F476527

General Info

Members Datasets Scaffolds Average Seq Length
707 374 1414 233

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100245697|Ga0070707_1002456972
Length 279
Sequence MPGLVPGIHVFFLRAAKTWMAGTRLRQGFAGLSSVSPPKLQRRRATPAMTRTAIDIARHSSLNIAGVQLIADLSGALFWEEQSLLVVSDLHLEKGSSFAERGVLLPPYDTVATLGRLAAVIARHDPRMVIALGDSFHDGDAHGRLSAPDRDTIAALQARRDWIWISGNHDPALPSDLGGVVAHEVAIGPIAFRHEPTGAVGEIAGHLHPKARVTRRGRSMERRCFACDGERAVMPAFGAYTGGLSIRDAAFSKIFQTLGFMAHVLGDTRLHSIAASRCY

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
82 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
316 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
317 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
322 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
323 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
328 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
329 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
333 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
334 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
337 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
338 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
343 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
344 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
345 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
346 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
347 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
348 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
349 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
350 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
351 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
352 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
353 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
354 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
355 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
356 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
357 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
358 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
359 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
360 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
361 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
362 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
363 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
364 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
365 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
366 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
367 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
368 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
369 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
370 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
371 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
372 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
373 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
374 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 4.81
Rhizoplane 7.07
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100245697 3300005468 Bacteria 1742
2 JGI25406J46586_10001899 3300003203 Bacteria 9844
3 rootL2_10105425 3300003322 Bacteria 3429
4 JGI25404J52841_10006198 3300003659 Bacteria 2493
5 JGI25404J52841_10038981 3300003659 Bacteria 1007
6 JGI25405J52794_10060300 3300003911 Bacteria 820
7 Ga0065165_1053946 3300005262 Bacteria 1129
8 Ga0070658_10114391 3300005327 Bacteria 2237
9 Ga0070658_10406953 3300005327 Bacteria 1169
10 Ga0070676_10051005 3300005328 Bacteria 2428
11 Ga0070683_100027504 3300005329 Bacteria 5129
12 Ga0068869_100085739 3300005334 Bacteria 2359
13 Ga0068869_100098901 3300005334 Bacteria 2204
14 Ga0070680_100004471 3300005336 Bacteria 10531
15 Ga0070680_100015683 3300005336 Bacteria 5947
16 Ga0070680_100027630 3300005336 Bacteria 4544
17 Ga0070682_100021862 3300005337 Bacteria 3782
18 Ga0068868_100100143 3300005338 Bacteria 2344
19 Ga0068868_100812249 3300005338 Bacteria 844
20 Ga0070660_100011280 3300005339 Bacteria 6344
21 Ga0070661_100133686 3300005344 Bacteria 1865
22 Ga0070668_100074150 3300005347 Bacteria 2654
23 Ga0070668_100074634 3300005347 Bacteria 2646
24 Ga0070668_100174572 3300005347 Bacteria 1751
25 Ga0070669_100182256 3300005353 Bacteria 1643
26 Ga0070675_100135361 3300005354 Bacteria 2102
27 Ga0070674_100049651 3300005356 Bacteria 2885
28 Ga0070673_100679915 3300005364 Bacteria 944
29 Ga0070688_100536117 3300005365 Bacteria 888
30 Ga0070659_100030798 3300005366 Bacteria 4152
31 Ga0070667_100224849 3300005367 Bacteria 1671
32 Ga0070667_100245228 3300005367 Bacteria 1600
33 Ga0070709_10000703 3300005434 Bacteria 19058
34 Ga0070709_10220578 3300005434 Bacteria 1352
35 Ga0070714_100025069 3300005435 Bacteria 4919
36 Ga0070714_100043155 3300005435 Bacteria 3812
37 Ga0070714_100199955 3300005435 Bacteria 1828
38 Ga0070713_100007431 3300005436 Bacteria 7690
39 Ga0070713_100028086 3300005436 Bacteria 4439
40 Ga0070713_100028990 3300005436 Bacteria 4377
41 Ga0070713_100032531 3300005436 Bacteria 4166
42 Ga0070713_100032964 3300005436 Bacteria 4144
43 Ga0070713_100100983 3300005436 Bacteria 2498
