009174 Bacteria 3901
208 Ga0105241_10378402 3300009174 Unclassified 1236
209 Ga0105242_10004553 3300009176 Bacteria 10757
210 Ga0105242_10031487 3300009176 Bacteria 4237
211 Ga0105248_10141249 3300009177 Bacteria 2716
212 Ga0105248_10301462 3300009177 Unclassified 1804
213 Ga0105248_11296568 3300009177 Unclassified 824
214 Ga0105248_11393406 3300009177 Bacteria 793
215 Ga0105238_10704008 3300009551 Bacteria 1022
216 Ga0105238_12452573 3300009551 Bacteria 557
217 Ga0105249_10384371 3300009553 Bacteria 1430
218 Ga0105249_11136173 3300009553 Unclassified 852
219 Ga0105239_10749446 3300010375 Bacteria 1118
220 Ga0105239_11131389 3300010375 Unclassified 902
221 Ga0105239_11511107 3300010375 Unclassified 776
222 Ga0105246_10027680 3300011119 Bacteria 3717
223 Ga0157370_10350413 3300013104 Unclassified 1361
224 Ga0157369_10872825 3300013105 Unclassified 923
225 Ga0157374_11345868 3300013296 Bacteria 736
226 Ga0157378_10103101 3300013297 Bacteria 2606
227 Ga0157378_10217193 3300013297 Bacteria 1816
228 Ga0163162_11203185 3300013306 Bacteria 860
229 Ga0157372_10294183 3300013307 Unclassified 1888
230 Ga0157372_10989019 3300013307 Bacteria 974
231 Ga0157375_10475973 3300013308 Bacteria 1414
232 Ga0163163_10067487 3300014325 Unclassified 3556
233 Ga0163163_12933670 3300014325 Unclassified 532
234 Ga0157380_10037696 3300014326 Bacteria 3747
235 Ga0157380_10112192 3300014326 Bacteria 2293
236 Ga0157380_10887399 3300014326 Bacteria 917
237 Ga0157380_11601320 3300014326 Bacteria 707
238 Ga0157377_10045177 3300014745 Bacteria 2460
239 Ga0157376_11381310 3300014969 Bacteria 735
240 Ga0157376_11825767 3300014969 Bacteria 644
241 Ga0163161_10859478 3300017792 Bacteria 766
242 Ga0163161_11010897 3300017792 Unclassified 710
243 Ga0206356_10232510 3300020070 Bacteria 2470
244 Ga0206356_11185460 3300020070 Unclassified 2220
245 Ga0207682_10018981 3300025893 Bacteria 2691
246 Ga0207682_10179880 3300025893 Bacteria 966
247 Ga0207642_10359933 3300025899 Bacteria 861
248 Ga0207710_10712391 3300025900 Unclassified 527
249 Ga0207688_10011198 3300025901 Bacteria 4883
250 Ga0207647_10116730 3300025904 Bacteria 1576
251 Ga0207699_10488517 3300025906 Unclassified 887
252 Ga0207699_10847544 3300025906 Unclassified 673
253 Ga0207645_10002224 3300025907 Bacteria 15472
254 Ga0207645_10021376 3300025907 Bacteria 4220
255 Ga0207645_10797123 3300025907 Unclassified 642
256 Ga0207643_10152707 3300025908 Bacteria 1385
257 Ga0207643_10262774 3300025908 Bacteria 1066
258 Ga0207684_11561969 3300025910 Bacteria 535
259 Ga0207654_10016288 3300025911 Bacteria 3868
260 Ga0207707_10255144 3300025912 Unclassified 1523
261 Ga0207707_10315235 3300025912 Bacteria 1351
262 Ga0207707_10861562 3300025912 Bacteria 751
263 Ga0207695_10656391 3300025913 Unclassified 930
264 Ga0207695_11159929 3300025913 Bacteria 653
265 Ga0207695_11530782 3300025913 Bacteria 547
266 Ga0207693_10243868 3300025915 Unclassified 1410
267 Ga0207663_10247707 3300025916 Bacteria 1310
268 Ga0207660_10093558 3300025917 Unclassified 2233
269 Ga0207662_10006368 3300025918 Bacteria 6368
270 Ga0207662_10088825 3300025918 Bacteria 1898
271 Ga0207657_10192107 3300025919 Unclassified 1646
272 Ga0207657_10346381 3300025919 Bacteria 1172
273 Ga0207649_10744983 3300025920 Bacteria 762
274 Ga0207652_10166919 3300025921 Unclassified 1974
275 Ga0207652_11437341 3300025921 Unclassified 593
276 Ga0207646_10405675 3300025922 Unclassified 1231
277 Ga0207681_10012902 3300025923 Bacteria 5167
278 Ga0207681_11373618 3300025923 Unclassified 593
279 Ga0207681_11510043 3300025923 Unclassified 563
280 Ga0207694_10633826 3300025924 Bacteria 900
281 Ga0207650_10220718 3300025925 Bacteria 1525
282 Ga0207659_10004161 3300025926 Bacteria 8735
283 Ga0207659_10508070 3300025926 Unclassified 1021
284 Ga0207659_11135061 3300025926 Bacteria 672
285 Ga0207687_10966925 3300025927 Bacteria 730
286 Ga0207700_10172364 3300025928 Unclassified 1806
287 Ga0207644_10112774 3300025931 Bacteria 2058
288 Ga0207644_10287894 3300025931 Bacteria 1320
289 Ga0207690_10324881 3300025932 Bacteria 1210
290 Ga0207706_10137407 3300025933 Unclassified 2150
291 Ga0207686_10030357 3300025934 Bacteria 3199
292 Ga0207686_10047658 3300025934 Bacteria 2650
293 Ga0207709_10018302 3300025935 Bacteria 3922
294 Ga0207669_10002689 3300025937 Bacteria 7604
295 Ga0207669_10008948 3300025937 Bacteria 4734
296 Ga0207704_10025065 3300025938 Bacteria 3249
297 Ga0207704_10422441 3300025938 Bacteria 1057
298 Ga0207704_11743583 3300025938 Bacteria 535
299 Ga0207691_10030277 3300025940 Bacteria 5059
300 Ga0207691_10069390 3300025940 Bacteria 3184
301 Ga0207711_10605492 3300025941 Bacteria 1022
302 Ga0207711_11332750 3300025941 Bacteria 660
303 Ga0207711_11760315 3300025941 Bacteria 563
304 Ga0207689_10000575 3300025942 Bacteria 35110
305 Ga0207689_10045260 3300025942 Bacteria 3639
306 Ga0207689_10268908 3300025942 Bacteria 1411
307 Ga0207689_10479671 3300025942 Bacteria 1041
308 Ga0207679_10064923 3300025945 Unclassified 2730
309 Ga0207679_10818388 3300025945 Bacteria 850
310 Ga0207679_11106468 3300025945 Bacteria 727
311 Ga0207651_10015429 3300025960 Bacteria 4438