44 Ga0070710_10000433 3300005437 Bacteria 19650
45 Ga0070710_10003825 3300005437 Bacteria 7115
46 Ga0070710_10209613 3300005437 Bacteria 1235
47 Ga0070711_100001124 3300005439 Bacteria 14297
48 Ga0070711_100002295 3300005439 Bacteria 10842
49 Ga0070711_100010761 3300005439 Bacteria 5672
50 Ga0070663_100067227 3300005455 Bacteria 2599
51 Ga0070663_100108291 3300005455 Bacteria 2084
52 Ga0070663_100178279 3300005455 Bacteria 1646
53 Ga0070678_100011192 3300005456 Bacteria 5524
54 Ga0070678_100250924 3300005456 Bacteria 1484
55 Ga0070678_100310367 3300005456 Bacteria 1344
56 Ga0070678_100512825 3300005456 Bacteria 1060
57 Ga0070662_100068013 3300005457 Bacteria 2617
58 Ga0070681_10025346 3300005458 Bacteria 5965
59 Ga0070681_10281851 3300005458 Bacteria 1572
60 Ga0068867_100079294 3300005459 Bacteria 2471
61 Ga0070706_100023481 3300005467 Bacteria 5679
62 Ga0070706_100120469 3300005467 Bacteria 2446
63 Ga0070707_100046304 3300005468 Bacteria 4163
64 Ga0070698_100026724 3300005471 Bacteria 6005
65 Ga0070679_100006230 3300005530 Bacteria 11111
66 Ga0070679_100060318 3300005530 Bacteria 3780
67 Ga0070679_100069911 3300005530 Bacteria 3502
68 Ga0070684_100060624 3300005535 Bacteria 3310
69 Ga0070684_100065643 3300005535 Bacteria 3185
70 Ga0070684_100075342 3300005535 Bacteria 2976
71 Ga0070697_100008119 3300005536 Bacteria 8189
72 Ga0070697_100234595 3300005536 Bacteria 1566
73 Ga0068853_100261279 3300005539 Bacteria 1592
74 Ga0068853_100303368 3300005539 Bacteria 1477
75 Ga0068853_100592235 3300005539 Bacteria 1053
76 Ga0070696_100231388 3300005546 Bacteria 1391
77 Ga0070693_100067782 3300005547 Bacteria 2093
78 Ga0070693_100182371 3300005547 Bacteria 1352
79 Ga0070665_100017188 3300005548 Bacteria 7256
80 Ga0070665_100129158 3300005548 Bacteria 2529
81 Ga0070665_100272231 3300005548 Bacteria 1695
82 Ga0070665_100321863 3300005548 Bacteria 1551
83 Ga0070665_100623557 3300005548 Bacteria 1091
84 Ga0070704_100791700 3300005549 Bacteria 847
85 Ga0068855_100142231 3300005563 Bacteria 2733
86 Ga0068855_100490382 3300005563 Bacteria 1336
87 Ga0068855_100492116 3300005563 Bacteria 1334
88 Ga0068857_100056152 3300005577 Bacteria 3494
89 Ga0068857_100997611 3300005577 Bacteria 806
90 Ga0068854_100135825 3300005578 Bacteria 1882
91 Ga0068854_100666609 3300005578 Bacteria 895
92 Ga0068856_100902315 3300005614 Bacteria 903
93 Ga0068852_100081767 3300005616 Bacteria 2868
94 Ga0068852_100320748 3300005616 Bacteria 1504
95 Ga0068852_100346411 3300005616 Bacteria 1449
96 Ga0068859_100501793 3300005617 Bacteria 1308
97 Ga0068864_100250295 3300005618 Bacteria 1645
98 Ga0068861_100129130 3300005719 Bacteria 2049
99 Ga0068861_100147030 3300005719 Bacteria 1929
100 Ga0068861_100216408 3300005719 Bacteria 1616
101 Ga0068861_100346437 3300005719 Bacteria 1302
102 Ga0068870_10121632 3300005840 Bacteria 1504
103 Ga0068863_100195006 3300005841 Bacteria 1947
104 Ga0068863_100239438 3300005841 Bacteria 1751
105 Ga0068863_100334841 3300005841 Bacteria 1472
106 Ga0068863_100572268 3300005841 Bacteria 1117
107 Ga0068858_100083847 3300005842 Bacteria 2964
108 Ga0068858_100868171 3300005842 Bacteria 882
109 Ga0068860_100002174 3300005843 Bacteria 20643
110 Ga0068860_100131566 3300005843 Bacteria 2401
111 Ga0068860_100461014 3300005843 Bacteria 1265
112 Ga0068860_100473492 3300005843 Bacteria 1247
113 Ga0068860_100776808 3300005843 Bacteria 971
114 Ga0068862_100035821 3300005844 Bacteria 4205
115 Ga0068862_100251251 3300005844 Bacteria 1611
116 Ga0068862_100322873 3300005844 Bacteria 1425
117 Ga0068862_100503906 3300005844 Bacteria 1149
118 Ga0081455_10001436 3300005937 Bacteria 29479
119 Ga0081455_10049749 3300005937 Bacteria 3611
120 Ga0081455_10099408 3300005937 Bacteria 2340
121 Ga0081455_10169664 3300005937 Bacteria 1664
122 Ga0081455_10169946 3300005937 Bacteria 1662
123 Ga0081540_1000198 3300005983 Bacteria 62526
124 Ga0081540_1011283 3300005983 Bacteria 5985
125 Ga0081540_1011767 3300005983 Bacteria 5820
126 Ga0081540_1014437 3300005983 Bacteria 5058
127 Ga0081540_1015028 3300005983 Bacteria 4918
128 Ga0081540_1022985 3300005983 Bacteria 3664
129 Ga0081539_10000229 3300005985 Bacteria 131455
130 Ga0081539_10000902 3300005985 Bacteria 56412
131 Ga0070717_10001671 3300006028 Bacteria 15424
132 Ga0070717_10002708 3300006028 Bacteria 12494
133 Ga0070717_10057030 3300006028 Bacteria 3228
134 Ga0070717_10087524 3300006028 Bacteria 2623
135 Ga0070717_10117428 3300006028 Bacteria 2276
136 Ga0070717_10135666 3300006028 Bacteria 2119
137 Ga0070717_10724287 3300006028 Bacteria 904
138 Ga0075365_10022506 3300006038 Bacteria 3950
139 Ga0075365_10072952 3300006038 Bacteria 2313
140 Ga0075365_10102378 3300006038 Bacteria 1962
141 Ga0075365_10149334 3300006038 Bacteria 1625
142 Ga0075365_10250073 3300006038 Bacteria 1246
143 Ga0075365_10266676 3300006038 Bacteria 1204
144 Ga0075368_10022839 3300006042 Bacteria 2384
145 Ga0075368_10104060 3300006042 Bacteria 1167
146 Ga0075368_10107122 3300006042 Bacteria 1150
147 Ga0075363_100011535 3300006048 Bacteria 4234
148 Ga0075363_100080673 3300006048 Bacteria 1779
149 Ga0075364_10137992 3300006051 Bacteria 1639
150 Ga0070715_10041739 3300006163 Bacteria 1924
151 Ga0070715_10054807 3300006163 Bacteria 1728
152 Ga0070716_100002889 3300006173 Bacteria 8006
153 Ga0070716_100030836 3300006173 Bacteria 2913
154 Ga0070712_100016562 3300006175 Bacteria 4761
155 Ga0070712_100022075 3300006175 Bacteria 4188
156 Ga0070712_100158977 3300006175 Bacteria 1743
157 Ga0070712_100182844 3300006175 Bacteria 1635
158 Ga0075362_10107524 3300006177 Bacteria 1310
159 Ga0075367_10125873 3300006178 Bacteria 1581
160 Ga0075367_10225794 3300006178 Bacteria 1172
161 Ga0075367_10289939 3300006178 Bacteria 1029
162 Ga0075369_10048997 3300006186 Bacteria 1824
163 Ga0075366_10116002 3300006195 Bacteria 1613
164 Ga0075366_10182231 3300006195 Bacteria 1276
165 Ga0097621_100216442 3300006237 Bacteria 1668
166 Ga0097621_100790386 3300006237 Bacteria 879
167 Ga0097621_100835560 3300006237 Bacteria 855
168 Ga0075370_10189865 3300006353 Bacteria 1210
169 Ga0075370_10207773 3300006353 Bacteria 1156
170 Ga0068871_100289029 3300006358 Bacteria 1436
171 Ga0075430_100059384 3300006846 Bacteria 3215
172 Ga0075431_100463014 3300006847 Bacteria 1262
173 Ga0075433_10175478 3300006852 Bacteria 1907
174 Ga0068865_100040953 3300006881 Bacteria 3150
175 Ga0068865_100099211 3300006881 Bacteria 2129
176 Ga0068865_100145786 3300006881 Bacteria 1790
177 Ga0075436_100136493 3300006914 Bacteria 1722
178 Ga0097620_100501800 3300006931 Bacteria 1308
179 Ga0097620_100719185 3300006931 Bacteria 1089
180 Ga0099824_1025594 3300006942 Bacteria 3200
181 Ga0099822_1002774 3300006943 Bacteria 22051
182 Ga0099794_10003219 3300007265 Bacteria 6192
183 Ga0099794_10224925 3300007265 Bacteria 964
184 Ga0099795_10058855 3300007788 Bacteria 1420
185 Ga0105240_10048224 3300009093 Bacteria 5385
186 Ga0105240_10210433 3300009093 Bacteria 2273
187 Ga0105240_10333643 3300009093 Bacteria 1725
188 Ga0105240_10567219 3300009093 Bacteria 1254
189 Ga0105245_10171263 3300009098 Bacteria 2068
190 Ga0105247_10253386 3300009101 Bacteria 1204
191 Ga0114129_10115444 3300009147 Bacteria 3701
192 Ga0105243_10196100 3300009148 Bacteria 1768
193 Ga0105241_10027700 3300009174 Bacteria 4220
194 Ga0105241_10040760 3300009174 Bacteria 3506
195 Ga0105242_10168247 3300009176 Bacteria 1924
196 Ga0105248_10005593 3300009177 Bacteria 13816
197 Ga0105248_10040819 3300009177 Bacteria 5202
198 Ga0105237_10040293 3300009545 Bacteria 4711
199 Ga0105237_10139881 3300009545 Bacteria 2415
200 Ga0105237_10142743 3300009545 Bacteria 2389
201 Ga0105238_10030469 3300009551 Bacteria 5492
202 Ga0105249_10684059 3300009553 Bacteria 1085
203 Ga0099796_10012218 3300010159 Bacteria 2418
204 Ga0099796_10126931 3300010159 Bacteria 985
205 Ga0105239_10099290 3300010375 Bacteria 3218
206 Ga0105239_10206158 3300010375 Bacteria 2203
207 Ga0105239_10988761 3300010375 Bacteria 967
208 Ga0105239_11428972 3300010375 Bacteria 799
209 Ga0157370_10054391 3300013104 Bacteria 3815
210 Ga0157370_10325717 3300013104 Bacteria 1417
211 Ga0157369_10004460 3300013105 Bacteria 16494
212 Ga0157369_10008484 3300013105 Bacteria 11787
213 Ga0157369_10020108 3300013105 Bacteria 7467
214 Ga0157369_10315531 3300013105 Bacteria 1625
215 Ga0157374_10042161 3300013296 Bacteria 4209
216 Ga0157378_10104514 3300013297 Bacteria 2589
217 Ga0163162_10066810 3300013306 Bacteria 3645
218 Ga0163162_10126306 3300013306 Bacteria 2664
219 Ga0163162_10301555 3300013306 Bacteria 1734
220 Ga0163162_10306928 3300013306 Bacteria 1719
221 Ga0157372_10100613 3300013307 Bacteria 3299
222 Ga0157372_10693113 3300013307 Bacteria 1185
223 Ga0157375_10561753 3300013308 Bacteria 1302
224 Ga0157375_10682842 3300013308 Bacteria 1181
225 Ga0163163_10085949 3300014325 Bacteria 3154
226 Ga0163163_10142464 3300014325 Bacteria 2440
227 Ga0163163_10203607 3300014325 Bacteria 2028
228 Ga0163163_10434809 3300014325 Bacteria 1372
229 Ga0182008_10084568 3300014497 Bacteria 1562
230 Ga0157377_10156352 3300014745 Bacteria 1414
231 Ga0157377_10385792 3300014745 Bacteria 950
232 Ga0157379_10072811 3300014968 Bacteria 3075
233 Ga0157379_10242560 3300014968 Bacteria 1634
234 Ga0157379_10356686 3300014968 Bacteria 1339
235 Ga0157376_10051626 3300014969 Bacteria 3416
236 Ga0157376_10193620 3300014969 Bacteria 1866
237 Ga0157376_10287530 3300014969 Bacteria 1551
238 Ga0163161_10464182 3300017792 Bacteria 1025
239 Ga0213871_10015418 3300021441 Bacteria 1827
240 Ga0209677_103350 3300025253 Bacteria 5267
241 Ga0209564_1000384 3300025295 Bacteria 80490
242 Ga0209758_1000979 3300025297 Bacteria 38423
243 Ga0209758_1012165 3300025297 Bacteria 4855
244 Ga0207692_10004253 3300025898 Bacteria 5657
245 Ga0207692_10018462 3300025898 Bacteria 3132
246 Ga0207642_10022660 3300025899 Bacteria 2496
247 Ga0207642_10261736 3300025899 Bacteria 986
248 Ga0207710_10007535 3300025900 Bacteria 4609
249 Ga0207710_10150618 3300025900 Bacteria 1128
250 Ga0207688_10045820 3300025901 Bacteria 2440
251 Ga0207688_10268211 3300025901 Bacteria 1038
252 Ga0207680_10126579 3300025903 Bacteria 1678
253 Ga0207685_10029943 3300025905 Bacteria 1933
254 Ga0207685_10033175 3300025905 Bacteria 1864
255 Ga0207699_10001026 3300025906 Bacteria 13172
256 Ga0207699_10002712 3300025906 Bacteria 8374
257 Ga0207699_10050687 3300025906 Bacteria 2449