312 Ga0207651_10028373 3300025960 Bacteria 3529
313 Ga0207651_10053832 3300025960 Bacteria 2753
314 Ga0207651_10164609 3300025960 Bacteria 1742
315 Ga0207712_10590914 3300025961 Bacteria 959
316 Ga0207712_11588707 3300025961 Unclassified 586
317 Ga0207640_10163432 3300025981 Unclassified 1650
318 Ga0207640_10231184 3300025981 Bacteria 1423
319 Ga0207658_10395372 3300025986 Bacteria 1214
320 Ga0207677_10582964 3300026023 Bacteria 979
321 Ga0207703_10326767 3300026035 Bacteria 1406
322 Ga0207708_10017092 3300026075 Bacteria 5459
323 Ga0207708_11465526 3300026075 Unclassified 599
324 Ga0207702_10682772 3300026078 Archaea 1011
325 Ga0207641_10124960 3300026088 Bacteria 2302
326 Ga0207641_10241316 3300026088 Bacteria 1684
327 Ga0207641_12559622 3300026088 Bacteria 508
328 Ga0207648_10003018 3300026089 Bacteria 17776
329 Ga0207648_10018781 3300026089 Bacteria 6250
330 Ga0207676_10014129 3300026095 Bacteria 5736
331 Ga0207676_10133678 3300026095 Unclassified 2113
332 Ga0207676_10280060 3300026095 Bacteria 1514
333 Ga0207674_10369447 3300026116 Bacteria 1387
334 Ga0207674_11248021 3300026116 Bacteria 713
335 Ga0207675_100026353 3300026118 Bacteria 5411
336 Ga0207675_100047690 3300026118 Bacteria 3999
337 Ga0207675_100976508 3300026118 Bacteria 865
338 Ga0207675_101690629 3300026118 Unclassified 653
339 Ga0207675_102155464 3300026118 Unclassified 573
340 Ga0207675_102639144 3300026118 Unclassified 511
341 Ga0207683_10049436 3300026121 Bacteria 3681
342 Ga0207683_10167708 3300026121 Bacteria 1987
343 Ga0207683_10221631 3300026121 Bacteria 1723
344 Ga0207698_11433681 3300026142 Unclassified 706
345 Ga0207698_11672620 3300026142 Unclassified 652
346 Ga0209967_1078416 3300027364 Bacteria 518
347 Ga0210002_1016288 3300027617 Bacteria 1176
348 Ga0209983_1059836 3300027665 Bacteria 841
349 Ga0209971_1009574 3300027682 Unclassified 2295
350 Ga0209971_1149676 3300027682 Unclassified 576
351 Ga0209974_10004233 3300027876 Bacteria 5125
352 Ga0207428_10001602 3300027907 Bacteria 23525
353 Ga0268264_10044498 3300028381 Bacteria 3683
354 Ga0268264_10393724 3300028381 Bacteria 1330
355 Ga0268264_10892336 3300028381 Unclassified 892
356 Ga0316182_1119089 3300030745 Bacteria 850
357 Ga0307408_100060340 3300031548 Bacteria 2764
358 Ga0307408_100077797 3300031548 Bacteria 2471
359 Ga0307408_100247512 3300031548 Bacteria 1468
360 Ga0307408_100328190 3300031548 Bacteria 1291
361 Ga0307408_101089981 3300031548 Bacteria 740
362 Ga0307408_101113427 3300031548 Bacteria 733
363 Ga0307408_101275919 3300031548 Unclassified 688
364 Ga0307408_102034862 3300031548 Unclassified 553
365 Ga0307408_102147642 3300031548 Bacteria 539
366 Ga0307405_10032778 3300031731 Bacteria 3074
367 Ga0307405_10076533 3300031731 Unclassified 2171
368 Ga0307405_10740983 3300031731 Bacteria 818
369 Ga0307413_10665829 3300031824 Bacteria 860
370 Ga0307413_11192191 3300031824 Bacteria 662
371 Ga0307413_11278635 3300031824 Bacteria 641
372 Ga0307413_11706552 3300031824 Unclassified 562
373 Ga0307413_12142709 3300031824 Bacteria 506
374 Ga0307410_11039893 3300031852 Bacteria 708
375 Ga0307410_11204030 3300031852 Bacteria 660
376 Ga0307410_11892514 3300031852 Unclassified 531
377 Ga0307406_10088574 3300031901 Bacteria 2077
378 Ga0307406_10191217 3300031901 Bacteria 1498
379 Ga0307406_11137253 3300031901 Bacteria 676
380 Ga0307407_10105628 3300031903 Bacteria 1757
381 Ga0307407_10425417 3300031903 Bacteria 958
382 Ga0307407_11541064 3300031903 Bacteria 526
383 Ga0307412_10332287 3300031911 Unclassified 1213
384 Ga0307412_10378723 3300031911 Bacteria 1145
385 Ga0307412_10640290 3300031911 Bacteria 905
386 Ga0307409_100410631 3300031995 Bacteria 1296
387 Ga0307409_100586330 3300031995 Bacteria 1100
388 Ga0307409_100811134 3300031995 Bacteria 944
389 Ga0307409_101015425 3300031995 Bacteria 848
390 Ga0307409_101580431 3300031995 Bacteria 684
391 Ga0307409_101901164 3300031995 Bacteria 625
392 Ga0307416_100008497 3300032002 Bacteria 6633
393 Ga0307416_100034119 3300032002 Unclassified 3868
394 Ga0307416_100144668 3300032002 Bacteria 2168
395 Ga0307416_100567721 3300032002 Unclassified 1210
396 Ga0307416_101025052 3300032002 Unclassified 929
397 Ga0307416_103709468 3300032002 Unclassified 511
398 Ga0307414_10130948 3300032004 Bacteria 1947
399 Ga0307411_10003896 3300032005 Bacteria 7036
400 Ga0307411_10146191 3300032005 Archaea 1750
401 Ga0307411_10485379 3300032005 Bacteria 1041
402 Ga0307411_10494413 3300032005 Bacteria 1033
403 Ga0307411_10726025 3300032005 Unclassified 868
404 Ga0307411_11008001 3300032005 Bacteria 746
405 Ga0307411_11909086 3300032005 Bacteria 553
406 Ga0307415_100070743 3300032126 Unclassified 2451
407 Ga0307415_100791876 3300032126 Bacteria 864
408 Ga0373930_0186793 3300034816 Bacteria 534
409 Ga0373958_0129588 3300034819 Unclassified 616
410 Ga0373959_0014428 3300034820 Bacteria 1438
411 Ga0373926_0046374 3300035083 Bacteria 1559
412 Ga0373929_0053848 3300035085 Bacteria 926
413 Ga0373940_0060862 3300035088 Bacteria 1080
414 Ga0373944_0045344 3300035089 Bacteria 1372
415 Ga0373941_0305604 3300035115 Bacteria 636
416 Ga0373960_0060413 3300035121 Bacteria 1149
417 Ga0373943_0141942 3300035170 Unclassified 1295