258 Ga0207699_10053112 3300025906 Bacteria 2402
259 Ga0207705_10292049 3300025909 Bacteria 1249
260 Ga0207684_10138656 3300025910 Bacteria 2090
261 Ga0207654_10024004 3300025911 Bacteria 3273
262 Ga0207707_10000514 3300025912 Bacteria 39723
263 Ga0207707_10001012 3300025912 Bacteria 26958
264 Ga0207707_10261086 3300025912 Bacteria 1503
265 Ga0207695_10048405 3300025913 Bacteria 4489
266 Ga0207695_10060474 3300025913 Bacteria 3921
267 Ga0207695_10611739 3300025913 Bacteria 971
268 Ga0207671_10026821 3300025914 Bacteria 4310
269 Ga0207671_10062722 3300025914 Bacteria 2761
270 Ga0207693_10004141 3300025915 Bacteria 12304
271 Ga0207693_10010309 3300025915 Bacteria 7586
272 Ga0207693_10014954 3300025915 Bacteria 6232
273 Ga0207693_10043741 3300025915 Bacteria 3521
274 Ga0207663_10000995 3300025916 Bacteria 12940
275 Ga0207663_10012963 3300025916 Bacteria 4521
276 Ga0207663_10017883 3300025916 Bacteria 3959
277 Ga0207663_10370681 3300025916 Bacteria 1088
278 Ga0207660_10004057 3300025917 Bacteria 9555
279 Ga0207660_10079669 3300025917 Bacteria 2403
280 Ga0207660_10117486 3300025917 Bacteria 2010
281 Ga0207657_10009295 3300025919 Bacteria 9897
282 Ga0207649_10097140 3300025920 Bacteria 1942
283 Ga0207652_10001200 3300025921 Bacteria 23314
284 Ga0207652_10004609 3300025921 Bacteria 11171
285 Ga0207652_10247068 3300025921 Bacteria 1609
286 Ga0207681_10071392 3300025923 Bacteria 2422
287 Ga0207694_10059451 3300025924 Bacteria 2972
288 Ga0207687_10020852 3300025927 Bacteria 4348
289 Ga0207700_10012075 3300025928 Bacteria 5549
290 Ga0207700_10037936 3300025928 Bacteria 3494
291 Ga0207700_10064047 3300025928 Bacteria 2799
292 Ga0207700_10147543 3300025928 Bacteria 1940
293 Ga0207700_10184366 3300025928 Bacteria 1750
294 Ga0207664_10020037 3300025929 Bacteria 4950
295 Ga0207664_10025655 3300025929 Bacteria 4444
296 Ga0207664_10168156 3300025929 Bacteria 1875
297 Ga0207664_10455401 3300025929 Bacteria 1142
298 Ga0207644_10569469 3300025931 Bacteria 939
299 Ga0207690_10101794 3300025932 Bacteria 2053
300 Ga0207706_10017544 3300025933 Bacteria 6451
301 Ga0207709_10240833 3300025935 Bacteria 1316
302 Ga0207669_10087581 3300025937 Bacteria 2017
303 Ga0207669_10317083 3300025937 Bacteria 1191
304 Ga0207704_10210640 3300025938 Bacteria 1430
305 Ga0207704_10545196 3300025938 Bacteria 942
306 Ga0207704_10902696 3300025938 Bacteria 743
307 Ga0207665_10002036 3300025939 Bacteria 13614
308 Ga0207665_10002454 3300025939 Bacteria 12518
309 Ga0207665_10025025 3300025939 Bacteria 3936
310 Ga0207665_10033052 3300025939 Bacteria 3427
311 Ga0207691_10043096 3300025940 Bacteria 4160
312 Ga0207691_10089094 3300025940 Bacteria 2767
313 Ga0207711_10059816 3300025941 Bacteria 3281
314 Ga0207661_10005931 3300025944 Bacteria 8624
315 Ga0207661_10006049 3300025944 Bacteria 8549
316 Ga0207679_10615204 3300025945 Bacteria 980
317 Ga0207667_10034378 3300025949 Bacteria 5444
318 Ga0207667_10112490 3300025949 Bacteria 2807
319 Ga0207668_10056368 3300025972 Bacteria 2736
320 Ga0207668_10956715 3300025972 Bacteria 764
321 Ga0207640_10040184 3300025981 Bacteria 2965
322 Ga0207639_10026091 3300026041 Bacteria 4243
323 Ga0207639_10032192 3300026041 Bacteria 3859
324 Ga0207678_10239803 3300026067 Bacteria 1553
325 Ga0207678_10394438 3300026067 Bacteria 1198
326 Ga0207702_10070447 3300026078 Bacteria 3007
327 Ga0207702_10312238 3300026078 Bacteria 1495
328 Ga0207702_10784874 3300026078 Bacteria 941
329 Ga0207648_10040525 3300026089 Bacteria 4092
330 Ga0207674_10033120 3300026116 Bacteria 5411
331 Ga0207674_10313987 3300026116 Bacteria 1516
332 Ga0207675_100084939 3300026118 Bacteria 2970
333 Ga0207683_10012077 3300026121 Bacteria 7373
334 Ga0207683_10205812 3300026121 Bacteria 1790
335 Ga0207698_10103516 3300026142 Bacteria 2366
336 Ga0207698_10545808 3300026142 Bacteria 1135
337 Ga0209589_1003502 3300027357 Bacteria 27390
338 Ga0209489_104084 3300027361 Bacteria 27390
339 Ga0209700_103995 3300027363 Bacteria 27388
340 Ga0209588_1015142 3300027671 Bacteria 2369
341 Ga0209813_10083275 3300027866 Bacteria 1062
342 Ga0268266_10046170 3300028379 Bacteria 3729
343 Ga0268266_10256664 3300028379 Bacteria 1619
344 Ga0268266_10266727 3300028379 Bacteria 1588
345 Ga0268265_10112457 3300028380 Bacteria 2226
346 Ga0268265_10131618 3300028380 Bacteria 2080
347 Ga0268264_10000049 3300028381 Bacteria 329992
348 Ga0268264_10222899 3300028381 Bacteria 1737
349 Ga0265334_10035257 3300028573 Bacteria 1982
350 Ga0307517_10002212 3300028786 Bacteria 31405
351 Ga0307515_10031180 3300028794 Bacteria 8901
352 Ga0307515_10334411 3300028794 Bacteria 1171
353 Ga0265338_10072170 3300028800 Bacteria 2949
354 Ga0307511_10187003 3300030521 Bacteria 1103
355 Ga0265330_10014628 3300031235 Bacteria 3639
356 Ga0265330_10042218 3300031235 Bacteria 2021
357 Ga0265330_10055596 3300031235 Bacteria 1728
358 Ga0265332_10061827 3300031238 Bacteria 1600
359 Ga0265340_10003251 3300031247 Bacteria 9214
360 Ga0265340_10012264 3300031247 Bacteria 4528
361 Ga0265340_10069117 3300031247 Bacteria 1676
362 Ga0265339_10009816 3300031249 Bacteria 5982
363 Ga0265339_10031616 3300031249 Bacteria 2990
364 Ga0265331_10050174 3300031250 Bacteria 2002
365 Ga0265316_10078500 3300031344 Bacteria 2534
366 Ga0265316_10169632 3300031344 Bacteria 1628
367 Ga0265316_10466465 3300031344 Bacteria 905
368 Ga0307509_10091066 3300031507 Bacteria 3122
369 Ga0307509_10401052 3300031507 Bacteria 1078
370 Ga0265313_10026653 3300031595 Bacteria 3040
371 Ga0265313_10038429 3300031595 Bacteria 2383
372 Ga0307508_10083807 3300031616 Bacteria 2770
373 Ga0307508_10475144 3300031616 Bacteria 844
374 Ga0265342_10012805 3300031712 Bacteria 5662
375 Ga0265342_10103040 3300031712 Bacteria 1623
376 Ga0307516_10316954 3300031730 Bacteria 1231
377 Ga0307409_100542770 3300031995 Bacteria 1140
378 Ga0307507_10076569 3300033179 Bacteria 2982
379 Ga0307510_10032374 3300033180 Bacteria 5891
380 Ga0307510_10268403 3300033180 Bacteria 1184
381 Ga0373950_0001895 3300034818 Bacteria 2810
382 Ga0373928_0007411 3300035084 Bacteria 2116
383 Ga0373934_0022031 3300035086 Bacteria 2455
384 Ga0373951_0025349 3300035091 Bacteria 1377
385 Ga0373923_0057769 3300035111 Bacteria 1641
386 Ga0373936_0096891 3300035113 Bacteria 1241
387 Ga0373941_0103319 3300035115 Bacteria 995
388 Ga0373945_0052731 3300035116 Bacteria 1499
389 Ga0373953_0001507 3300035117 Bacteria 6754
390 Ga0373953_0062006 3300035117 Bacteria 1530
391 Ga0373954_0000611 3300035118 Bacteria 13614
392 Ga0373954_0065128 3300035118 Bacteria 1724
393 Ga0373956_0001898 3300035119 Bacteria 8617
394 Ga0373957_0073546 3300035120 Bacteria 1340
395 Ga0373957_0113745 3300035120 Bacteria 1091
396 Ga0373946_0071532 3300035171 Bacteria 1499
397 Ga0373955_0005153 3300035172 Bacteria 5845
398 Ga0373942_0008766 3300035207 Bacteria 2363
399 Ga0373924_0044223 3300035410 Bacteria 1830
400 Ga0373931_0002204 3300035691 Bacteria 8603
401 Ga0373935_0029617 3300035692 Bacteria 3388
402 Ga0373935_0043094 3300035692 Bacteria 2839
403 Ga0373935_0275100 3300035692 Bacteria 1184
404 Ga0373935_0327693 3300035692 Bacteria 1088
405 Ga0373927_0004862 3300035695 Bacteria 9344
406 Ga0373927_0028145 3300035695 Bacteria 3667
407 Ga0373927_0044200 3300035695 Bacteria 2882
408 Ga0373927_0050720 3300035695 Bacteria 2684
409 Ga0373927_0207941 3300035695 Bacteria 1285
410 Ga0373927_0376963 3300035695 Bacteria 935
411 Ga0373933_0004009 3300035724 Bacteria 8113
412 Ga0373947_0011593 3300035725 Bacteria 5057
413 Ga0373947_0024859 3300035725 Bacteria 3493
414 Ga0373947_0100916 3300035725 Bacteria 1814
415 Ga0373947_0129596 3300035725 Bacteria 1609
416 Ga0373947_0150172 3300035725 Bacteria 1500
417 Ga0373947_0350597 3300035725 Bacteria 990
418 Ga0373937_0051786 3300036401 Bacteria 3762
419 Ga0373937_0116476 3300036401 Bacteria 2488
420 Ga0373925_0016736 3300037068 Bacteria 5310
421 Ga0373925_0023018 3300037068 Bacteria 4547
422 Ga0373925_0025836 3300037068 Bacteria 4294
423 Ga0373925_0069253 3300037068 Bacteria 2665
424 Ga0373925_0152184 3300037068 Bacteria 1817
425 Ga0395900_0030405 3300037418 Bacteria 5546
426 Ga0395900_0035384 3300037418 Bacteria 5143
427 Ga0395900_0132588 3300037418 Bacteria 2553
428 Ga0395898_0006663 3300037466 Bacteria 12317
429 Ga0395898_0018371 3300037466 Bacteria 7131
430 Ga0395901_0040740 3300038443 Bacteria 4811
431 Ga0436365_0046962 3300039437 Bacteria 16656
432 Ga0436365_0704293 3300039437 Bacteria 1881
433 Ga0436365_1153094 3300039437 Bacteria 1193
434 Ga0436365_1787641 3300039437 Bacteria 1162
435 Ga0436360_0167936 3300039438 Bacteria 2528
436 Ga0436360_1041607 3300039438 Bacteria 1540
437 Ga0436361_0333797 3300039447 Bacteria 835
438 Ga0436363_0733303 3300039450 Bacteria 3870
439 Ga0436363_0769516 3300039450 Bacteria 1356
440 Ga0436363_0994048 3300039450 Bacteria 967
441 Ga0451793_1655420 3300041452 Bacteria 1366
442 Ga0451797_1390215 3300041453 Bacteria 752
443 Ga0466965_0057357 3300044683 Bacteria 1941
444 Ga0466963_0038075 3300044694 Bacteria 3144
445 Ga0466971_0103383 3300044719 Bacteria 1310
446 Ga0466959_0046779 3300045049 Bacteria 3184
447 Ga0466958_0363586 3300045836 Bacteria 932
448 Ga0466967_0040815 3300045976 Bacteria 3997
449 Ga0495617_045207 3300046452 Bacteria 1468
450 Ga0495592_0001347 3300046454 Bacteria 17006
451 Ga0495592_0031397 3300046454 Bacteria 4015
452 Ga0495603_0046216 3300046455 Bacteria 2595
453 Ga0495603_0103798 3300046455 Bacteria 1659
454 Ga0495603_0140120 3300046455 Bacteria 1407
455 Ga0495603_0333218 3300046455 Bacteria 871
456 Ga0495629_0000388 3300046459 Bacteria 36900
457 Ga0495629_0039239 3300046459 Bacteria 3333
458 Ga0495629_0285951 3300046459 Bacteria 1131
459 Ga0495638_0025476 3300046460 Bacteria 3844
460 Ga0495638_0026381 3300046460 Bacteria 3764
461 Ga0495638_0047003 3300046460 Bacteria 2708
462 Ga0495651_0003758 3300046462 Bacteria 11612
463 Ga0495653_0017721 3300046463 Bacteria 5789
464 Ga0495653_0278670 3300046463 Bacteria 1098
465 Ga0495650_0034149 3300046471 Bacteria 2256
466 Ga0495580_0064617 3300046472 Bacteria 2565
467 Ga0495582_0028335 3300046473 Bacteria 3074
468 Ga0495582_0036177 3300046473 Bacteria 2716
469 Ga0495582_0166404 3300046473 Bacteria 1255
470 Ga0495639_0012959 3300046475 Bacteria 3599
471 Ga0495662_0056923 3300046476 Bacteria 1888
472 Ga0495664_0007894 3300046477 Bacteria 5921
473 Ga0495664_0105688 3300046477 Bacteria 1697
474 Ga0495664_0119627 3300046477 Bacteria 1593