418 Ga0373946_0321930 3300035171 Bacteria 768
419 Ga0373955_0746693 3300035172 Bacteria 601
420 Ga0373942_0167540 3300035207 Bacteria 714
421 Ga0373931_0161719 3300035691 Bacteria 1313
422 Ga0373931_0590058 3300035691 Bacteria 725
423 Ga0373935_0244852 3300035692 Bacteria 1253
424 Ga0373935_0869004 3300035692 Bacteria 667
425 Ga0373933_0047765 3300035724 Bacteria 2547
426 Ga0373933_0371422 3300035724 Unclassified 931
427 Ga0373947_0626472 3300035725 Bacteria 733
428 Ga0373937_0058112 3300036401 Bacteria 3553
429 Ga0373937_0064114 3300036401 Bacteria 3380
430 Ga0373925_0095224 3300037068 Bacteria 2280
431 Ga0373925_1318097 3300037068 Bacteria 592
432 Ga0439453_0027317 3300041408 Unclassified 1062
433 Ga0451807_1884642 3300041486 Bacteria 852
434 Ga0451853_3503131 3300041512 Bacteria 1022
435 Ga0439450_008296 3300042008 Bacteria 1935
436 Ga0450890_090191 3300042127 Unclassified 508
437 Ga0439446_0037412 3300042156 Bacteria 1420
438 Ga0439446_0100387 3300042156 Unclassified 915
439 Ga0439446_0341363 3300042156 Bacteria 532
440 Ga0439435_0122703 3300042436 Bacteria 815
441 Ga0439444_0019270 3300042437 Bacteria 1189
442 Ga0439444_0170571 3300042437 Unclassified 536
443 Ga0439464_0000364 3300042439 Bacteria 8810
444 Ga0439460_0025770 3300042461 Unclassified 1640
445 Ga0439460_0065914 3300042461 Bacteria 1113
446 Ga0451577_1440980 3300042876 Unclassified 610
447 Ga0451576_0271573 3300045051 Unclassified 1773
448 Ga0466967_0055727 3300045976 Bacteria 3483
449 Ga0466967_1298342 3300045976 Bacteria 725
450 Ga0495580_0228182 3300046472 Bacteria 1279
451 Ga0495608_0258654 3300046511 Bacteria 1084
452 Ga0495643_0004737 3300046522 Bacteria 9411
453 Ga0495598_0303022 3300046537 Bacteria 605
454 Ga0495623_0107631 3300046679 Bacteria 1693
455 Ga0495658_0792196 3300046683 Unclassified 607
456 Ga0495674_0098480 3300047319 Bacteria 2490
457 Ga0496100_0085415 3300048903 Unclassified 2142
458 Ga0496101_0336461 3300048904 Unclassified 1185
459 Ga0496102_0021433 3300048905 Bacteria 5714
460 Ga0496102_0211340 3300048905 Bacteria 1829
461 Ga0496103_0382415 3300048906 Unclassified 904
462 Ga0496104_0615527 3300048907 Unclassified 996
463 Ga0496106_1194720 3300048909 Bacteria 593
464 Ga0496106_1247154 3300048909 Unclassified 578
465 Ga0496107_0377844 3300048910 Bacteria 1054
466 Ga0496109_0371395 3300048912 Unclassified 1351
467 Ga0496112_0190408 3300048915 Unclassified 2013
468 Ga0501307_087270 3300049162 Unclassified 517
469 Ga0501291_120187 3300049514 Unclassified 569
470 Ga0501292_124425 3300049515 Bacteria 528
471 Ga0501315_075279 3300049531 Bacteria 566
472 Ga0501317_070841 3300049533 Unclassified 588
473 Ga0501320_016867 3300049536 Unclassified 812
474 Ga0501320_068540 3300049536 Unclassified 510
475 Ga0501325_059341 3300049541 Unclassified 502
476 Ga0501336_035427 3300049552 Unclassified 504
477 Ga0501031_0398281 3300049568 Bacteria 890
478 Ga0501032_0136983 3300049569 Bacteria 1613
479 Ga0501032_0262937 3300049569 Bacteria 1119
480 Ga0501032_0799288 3300049569 Bacteria 596
481 Ga0501033_0037831 3300049570 Unclassified 3610
482 Ga0501033_0466515 3300049570 Bacteria 876
483 Ga0501034_0510183 3300049571 Bacteria 1115
484 Ga0501034_0852450 3300049571 Unclassified 801
485 Ga0501036_0297063 3300049572 Bacteria 1351
486 Ga0501036_0352694 3300049572 Bacteria 1228
487 Ga0501036_0505386 3300049572 Bacteria 1006
488 Ga0501036_0648444 3300049572 Bacteria 874
489 Ga0501036_0842566 3300049572 Bacteria 754
490 Ga0501036_0852614 3300049572 Bacteria 749
491 Ga0501037_0130313 3300049573 Bacteria 1803
492 Ga0501037_0246983 3300049573 Unclassified 1250
493 Ga0501037_0249700 3300049573 Bacteria 1242
494 Ga0501038_0009435 3300049574 Bacteria 8955
495 Ga0501038_0094176 3300049574 Bacteria 2504
496 Ga0501038_0124901 3300049574 Bacteria 2119
497 Ga0501038_1032408 3300049574 Unclassified 602
498 Ga0501039_0219881 3300049575 Bacteria 1493
499 Ga0501039_0304233 3300049575 Bacteria 1253
500 Ga0501039_0405841 3300049575 Bacteria 1070
501 Ga0501039_1408506 3300049575 Bacteria 536
502 Ga0501040_0050995 3300049576 Bacteria 2831
503 Ga0501040_0070321 3300049576 Bacteria 2415
504 Ga0501040_0073049 3300049576 Bacteria 2370
505 Ga0501040_0094101 3300049576 Bacteria 2084
506 Ga0501040_0566535 3300049576 Bacteria 820
507 Ga0501040_0793171 3300049576 Bacteria 685
508 Ga0501041_0098512 3300049577 Bacteria 1808
509 Ga0501041_0123754 3300049577 Bacteria 1608
510 Ga0501041_0221188 3300049577 Bacteria 1188
511 Ga0501041_0335943 3300049577 Unclassified 954
512 Ga0501042_0024011 3300049578 Bacteria 4273
513 Ga0501042_0030726 3300049578 Bacteria 3797
514 Ga0501042_0137724 3300049578 Bacteria 1759
515 Ga0501042_0275207 3300049578 Bacteria 1215
516 Ga0501042_0526228 3300049578 Bacteria 859
517 Ga0501043_0176076 3300049579 Bacteria 1667
518 Ga0501043_1017564 3300049579 Bacteria 589
519 Ga0501046_0128112 3300049580 Bacteria 1926
520 Ga0501046_0417076 3300049580 Bacteria 968
521 Ga0501046_0915643 3300049580 Unclassified 611
522 Ga0501048_0011907 3300049582 Bacteria 6486
523 Ga0501048_0221789 3300049582 Bacteria 1341
524 Ga0501048_0305345 3300049582 Bacteria 1132
525 Ga0501048_0487102 3300049582 Bacteria 884