475 Ga0495585_0027101 3300046492 Bacteria 3271
476 Ga0495606_0135477 3300046507 Bacteria 1459
477 Ga0495608_0011088 3300046511 Bacteria 6279
478 Ga0495608_0122979 3300046511 Bacteria 1663
479 Ga0495610_0054995 3300046512 Bacteria 1921
480 Ga0495628_0071510 3300046516 Bacteria 2704
481 Ga0495628_0076997 3300046516 Bacteria 2595
482 Ga0495630_0049306 3300046517 Bacteria 3152
483 Ga0495630_0178396 3300046517 Bacteria 1619
484 Ga0495652_0002755 3300046529 Bacteria 17749
485 Ga0495652_0171536 3300046529 Bacteria 1674
486 Ga0495652_0197156 3300046529 Bacteria 1531
487 Ga0495652_0376167 3300046529 Bacteria 1011
488 Ga0495665_0011166 3300046531 Bacteria 4862
489 Ga0495640_0009675 3300046533 Bacteria 7495
490 Ga0495640_0048652 3300046533 Bacteria 2929
491 Ga0495645_0013630 3300046543 Bacteria 5757
492 Ga0495622_0040606 3300046557 Bacteria 2165
493 Ga0495633_0054767 3300046558 Bacteria 1876
494 Ga0495633_0113441 3300046558 Bacteria 1257
495 Ga0495667_0003989 3300046559 Bacteria 9910
496 Ga0495656_0318773 3300046615 Bacteria 800
497 Ga0495634_0008124 3300046642 Bacteria 7822
498 Ga0495634_0018721 3300046642 Bacteria 4926
499 Ga0495634_0028639 3300046642 Bacteria 3865
500 Ga0495611_0189063 3300046648 Bacteria 961
501 Ga0495635_0000278 3300046663 Bacteria 32846
502 Ga0495588_0020818 3300046674 Bacteria 3227
503 Ga0495599_0001883 3300046678 Bacteria 12153
504 Ga0495623_0014126 3300046679 Bacteria 5172
505 Ga0495646_0027150 3300046680 Bacteria 3592
506 Ga0495646_0033123 3300046680 Bacteria 3214
507 Ga0495647_0003016 3300046681 Bacteria 5360
508 Ga0495658_0028970 3300046683 Bacteria 2992
509 Ga0495669_0126149 3300046684 Bacteria 1203
510 Ga0495613_0019077 3300046689 Bacteria 5112
511 Ga0495613_0052291 3300046689 Bacteria 3009
512 Ga0495624_0161353 3300046690 Bacteria 1369
513 Ga0495670_0050620 3300046691 Bacteria 2079
514 Ga0495671_0070182 3300046692 Bacteria 1721
515 Ga0495600_0070808 3300046809 Bacteria 2279
516 Ga0495581_0029850 3300047315 Bacteria 3161
517 Ga0495604_0006228 3300047317 Bacteria 9468
518 Ga0495604_0191300 3300047317 Bacteria 1426
519 Ga0495674_0024456 3300047319 Bacteria 5550
520 Ga0495674_0599653 3300047319 Bacteria 873
521 Ga0495672_0014613 3300047320 Bacteria 5367
522 Ga0495672_0028598 3300047320 Bacteria 3523
523 Ga0495672_0033373 3300047320 Bacteria 3189
524 Ga0495676_0143197 3300047321 Bacteria 1711
525 Ga0495680_0001213 3300047322 Bacteria 28254
526 Ga0495675_0010868 3300047444 Bacteria 5703
527 Ga0495673_0059846 3300047469 Bacteria 1636
528 Ga0495684_0000161 3300047471 Bacteria 50269
529 Ga0495684_0007850 3300047471 Bacteria 8258
530 Ga0495684_0311749 3300047471 Bacteria 1127
531 Ga0495593_0000707 3300047673 Bacteria 19277
532 Ga0495593_0067256 3300047673 Bacteria 1866
533 Ga0495593_0071916 3300047673 Bacteria 1796
534 Ga0495593_0167877 3300047673 Bacteria 1107
535 Ga0495593_0229078 3300047673 Bacteria 932
536 Ga0496100_0152844 3300048903 Bacteria 1648
537 Ga0496100_0198628 3300048903 Bacteria 1460
538 Ga0496100_0348333 3300048903 Bacteria 1118
539 Ga0496101_0029687 3300048904 Bacteria 3825
540 Ga0496101_0066739 3300048904 Bacteria 2625
541 Ga0496102_0140603 3300048905 Bacteria 2263
542 Ga0496102_0239417 3300048905 Bacteria 1711
543 Ga0496104_0167720 3300048907 Bacteria 2105
544 Ga0496104_0359416 3300048907 Bacteria 1368
545 Ga0496104_0389744 3300048907 Bacteria 1305
546 Ga0496104_0478887 3300048907 Bacteria 1156
547 Ga0496104_0841392 3300048907 Bacteria 823
548 Ga0496105_0011867 3300048908 Bacteria 6900
549 Ga0496105_0046894 3300048908 Bacteria 3566
550 Ga0496105_0077423 3300048908 Bacteria 2747
551 Ga0496106_0231165 3300048909 Bacteria 1476
552 Ga0496107_0002722 3300048910 Bacteria 11598
553 Ga0496107_0029803 3300048910 Bacteria 3886
554 Ga0496107_0072309 3300048910 Bacteria 2507
555 Ga0496107_0103445 3300048910 Bacteria 2089
556 Ga0496108_0000792 3300048911 Bacteria 24615
557 Ga0496108_0036715 3300048911 Bacteria 4078
558 Ga0496108_0085022 3300048911 Bacteria 2685
559 Ga0496108_0281491 3300048911 Bacteria 1448
560 Ga0496108_0397536 3300048911 Bacteria 1204
561 Ga0496108_0655600 3300048911 Bacteria 912
562 Ga0496109_0102220 3300048912 Bacteria 2660
563 Ga0496109_0336717 3300048912 Bacteria 1425
564 Ga0496109_0367207 3300048912 Bacteria 1359
565 Ga0496110_0078644 3300048913 Bacteria 2936
566 Ga0496110_0208039 3300048913 Bacteria 1778
567 Ga0496111_0076753 3300048914 Bacteria 2435
568 Ga0496111_0207368 3300048914 Bacteria 1456
569 Ga0496111_0210723 3300048914 Bacteria 1443
570 Ga0496111_0231605 3300048914 Bacteria 1372
571 Ga0496111_0615249 3300048914 Bacteria 794
572 Ga0496112_0053183 3300048915 Bacteria 3976
573 Ga0496112_0061146 3300048915 Bacteria 3712
574 Ga0496113_0085515 3300048916 Bacteria 2423
575 Ga0496113_0174224 3300048916 Bacteria 1704
576 Ga0496114_0453793 3300048917 Bacteria 1135
577 Ga0496114_0476340 3300048917 Bacteria 1104
578 Ga0496114_0920488 3300048917 Bacteria 756
579 Ga0496115_0023207 3300048918 Bacteria 4814
580 Ga0496115_0049251 3300048918 Bacteria 3372
581 Ga0496115_0055274 3300048918 Bacteria 3189
582 Ga0496115_0318572 3300048918 Bacteria 1272
583 Ga0496115_0469112 3300048918 Bacteria 1015