526 Ga0501067_0876513 3300049583 Bacteria 506
527 Ga0501068_0113168 3300049584 Bacteria 1688
528 Ga0501068_0173190 3300049584 Unclassified 1363
529 Ga0501068_0280858 3300049584 Bacteria 1064
530 Ga0501068_0512608 3300049584 Bacteria 778
531 Ga0501069_0095340 3300049585 Bacteria 1685
532 Ga0501070_0591540 3300049586 Bacteria 885
533 Ga0501070_0766282 3300049586 Bacteria 760
534 Ga0501070_0933660 3300049586 Bacteria 675
535 Ga0501071_0028350 3300049587 Bacteria 3946
536 Ga0501071_0032321 3300049587 Bacteria 3715
537 Ga0501071_0095385 3300049587 Bacteria 2189
538 Ga0501071_0123590 3300049587 Bacteria 1919
539 Ga0501071_0221483 3300049587 Bacteria 1424
540 Ga0501071_0386993 3300049587 Unclassified 1067
541 Ga0501071_0571381 3300049587 Bacteria 869
542 Ga0501072_0022761 3300049588 Unclassified 4863
543 Ga0501072_0023578 3300049588 Bacteria 4780
544 Ga0501072_0036993 3300049588 Bacteria 3829
545 Ga0501072_0104486 3300049588 Bacteria 2252
546 Ga0501072_0294765 3300049588 Bacteria 1289
547 Ga0501072_0377538 3300049588 Bacteria 1125
548 Ga0501072_0549188 3300049588 Unclassified 912
549 Ga0501072_1283760 3300049588 Bacteria 568
550 Ga0501072_1411048 3300049588 Bacteria 538
551 Ga0501073_0169741 3300049589 Bacteria 1510
552 Ga0501074_0113658 3300049590 Unclassified 1937
553 Ga0501074_0181534 3300049590 Bacteria 1501
554 Ga0501074_0240857 3300049590 Bacteria 1286
555 Ga0501074_0730496 3300049590 Bacteria 698
556 Ga0501074_0996783 3300049590 Bacteria 589
557 Ga0501075_0021328 3300049591 Bacteria 4721
558 Ga0501075_0089005 3300049591 Bacteria 2341
559 Ga0501075_0089646 3300049591 Bacteria 2332
560 Ga0501075_0331633 3300049591 Bacteria 1159
561 Ga0501075_0374526 3300049591 Bacteria 1085
562 Ga0501075_0386527 3300049591 Unclassified 1067
563 Ga0501075_0447170 3300049591 Unclassified 985
564 Ga0501075_0456807 3300049591 Bacteria 974
565 Ga0501075_1301308 3300049591 Unclassified 551
566 Ga0501075_1321447 3300049591 Bacteria 546
567 Ga0501076_0007570 3300049592 Bacteria 7905
568 Ga0501076_0070349 3300049592 Bacteria 2797
569 Ga0501076_0070593 3300049592 Bacteria 2793
570 Ga0501076_0312162 3300049592 Bacteria 1289
571 Ga0501076_0414499 3300049592 Bacteria 1108
572 Ga0501076_0563972 3300049592 Unclassified 939
573 Ga0501076_0656598 3300049592 Bacteria 865
574 Ga0501076_0659909 3300049592 Bacteria 863
575 Ga0501076_1560875 3300049592 Unclassified 542
576 Ga0501077_0017907 3300049593 Bacteria 4477
577 Ga0501077_0168697 3300049593 Bacteria 1391
578 Ga0501077_0974141 3300049593 Bacteria 546
579 Ga0501077_0991248 3300049593 Bacteria 541
580 Ga0501077_1067156 3300049593 Unclassified 520
581 Ga0501202_037547 3300049652 Bacteria 1035
582 Ga0501217_124934 3300049661 Bacteria 750
583 Ga0501233_004398 3300049668 Bacteria 2583
584 Ga0501233_035892 3300049668 Bacteria 1144
585 Ga0501233_215021 3300049668 Unclassified 565
586 Ga0501235_080697 3300049669 Unclassified 777
587 Ga0501253_020253 3300049683 Bacteria 1158
588 Ga0501253_181581 3300049683 Bacteria 547
589 Ga0501257_264677 3300049686 Bacteria 513
590 Ga0501261_090950 3300049690 Bacteria 567
591 Ga0501079_0046585 3300049741 Bacteria 3345
592 Ga0501079_0058797 3300049741 Unclassified 2967
593 Ga0501079_0166920 3300049741 Bacteria 1717
594 Ga0501079_0240103 3300049741 Bacteria 1416
595 Ga0501079_0365818 3300049741 Bacteria 1130
596 Ga0501079_1096589 3300049741 Bacteria 627
597 Ga0501080_0078012 3300049742 Unclassified 3081
598 Ga0501080_0285673 3300049742 Bacteria 1499
599 Ga0501080_0379381 3300049742 Bacteria 1274
600 Ga0501080_0381690 3300049742 Bacteria 1270
601 Ga0501080_0704649 3300049742 Bacteria 890
602 Ga0501080_0834846 3300049742 Unclassified 806
603 Ga0501081_0060981 3300049743 Bacteria 2615
604 Ga0501081_0064916 3300049743 Bacteria 2536
605 Ga0501081_0304896 3300049743 Bacteria 1168
606 Ga0501081_0695607 3300049743 Bacteria 763
607 Ga0501081_0707577 3300049743 Unclassified 756
608 Ga0501081_1428890 3300049743 Bacteria 525
609 Ga0501081_1472265 3300049743 Unclassified 517
610 Ga0501083_0152024 3300049744 Bacteria 1515
611 Ga0501083_0344309 3300049744 Bacteria 969
612 Ga0501083_0489865 3300049744 Unclassified 800
613 Ga0501083_0598374 3300049744 Bacteria 717
614 Ga0501266_038921 3300049763 Unclassified 702
615 Ga0501270_126691 3300049767 Unclassified 561
616 Ga0501272_043042 3300049769 Bacteria 608
617 Ga0501273_058508 3300049770 Unclassified 603
618 Ga0501283_014362 3300049779 Bacteria 1209
619 Ga0501035_0110640 3300049822 Unclassified 2407
620 Ga0501035_0321204 3300049822 Bacteria 1301
621 Ga0501044_0820280 3300049823 Bacteria 808
622 Ga0501045_0043317 3300049824 Bacteria 3277
623 Ga0501045_0104700 3300049824 Bacteria 2096
624 Ga0501045_0278838 3300049824 Bacteria 1244
625 Ga0501045_0292477 3300049824 Bacteria 1212
626 Ga0501045_0319493 3300049824 Bacteria 1155
627 Ga0501045_0324579 3300049824 Bacteria 1145
628 Ga0501045_0397317 3300049824 Bacteria 1026
629 Ga0501045_1420180 3300049824 Bacteria 504
630 Ga0501204_076236 3300049850 Bacteria 562
631 Ga0501212_100948 3300049851 Bacteria 542
632 nmdc:mga06z11_549999_c1 3300050494 Bacteria 701
633 nmdc:mga04h51_176098_c1 3300050495 Bacteria 830