584 Ga0496121_0006401 3300048924 Bacteria 14641
585 Ga0496121_0017018 3300048924 Bacteria 7461
586 Ga0496121_0055421 3300048924 Bacteria 3303
587 Ga0496121_0090735 3300048924 Bacteria 2388
588 Ga0496121_0194447 3300048924 Bacteria 1451
589 Ga0496121_0205326 3300048924 Bacteria 1400
590 Ga0496121_0483748 3300048924 Bacteria 790
591 Ga0496124_0229533 3300048927 Bacteria 1389
592 Ga0496124_0574545 3300048927 Bacteria 739
593 Ga0496125_0000243 3300048928 Bacteria 111891
594 Ga0496125_0003560 3300048928 Bacteria 18764
595 Ga0496126_0006360 3300048929 Bacteria 13170
596 Ga0496126_0026526 3300048929 Bacteria 5554
597 Ga0496126_0061203 3300048929 Bacteria 3382
598 Ga0496126_0064692 3300048929 Bacteria 3275
599 Ga0496126_0084298 3300048929 Bacteria 2803
600 Ga0496126_0103728 3300048929 Bacteria 2485
601 Ga0496126_0309518 3300048929 Bacteria 1301
602 Ga0501034_0053245 3300049571 Bacteria 4076
603 Ga0501034_0175214 3300049571 Bacteria 2111
604 Ga0501034_0265617 3300049571 Bacteria 1658
605 Ga0501036_0455310 3300049572 Bacteria 1066
606 Ga0501039_0283053 3300049575 Bacteria 1303
607 Ga0501041_0168786 3300049577 Bacteria 1369
608 Ga0501047_0624864 3300049581 Bacteria 898
609 Ga0501067_0013330 3300049583 Bacteria 4552
610 Ga0501070_0160503 3300049586 Bacteria 1853
611 Ga0501080_0446253 3300049742 Bacteria 1160
612 Ga0501035_0000904 3300049822 Bacteria 31387
613 Ga0501035_0323490 3300049822 Bacteria 1295
614 Ga0501044_0168686 3300049823 Bacteria 2161
615 Ga0501044_0465654 3300049823 Bacteria 1169
616 nmdc:mga07m45_295693_c1 3300050496 Bacteria 942
617 nmdc:mga09592_30270_c1 3300050508 Bacteria 4504
618 nmdc:mga08x19_165610_c1 3300050514 Bacteria 1503
619 nmdc:mga0a205_165849_c1 3300050515 Bacteria 2104
620 Ga0495601_0083575 3300053077 Bacteria 2051
621 Ga0495601_0089172 3300053077 Bacteria 1983
622 Ga0495601_0110134 3300053077 Bacteria 1783
623 Ga0495601_0219423 3300053077 Bacteria 1242
624 Ga0495601_0284575 3300053077 Bacteria 1078
625 Ga0495601_0415710 3300053077 Bacteria 871
626 Ga0495612_0023480 3300053078 Bacteria 2475
627 Ga0495595_0002151 3300053084 Bacteria 7654
628 Ga0495595_0019276 3300053084 Bacteria 2959
629 Ga0495619_0001354 3300053085 Bacteria 16078
630 Ga0495619_0068250 3300053085 Bacteria 2375
631 Ga0495619_0189719 3300053085 Bacteria 1422
632 Ga0495619_0452467 3300053085 Bacteria 885
633 Ga0500581_030744 3300053089 Bacteria 2746
634 Ga0500647_0116930 3300053091 Bacteria 1264
635 Ga0500566_0000288 3300053094 Bacteria 27039
636 Ga0500566_0149438 3300053094 Bacteria 1230
637 Ga0500641_0006163 3300053096 Bacteria 4251
638 Ga0500641_0108974 3300053096 Bacteria 1191
639 Ga0500650_0011842 3300053098 Bacteria 3609
640 Ga0500572_003081 3300053111 Bacteria 3872
641 Ga0500595_005666 3300053119 Bacteria 5421
642 Ga0500595_011180 3300053119 Bacteria 3527
643 Ga0500595_018417 3300053119 Bacteria 2554
644 Ga0500595_080519 3300053119 Bacteria 953
645 Ga0500597_213677 3300053120 Bacteria 805
646 Ga0500608_018708 3300053122 Bacteria 3165
647 Ga0500614_009355 3300053123 Bacteria 2091
648 Ga0500559_0000393 3300053136 Bacteria 31876
649 Ga0500559_0068806 3300053136 Bacteria 1591
650 Ga0500568_0008039 3300053139 Bacteria 5119
651 Ga0500568_0015491 3300053139 Bacteria 3413
652 Ga0500577_0001891 3300053142 Bacteria 5370
653 Ga0500590_060708 3300053148 Bacteria 1900
654 Ga0500590_216986 3300053148 Bacteria 793
655 Ga0500603_009718 3300053150 Bacteria 2156
656 Ga0500603_050643 3300053150 Bacteria 1135
657 Ga0500604_0004008 3300053151 Bacteria 3930
658 Ga0500616_0000046 3300053153 Bacteria 333409
659 Ga0500616_0004625 3300053153 Bacteria 9717
660 Ga0500624_004975 3300053157 Bacteria 1759
661 Ga0500638_002593 3300053162 Bacteria 6370
662 Ga0500638_175109 3300053162 Bacteria 931
663 Ga0500639_004787 3300053163 Bacteria 6891
664 Ga0500639_132645 3300053163 Bacteria 1177
665 Ga0500636_0087629 3300053177 Bacteria 1786
666 Ga0500637_0000174 3300053178 Bacteria 24012
667 Ga0500637_0101673 3300053178 Bacteria 1666
668 Ga0500637_0344714 3300053178 Bacteria 795
669 Ga0500552_008871 3300053733 Bacteria 1198
670 Ga0500552_026530 3300053733 Bacteria 865
671 Ga0500601_005500 3300053737 Bacteria 1387
672 Ga0500661_000298 3300055283 Bacteria 9001
673 Ga0501082_0318012 3300060353 Bacteria 1356
674 Ga0466962_0124762 3300061719 Bacteria 1243
675 2507505729 2507262055 Bacteria 8048963
676 2508539928 2508501009 Bacteria 7784016
677 2508695993 2508501042 Bacteria 8719808
678 2513889734 2513237141 Bacteria 8496279
679 2515627743 2515154112 Bacteria 8294334
680 2524435602 2524023205 Bacteria 8918781
681 2524533252 2524023228 Bacteria 10118060
682 2723842161 2721755755 Bacteria 8322773
683 2745079858 2744054633 Bacteria 8678936
684 2893066966 2893066018 Bacteria 6158120
685 2903778096 2903768456 Bacteria 9749579
686 2906633757 2906626472 Bacteria 8826946
687 2935614783 2935608549 Bacteria 8203142
688 2935649176 2935648319 Bacteria 8801166
689 2935658052 2935656913 Bacteria 8965014
690 2935826177 2935819856 Bacteria 8261050
691 2935853673 2935847175 Bacteria 8228321
692 2935978408 2935975950 Bacteria 8347125
693 2935985460 2935984226 Bacteria 8302647
694 2936012271 2936011229 Bacteria 8801034