634 nmdc:mga05p37_1200596_c1 3300050507 Unclassified 784
635 nmdc:mga05p37_1431_c1 3300050507 Bacteria 27718
636 nmdc:mga05p37_14385_c1 3300050507 Bacteria 9501
637 nmdc:mga05p37_32181_c1 3300050507 Bacteria 6413
638 nmdc:mga05p37_35887_c1 3300050507 Bacteria 6083
639 nmdc:mga05p37_546212_c1 3300050507 Bacteria 1320
640 nmdc:mga05p37_670474_c1 3300050507 Bacteria 1158
641 nmdc:mga05p37_7701_c1 3300050507 Bacteria 12708
642 nmdc:mga05p37_7758_c1 3300050507 Bacteria 12668
643 nmdc:mga09592_134896_c1 3300050508 Bacteria 2126
644 nmdc:mga09592_279956_c1 3300050508 Bacteria 1447
645 nmdc:mga09592_572762_c1 3300050508 Unclassified 969
646 nmdc:mga0qj67_2107_c1 3300050509 Bacteria 14176
647 nmdc:mga0qj67_22280_c1 3300050509 Unclassified 4866
648 nmdc:mga0qj67_49170_c1 3300050509 Bacteria 3333
649 nmdc:mga0qj67_633558_c1 3300050509 Unclassified 854
650 nmdc:mga06r32_102832_c1 3300050510 Bacteria 2805
651 nmdc:mga06r32_148304_c1 3300050510 Bacteria 2323
652 nmdc:mga06r32_50060_c1 3300050510 Unclassified 3996
653 nmdc:mga06r32_503177_c1 3300050510 Bacteria 1188
654 nmdc:mga06r32_660984_c1 3300050510 Unclassified 1013
655 nmdc:mga08y16_159524_c1 3300050511 Bacteria 2343
656 nmdc:mga08y16_1714413_c1 3300050511 Bacteria 583
657 nmdc:mga08y16_1864_c1 3300050511 Bacteria 21429
658 nmdc:mga08y16_453603_c1 3300050511 Bacteria 1307
659 nmdc:mga0n895_65852_c1 3300050512 Bacteria 3587
660 nmdc:mga0n895_72520_c1 3300050512 Bacteria 3416
661 nmdc:mga0rr50_136675_c1 3300050513 Bacteria 1968
662 nmdc:mga0rr50_40565_c1 3300050513 Bacteria 3386
663 nmdc:mga08x19_436031_c1 3300050514 Bacteria 921
664 nmdc:mga0a205_174852_c1 3300050515 Unclassified 2043
665 nmdc:mga0a205_299359_c1 3300050515 Bacteria 1482
666 nmdc:mga0a205_41857_c1 3300050515 Bacteria 4413
667 nmdc:mga0a205_87169_c1 3300050515 Unclassified 3016
668 Ga0495601_0229237 3300053077 Bacteria 1213
669 Ga0495595_0292068 3300053084 Bacteria 819
670 Ga0495619_1050087 3300053085 Unclassified 543
671 Ga0501084_0069837 3300054114 Bacteria 2941
672 Ga0501084_0110725 3300054114 Bacteria 2307
673 Ga0501084_0231060 3300054114 Bacteria 1561
674 Ga0501084_0295201 3300054114 Bacteria 1369
675 Ga0501084_0545694 3300054114 Bacteria 979
676 Ga0501084_1589235 3300054114 Unclassified 547
677 Ga0501084_1811598 3300054114 Unclassified 510
678 Ga0590071_001774 3300059421 Bacteria 5571
679 Ga0590071_011932 3300059421 Bacteria 2036
680 Ga0590071_087786 3300059421 Bacteria 777
681 Ga0590075_000359 3300059424 Bacteria 12620
682 Ga0590075_110226 3300059424 Unclassified 718
683 Ga0590075_202660 3300059424 Bacteria 525
684 Ga0590077_000171 3300059426 Bacteria 18248
685 Ga0587085_128548 3300059506 Unclassified 564
686 Ga0587085_183651 3300059506 Bacteria 503
687 Ga0587091_086180 3300059511 Unclassified 714
688 Ga0587092_131636 3300059512 Unclassified 544
689 Ga0587128_002469 3300059630 Bacteria 1931
690 Ga0587062_055428 3300059639 Bacteria 682
691 Ga0587072_138063 3300059643 Unclassified 579
692 Ga0587107_019575 3300059652 Unclassified 930
693 Ga0587119_052555 3300059658 Unclassified 612
694 Ga0587111_0268034 3300060346 Unclassified 511
695 Ga0501082_0055453 3300060353 Bacteria 3414
696 Ga0501082_0076768 3300060353 Bacteria 2880
697 Ga0501082_0120235 3300060353 Bacteria 2277
698 Ga0501082_0181271 3300060353 Unclassified 1832
699 Ga0501082_0370686 3300060353 Bacteria 1249
700 Ga0501082_1343288 3300060353 Bacteria 624
701 Ga0530510_0032053 3300061734 Bacteria 3779
702 Ga0530510_0066105 3300061734 Bacteria 2621
703 Ga0530510_0391043 3300061734 Bacteria 1047
704 Ga0530510_0444900 3300061734 Bacteria 979
705 Ga0530510_0467460 3300061734 Bacteria 954
706 Ga0530510_0572667 3300061734 Bacteria 858
707 Ga0530510_0641764 3300061734 Unclassified 808
708 Ga0114129_10000108
709 JGI24751J29686_10022043
710 rootL2_10084844
711 Ga0007429J51699_1031697
712 Ga0032354_1023873
713 Ga0032354_1069567
714 Ga0058863_11770274
715 Ga0058860_10038317
716 Ga0058860_12191695
717 Ga0065715_10016006
718 Ga0065715_11187906
719 Ga0065707_10191511
720 Ga0065707_10444521
721 Ga0070676_10171884
722 Ga0070683_101037738
723 Ga0070690_100061669
724 Ga0070690_100201567
725 Ga0070690_100219113
726 Ga0070677_10162402
727 Ga0070677_10246974
728 Ga0068869_100001674
729 Ga0068869_100410367
730 Ga0070666_10707800
731 Ga0070666_10974504
732 Ga0070680_100080493
733 Ga0070680_101437142
734 Ga0070682_100774650
735 Ga0070682_100993087
736 Ga0070682_101683982
737 Ga0068868_100660301
738 Ga0068868_100815873
739 Ga0070660_100396098
740 Ga0070660_100421828
741 Ga0070689_100197218
742 Ga0070689_101287585
743 Ga0070691_10084898
744 Ga0070691_10312296
745 Ga0070691_10352081
746 Ga0070687_100005613
747 Ga0070687_100032707
748 Ga0070661_100250350
749 Ga0070661_101120393
750 Ga0070661_101125079
751 Ga0070692_10438670
752 Ga0070668_100544169
753 Ga0070669_100059046
754 Ga0070669_100095918
755 Ga0070675_100003298
756 Ga0070675_100462629
757 Ga0070675_101165299
758 Ga0070671_100003192
759 Ga0070671_100125111
760 Ga0070674_100061558
761 Ga0070673_100007029
762 Ga0070673_100008047
763 Ga0070673_100030664
764 Ga0070673_100348703
765 Ga0070659_100030095
766 Ga0070659_100734893
767 Ga0070667_101298210
768 Ga0070709_10395092
769 Ga0070709_10737456
770 Ga0070713_100010625
771 Ga0070713_100660089
772 Ga0070701_10140980
773 Ga0070701_10663021
774 Ga0070711_101124712
775 Ga0070705_100039072
776 Ga0070700_100023523
777 Ga0070700_101115243
778 Ga0070700_101809435
779 Ga0070694_101705383
780 Ga0070663_101129575
781 Ga0070678_100027465
782 Ga0070678_101103254
783 Ga0070662_100322602
784 Ga0070662_100909011
785 Ga0070681_10016257
786 Ga0070681_10058263
787 Ga0070681_10364088
788 Ga0068867_100001597
789 Ga0068867_100039709
790 Ga0070685_10297435
791 Ga0070706_100353372
792 Ga0070707_100025801
793 Ga0070707_100356585
794 Ga0070698_100091463
795 Ga0070698_100435061
796 Ga0070698_100522805
797 Ga0070699_101528832
798 Ga0070699_101631306
799 Ga0070679_100108978
800 Ga0070697_100058323
801 Ga0070697_101530310
802 Ga0068853_100933488
803 Ga0068853_102477963
804 Ga0070672_100001819
805 Ga0070672_100018874
806 Ga0070672_100162737
807 Ga0070686_100042129
808 Ga0070686_100062156
809 Ga0070686_100173598
810 Ga0070695_100230477
811 Ga0070695_100236216
812 Ga0070695_100593218
813 Ga0070695_101629377
814 Ga0070696_101083633
815 Ga0070693_100073368
816 Ga0070693_100098783
817 Ga0070665_101201309
818 Ga0070704_100249258
819 Ga0068855_100121726
820 Ga0070664_100021383
821 Ga0068857_100433049
822 Ga0068857_100445299
823 Ga0068854_100280881
824 Ga0068854_100363515
825 Ga0068856_100867038
826 Ga0068856_101986975
827 Ga0070702_100006598
828 Ga0070702_100078746
829 Ga0068852_101720111
830 Ga0068859_100036569
831 Ga0068859_100291034
832 Ga0068864_100183871
833 Ga0068864_100291514
834 Ga0068864_100350842
835 Ga0068866_10280122
836 Ga0068861_100301086
837 Ga0068861_100403355
838 Ga0068861_102534306
839 Ga0068870_10172997
840 Ga0068870_10208516
841 Ga0068863_100225097
842 Ga0068863_102389584
843 Ga0068858_100031356
844 Ga0068860_100039032
845 Ga0068860_100376546
846 Ga0068862_101510654
847 Ga0081538_10104394
848 Ga0081538_10265635
849 Ga0081538_10358995
850 Ga0070716_101561458
851 Ga0075367_10388341
852 Ga0097621_100411119
853 Ga0068871_100213179
854 Ga0068871_100534694
855 Ga0075428_100002414
856 Ga0075428_100012091
857 Ga0075428_100013706
858 Ga0075430_100005581
859 Ga0075430_100055669
860 Ga0075430_100073011
861 Ga0075430_100685456
862 Ga0075430_100803468
863 Ga0075430_101518730
864 Ga0075431_100037021
865 Ga0075431_100052713
866 Ga0075431_100089620
867 Ga0075431_100119432
868 Ga0075431_100956950
869 Ga0075433_10012184
870 Ga0075433_10032242
871 Ga0075433_10167145
872 Ga0075433_10179068
873 Ga0075434_100053167
874 Ga0075434_100190575
875 Ga0075434_100281975
876 Ga0075434_100380259
877 Ga0075434_100438355
878 Ga0075429_100004168
879 Ga0075429_100028977
880 Ga0075429_100200964
881 Ga0068865_100024604
882 Ga0068865_100237179
883 Ga0075436_100458265
884 Ga0097620_100036568
885 Ga0097620_100291031
886 Ga0075435_100002272
887 Ga0075435_100061311
888 Ga0075435_100191544
889 Ga0105240_10282156
890 Ga0105240_10650625
891 Ga0111539_10002069
892 Ga0111539_10190074
893 Ga0111539_11444706
894 Ga0111539_11762540
895 Ga0111539_11905564
896 Ga0111539_12185067
897 Ga0111539_12819318
898 Ga0111539_13402790
899 Ga0105245_10102895
900 Ga0105245_10909590
901 Ga0105247_10745339
902 Ga0114129_10001729
903 Ga0114129_10006049
904 Ga0114129_10014363
905 Ga0114129_10045184
906 Ga0114129_10069154
907 Ga0114129_10660749
908 Ga0114129_10674367
909 Ga0114129_11051161
910 Ga0114129_12329636
911 Ga0105243_10023921
912 Ga0105243_10861816
913 Ga0105243_10880381
914 Ga0105241_10032705
915 Ga0105241_10378402
916 Ga0105242_10004553
917 Ga0105242_10031487
918 Ga0105248_10141249
919 Ga0105248_10301462
920 Ga0105248_11296568
921 Ga0105248_11393406
922 Ga0105238_10704008
923 Ga0105238_12452573
924 Ga0105249_10384371
925 Ga0105249_11136173
926 Ga0105239_10749446
927 Ga0105239_11131389
928 Ga0105239_11511107
929 Ga0105246_10027680
930 Ga0157370_10350413
931 Ga0157369_10872825
932 Ga0157374_11345868
933 Ga0157378_10103101
934 Ga0157378_10217193
935 Ga0163162_11203185
936 Ga0157372_10294183
937 Ga0157372_10989019
938 Ga0157375_10475973
939 Ga0163163_10067487
940 Ga0163163_12933670
941 Ga0157380_10037696
942 Ga0157380_10112192
943 Ga0157380_10887399
944 Ga0157380_11601320
945 Ga0157377_10045177
946 Ga0157376_11381310
947 Ga0157376_11825767
948 Ga0163161_10859478
949 Ga0163161_11010897
950 Ga0206356_10232510
951 Ga0206356_11185460
952 Ga0207682_10018981
953 Ga0207682_10179880
954 Ga0207642_10359933
955 Ga0207710_10712391
956 Ga0207688_10011198
957 Ga0207647_10116730
958 Ga0207699_10488517
959 Ga0207699_10847544
960 Ga0207645_10002224
961 Ga0207645_10021376
962 Ga0207645_10797123
963 Ga0207643_10152707
964 Ga0207643_10262774
965 Ga0207684_11561969
966 Ga0207654_10016288
967 Ga0207707_10255144
968 Ga0207707_10315235
969 Ga0207707_10861562
970 Ga0207695_10656391
971 Ga0207695_11159929
972 Ga0207695_11530782
973 Ga0207693_10243868
974 Ga0207663_10247707
975 Ga0207660_10093558
976 Ga0207662_10006368
977 Ga0207662_10088825
978 Ga0207657_10192107
979 Ga0207657_10346381
980 Ga0207649_10744983
981 Ga0207652_10166919
982 Ga0207652_11437341
983 Ga0207646_10405675
984 Ga0207681_10012902
985 Ga0207681_11373618
986 Ga0207681_11510043
987 Ga0207694_10633826
988 Ga0207650_10220718
989 Ga0207659_10004161
990 Ga0207659_10508070
991 Ga0207659_11135061
992 Ga0207687_10966925
993 Ga0207700_10172364
994 Ga0207644_10112774
995 Ga0207644_10287894
996 Ga0207690_10324881
997 Ga0207706_10137407
998 Ga0207686_10030357
999 Ga0207686_10047658
1000 Ga0207709_10018302
1001 Ga0207669_10002689
1002 Ga0207669_10008948
1003 Ga0207704_10025065
1004 Ga0207704_10422441
1005 Ga0207704_11743583
1006 Ga0207691_10030277
1007 Ga0207691_10069390
1008 Ga0207711_10605492
1009 Ga0207711_11332750
1010 Ga0207711_11760315
1011 Ga0207689_10000575
1012 Ga0207689_10045260
1013 Ga0207689_10268908
1014 Ga0207689_10479671
1015 Ga0207679_10064923
1016 Ga0207679_10818388
1017 Ga0207679_11106468
1018 Ga0207651_10015429
1019 Ga0207651_10028373
1020 Ga0207651_10053832
1021 Ga0207651_10164609
1022 Ga0207712_10590914
1023 Ga0207712_11588707
1024 Ga0207640_10163432
1025 Ga0207640_10231184
1026 Ga0207658_10395372
1027 Ga0207677_10582964
1028 Ga0207703_10326767
1029 Ga0207708_10017092
1030 Ga0207708_11465526
1031 Ga0207702_10682772
1032 Ga0207641_10124960
1033 Ga0207641_10241316
1034 Ga0207641_12559622
1035 Ga0207648_10003018
1036 Ga0207648_10018781
1037 Ga0207676_10014129
1038 Ga0207676_10133678
1039 Ga0207676_10280060
1040 Ga0207674_10369447
1041 Ga0207674_11248021
1042 Ga0207675_100026353
1043 Ga0207675_100047690
1044 Ga0207675_100976508
1045 Ga0207675_101690629
1046 Ga0207675_102155464
1047 Ga0207675_102639144
1048 Ga0207683_10049436
1049 Ga0207683_10167708
1050 Ga0207683_10221631
1051 Ga0207698_11433681
1052 Ga0207698_11672620
1053 Ga0209967_1078416
1054 Ga0210002_1016288
1055 Ga0209983_1059836
1056 Ga0209971_1009574
1057 Ga0209971_1149676
1058 Ga0209974_10004233
1059 Ga0207428_10001602
1060 Ga0268264_10044498
1061 Ga0268264_10393724
1062 Ga0268264_10892336
1063 Ga0316182_1119089
1064 Ga0307408_100060340
1065 Ga0307408_100077797
1066 Ga0307408_100247512
1067 Ga0307408_100328190
1068 Ga0307408_101089981
1069 Ga0307408_101113427
1070 Ga0307408_101275919
1071 Ga0307408_102034862
1072 Ga0307408_102147642
1073 Ga0307405_10032778
1074 Ga0307405_10076533
1075 Ga0307405_10740983
1076 Ga0307413_10665829
1077 Ga0307413_11192191
1078 Ga0307413_11278635
1079 Ga0307413_11706552
1080 Ga0307413_12142709
1081 Ga0307410_11039893
1082 Ga0307410_11204030
1083 Ga0307410_11892514
1084 Ga0307406_10088574
1085 Ga0307406_10191217
1086 Ga0307406_11137253
1087 Ga0307407_10105628
1088 Ga0307407_10425417
1089 Ga0307407_11541064
1090 Ga0307412_10332287
1091 Ga0307412_10378723
1092 Ga0307412_10640290
1093 Ga0307409_100410631
1094 Ga0307409_100586330
1095 Ga0307409_100811134
1096 Ga0307409_101015425
1097 Ga0307409_101580431
1098 Ga0307409_101901164
1099 Ga0307416_100008497
1100 Ga0307416_100034119
1101 Ga0307416_100144668
1102 Ga0307416_100567721
1103 Ga0307416_101025052
1104 Ga0307416_103709468
1105 Ga0307414_10130948
1106 Ga0307411_10003896
1107 Ga0307411_10146191
1108 Ga0307411_10485379
1109 Ga0307411_10494413
1110 Ga0307411_10726025
1111 Ga0307411_11008001
1112 Ga0307411_11909086
1113 Ga0307415_100070743
1114 Ga0307415_100791876
1115 Ga0373930_0186793
1116 Ga0373958_0129588
1117 Ga0373959_0014428
1118 Ga0373926_0046374
1119 Ga0373929_0053848
1120 Ga0373940_0060862
1121 Ga0373944_0045344
1122 Ga0373941_0305604
1123 Ga0373960_0060413
1124 Ga0373943_0141942
1125 Ga0373946_0321930
1126 Ga0373955_0746693
1127 Ga0373942_0167540
1128 Ga0373931_0161719
1129 Ga0373931_0590058
1130 Ga0373935_0244852
1131 Ga0373935_0869004
1132 Ga0373933_0047765
1133 Ga0373933_0371422
1134 Ga0373947_0626472
1135 Ga0373937_0058112
1136 Ga0373937_0064114
1137 Ga0373925_0095224
1138 Ga0373925_1318097
1139 Ga0439453_0027317
1140 Ga0451807_1884642
1141 Ga0451853_3503131
1142 Ga0439450_008296
1143 Ga0450890_090191
1144 Ga0439446_0037412
1145 Ga0439446_0100387
1146 Ga0439446_0341363
1147 Ga0439435_0122703
1148 Ga0439444_0019270
1149 Ga0439444_0170571
1150 Ga0439464_0000364
1151 Ga0439460_0025770
1152 Ga0439460_0065914
1153 Ga0451577_1440980
1154 Ga0451576_0271573
1155 Ga0466967_0055727
1156 Ga0466967_1298342
1157 Ga0495580_0228182
1158 Ga0495608_0258654
1159 Ga0495643_0004737
1160 Ga0495598_0303022
1161 Ga0495623_0107631
1162 Ga0495658_0792196
1163 Ga0495674_0098480
1164 Ga0496100_0085415
1165 Ga0496101_0336461
1166 Ga0496102_0021433
1167 Ga0496102_0211340
1168 Ga0496103_0382415
1169 Ga0496104_0615527
1170 Ga0496106_1194720
1171 Ga0496106_1247154
1172 Ga0496107_0377844
1173 Ga0496109_0371395
1174 Ga0496112_0190408
1175 Ga0501307_087270
1176 Ga0501291_120187
1177 Ga0501292_124425
1178 Ga0501315_075279
1179 Ga0501317_070841
1180 Ga0501320_016867
1181 Ga0501320_068540
1182 Ga0501325_059341
1183 Ga0501336_035427
1184 Ga0501031_0398281
1185 Ga0501032_0136983
1186 Ga0501032_0262937
1187 Ga0501032_0799288
1188 Ga0501033_0037831
1189 Ga0501033_0466515
1190 Ga0501034_0510183
1191 Ga0501034_0852450
1192 Ga0501036_0297063
1193 Ga0501036_0352694
1194 Ga0501036_0505386
1195 Ga0501036_0648444
1196 Ga0501036_0842566
1197 Ga0501036_0852614
1198 Ga0501037_0130313
1199 Ga0501037_0246983
1200 Ga0501037_0249700
1201 Ga0501038_0009435
1202 Ga0501038_0094176
1203 Ga0501038_0124901
1204 Ga0501038_1032408
1205 Ga0501039_0219881
1206 Ga0501039_0304233
1207 Ga0501039_0405841
1208 Ga0501039_1408506
1209 Ga0501040_0050995
1210 Ga0501040_0070321
1211 Ga0501040_0073049
1212 Ga0501040_0094101
1213 Ga0501040_0566535
1214 Ga0501040_0793171
1215 Ga0501041_0098512
1216 Ga0501041_0123754
1217 Ga0501041_0221188
1218 Ga0501041_0335943
1219 Ga0501042_0024011
1220 Ga0501042_0030726
1221 Ga0501042_0137724
1222 Ga0501042_0275207
1223 Ga0501042_0526228
1224 Ga0501043_0176076
1225 Ga0501043_1017564
1226 Ga0501046_0128112
1227 Ga0501046_0417076
1228 Ga0501046_0915643
1229 Ga0501048_0011907
1230 Ga0501048_0221789
1231 Ga0501048_0305345
1232 Ga0501048_0487102
1233 Ga0501067_0876513
1234 Ga0501068_0113168
1235 Ga0501068_0173190
1236 Ga0501068_0280858
1237 Ga0501068_0512608
1238 Ga0501069_0095340
1239 Ga0501070_0591540
1240 Ga0501070_0766282
1241 Ga0501070_0933660
1242 Ga0501071_0028350
1243 Ga0501071_0032321
1244 Ga0501071_0095385
1245 Ga0501071_0123590
1246 Ga0501071_0221483
1247 Ga0501071_0386993
1248 Ga0501071_0571381
1249 Ga0501072_0022761
1250 Ga0501072_0023578
1251 Ga0501072_0036993
1252 Ga0501072_0104486
1253 Ga0501072_0294765
1254 Ga0501072_0377538
1255 Ga0501072_0549188
1256 Ga0501072_1283760
1257 Ga0501072_1411048
1258 Ga0501073_0169741
1259 Ga0501074_0113658
1260 Ga0501074_0181534
1261 Ga0501074_0240857
1262 Ga0501074_0730496
1263 Ga0501074_0996783
1264 Ga0501075_0021328
1265 Ga0501075_0089005
1266 Ga0501075_0089646
1267 Ga0501075_0331633
1268 Ga0501075_0374526
1269 Ga0501075_0386527
1270 Ga0501075_0447170
1271 Ga0501075_0456807
1272 Ga0501075_1301308
1273 Ga0501075_1321447
1274 Ga0501076_0007570
1275 Ga0501076_0070349
1276 Ga0501076_0070593
1277 Ga0501076_0312162
1278 Ga0501076_0414499
1279 Ga0501076_0563972
1280 Ga0501076_0656598
1281 Ga0501076_0659909
1282 Ga0501076_1560875
1283 Ga0501077_0017907
1284 Ga0501077_0168697
1285 Ga0501077_0974141
1286 Ga0501077_0991248
1287 Ga0501077_1067156
1288 Ga0501202_037547
1289 Ga0501217_124934
1290 Ga0501233_004398
1291 Ga0501233_035892
1292 Ga0501233_215021
1293 Ga0501235_080697
1294 Ga0501253_020253
1295 Ga0501253_181581
1296 Ga0501257_264677
1297 Ga0501261_090950
1298 Ga0501079_0046585
1299 Ga0501079_0058797
1300 Ga0501079_0166920
1301 Ga0501079_0240103
1302 Ga0501079_0365818
1303 Ga0501079_1096589
1304 Ga0501080_0078012
1305 Ga0501080_0285673
1306 Ga0501080_0379381
1307 Ga0501080_0381690
1308 Ga0501080_0704649
1309 Ga0501080_0834846
1310 Ga0501081_0060981
1311 Ga0501081_0064916
1312 Ga0501081_0304896
1313 Ga0501081_0695607
1314 Ga0501081_0707577
1315 Ga0501081_1428890
1316 Ga0501081_1472265
1317 Ga0501083_0152024
1318 Ga0501083_0344309
1319 Ga0501083_0489865
1320 Ga0501083_0598374
1321 Ga0501266_038921
1322 Ga0501270_126691
1323 Ga0501272_043042
1324 Ga0501273_058508
1325 Ga0501283_014362
1326 Ga0501035_0110640
1327 Ga0501035_0321204
1328 Ga0501044_0820280
1329 Ga0501045_0043317
1330 Ga0501045_0104700
1331 Ga0501045_0278838
1332 Ga0501045_0292477
1333 Ga0501045_0319493
1334 Ga0501045_0324579
1335 Ga0501045_0397317
1336 Ga0501045_1420180
1337 Ga0501204_076236
1338 Ga0501212_100948
1339 nmdc:mga06z11_549999_c1
1340 nmdc:mga04h51_176098_c1
1341 nmdc:mga05p37_1200596_c1
1342 nmdc:mga05p37_1431_c1
1343 nmdc:mga05p37_14385_c1
1344 nmdc:mga05p37_32181_c1
1345 nmdc:mga05p37_35887_c1
1346 nmdc:mga05p37_546212_c1
1347 nmdc:mga05p37_670474_c1
1348 nmdc:mga05p37_7701_c1
1349 nmdc:mga05p37_7758_c1
1350 nmdc:mga09592_134896_c1
1351 nmdc:mga09592_279956_c1
1352 nmdc:mga09592_572762_c1
1353 nmdc:mga0qj67_2107_c1
1354 nmdc:mga0qj67_22280_c1
1355 nmdc:mga0qj67_49170_c1
1356 nmdc:mga0qj67_633558_c1
1357 nmdc:mga06r32_102832_c1
1358 nmdc:mga06r32_148304_c1
1359 nmdc:mga06r32_50060_c1
1360 nmdc:mga06r32_503177_c1
1361 nmdc:mga06r32_660984_c1
1362 nmdc:mga08y16_159524_c1
1363 nmdc:mga08y16_1714413_c1
1364 nmdc:mga08y16_1864_c1
1365 nmdc:mga08y16_453603_c1
1366 nmdc:mga0n895_65852_c1
1367 nmdc:mga0n895_72520_c1
1368 nmdc:mga0rr50_136675_c1
1369 nmdc:mga0rr50_40565_c1
1370 nmdc:mga08x19_436031_c1
1371 nmdc:mga0a205_174852_c1
1372 nmdc:mga0a205_299359_c1
1373 nmdc:mga0a205_41857_c1
1374 nmdc:mga0a205_87169_c1
1375 Ga0495601_0229237
1376 Ga0495595_0292068
1377 Ga0495619_1050087
1378 Ga0501084_0069837
1379 Ga0501084_0110725
1380 Ga0501084_0231060
1381 Ga0501084_0295201
1382 Ga0501084_0545694
1383 Ga0501084_1589235
1384 Ga0501084_1811598
1385 Ga0590071_001774
1386 Ga0590071_011932
1387 Ga0590071_087786
1388 Ga0590075_000359
1389 Ga0590075_110226
1390 Ga0590075_202660
1391 Ga0590077_000171
1392 Ga0587085_128548
1393 Ga0587085_183651
1394 Ga0587091_086180
1395 Ga0587092_131636
1396 Ga0587128_002469
1397 Ga0587062_055428
1398 Ga0587072_138063
1399 Ga0587107_019575
1400 Ga0587119_052555
1401 Ga0587111_0268034
1402 Ga0501082_0055453
1403 Ga0501082_0076768
1404 Ga0501082_0120235
1405 Ga0501082_0181271
1406 Ga0501082_0370686
1407 Ga0501082_1343288
1408 Ga0530510_0032053
1409 Ga0530510_0066105
1410 Ga0530510_0391043
1411 Ga0530510_0444900
1412 Ga0530510_0467460
1413 Ga0530510_0572667
1414 Ga0530510_0641764

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

50

97

0.97

Map