695 2936020648 2936019824 Bacteria 8804134
696 2936029564 2936028420 Bacteria 8965941
697 2936051971 2936046547 Bacteria 8903709
698 2936056772 2936055302 Bacteria 8785755
699 8016585645 8016583857 Bacteria 10421953
700 8016635110 8016630954 Bacteria 9217207
701 8019622168 8019619141 Bacteria 9218857
702 8019631144 8019629233 Bacteria 8687553
703 8019639475 8019638758 Bacteria 9062356
704 8019677373 8019668869 Bacteria 8791617
705 8019687581 8019678201 Bacteria 8863603
706 8056679279 8056673599 Bacteria 7871253
707 8056683516 8056681323 Bacteria 8472857
708 Ga0070707_100245697
709 JGI25406J46586_10001899
710 rootL2_10105425
711 JGI25404J52841_10006198
712 JGI25404J52841_10038981
713 JGI25405J52794_10060300
714 Ga0065165_1053946
715 Ga0070658_10114391
716 Ga0070658_10406953
717 Ga0070676_10051005
718 Ga0070683_100027504
719 Ga0068869_100085739
720 Ga0068869_100098901
721 Ga0070680_100004471
722 Ga0070680_100015683
723 Ga0070680_100027630
724 Ga0070682_100021862
725 Ga0068868_100100143
726 Ga0068868_100812249
727 Ga0070660_100011280
728 Ga0070661_100133686
729 Ga0070668_100074150
730 Ga0070668_100074634
731 Ga0070668_100174572
732 Ga0070669_100182256
733 Ga0070675_100135361
734 Ga0070674_100049651
735 Ga0070673_100679915
736 Ga0070688_100536117
737 Ga0070659_100030798
738 Ga0070667_100224849
739 Ga0070667_100245228
740 Ga0070709_10000703
741 Ga0070709_10220578
742 Ga0070714_100025069
743 Ga0070714_100043155
744 Ga0070714_100199955
745 Ga0070713_100007431
746 Ga0070713_100028086
747 Ga0070713_100028990
748 Ga0070713_100032531
749 Ga0070713_100032964
750 Ga0070713_100100983
751 Ga0070710_10000433
752 Ga0070710_10003825
753 Ga0070710_10209613
754 Ga0070711_100001124
755 Ga0070711_100002295
756 Ga0070711_100010761
757 Ga0070663_100067227
758 Ga0070663_100108291
759 Ga0070663_100178279
760 Ga0070678_100011192
761 Ga0070678_100250924
762 Ga0070678_100310367
763 Ga0070678_100512825
764 Ga0070662_100068013
765 Ga0070681_10025346
766 Ga0070681_10281851
767 Ga0068867_100079294
768 Ga0070706_100023481
769 Ga0070706_100120469
770 Ga0070707_100046304
771 Ga0070698_100026724
772 Ga0070679_100006230
773 Ga0070679_100060318
774 Ga0070679_100069911
775 Ga0070684_100060624
776 Ga0070684_100065643
777 Ga0070684_100075342
778 Ga0070697_100008119
779 Ga0070697_100234595
780 Ga0068853_100261279
781 Ga0068853_100303368
782 Ga0068853_100592235
783 Ga0070696_100231388
784 Ga0070693_100067782
785 Ga0070693_100182371
786 Ga0070665_100017188
787 Ga0070665_100129158
788 Ga0070665_100272231
789 Ga0070665_100321863
790 Ga0070665_100623557
791 Ga0070704_100791700
792 Ga0068855_100142231
793 Ga0068855_100490382
794 Ga0068855_100492116
795 Ga0068857_100056152
796 Ga0068857_100997611
797 Ga0068854_100135825
798 Ga0068854_100666609
799 Ga0068856_100902315
800 Ga0068852_100081767
801 Ga0068852_100320748
802 Ga0068852_100346411
803 Ga0068859_100501793
804 Ga0068864_100250295
805 Ga0068861_100129130
806 Ga0068861_100147030
807 Ga0068861_100216408
808 Ga0068861_100346437
809 Ga0068870_10121632
810 Ga0068863_100195006
811 Ga0068863_100239438
812 Ga0068863_100334841
813 Ga0068863_100572268
814 Ga0068858_100083847
815 Ga0068858_100868171
816 Ga0068860_100002174
817 Ga0068860_100131566
818 Ga0068860_100461014
819 Ga0068860_100473492
820 Ga0068860_100776808
821 Ga0068862_100035821
822 Ga0068862_100251251
823 Ga0068862_100322873
824 Ga0068862_100503906
825 Ga0081455_10001436
826 Ga0081455_10049749
827 Ga0081455_10099408
828 Ga0081455_10169664
829 Ga0081455_10169946
830 Ga0081540_1000198
831 Ga0081540_1011283
832 Ga0081540_1011767
833 Ga0081540_1014437
834 Ga0081540_1015028
835 Ga0081540_1022985
836 Ga0081539_10000229
837 Ga0081539_10000902
838 Ga0070717_10001671
839 Ga0070717_10002708
840 Ga0070717_10057030
841 Ga0070717_10087524
842 Ga0070717_10117428
843 Ga0070717_10135666
844 Ga0070717_10724287
845 Ga0075365_10022506
846 Ga0075365_10072952
847 Ga0075365_10102378
848 Ga0075365_10149334
849 Ga0075365_10250073
850 Ga0075365_10266676
851 Ga0075368_10022839
852 Ga0075368_10104060
853 Ga0075368_10107122
854 Ga0075363_100011535
855 Ga0075363_100080673
856 Ga0075364_10137992
857 Ga0070715_10041739
858 Ga0070715_10054807
859 Ga0070716_100002889
860 Ga0070716_100030836
861 Ga0070712_100016562
862 Ga0070712_100022075
863 Ga0070712_100158977
864 Ga0070712_100182844
865 Ga0075362_10107524
866 Ga0075367_10125873
867 Ga0075367_10225794
868 Ga0075367_10289939
869 Ga0075369_10048997
870 Ga0075366_10116002
871 Ga0075366_10182231
872 Ga0097621_100216442
873 Ga0097621_100790386
874 Ga0097621_100835560
875 Ga0075370_10189865
876 Ga0075370_10207773
877 Ga0068871_100289029
878 Ga0075430_100059384
879 Ga0075431_100463014
880 Ga0075433_10175478
881 Ga0068865_100040953
882 Ga0068865_100099211
883 Ga0068865_100145786
884 Ga0075436_100136493
885 Ga0097620_100501800
886 Ga0097620_100719185
887 Ga0099824_1025594
888 Ga0099822_1002774
889 Ga0099794_10003219
890 Ga0099794_10224925
891 Ga0099795_10058855
892 Ga0105240_10048224
893 Ga0105240_10210433
894 Ga0105240_10333643
895 Ga0105240_10567219
896 Ga0105245_10171263
897 Ga0105247_10253386
898 Ga0114129_10115444
899 Ga0105243_10196100
900 Ga0105241_10027700
901 Ga0105241_10040760
902 Ga0105242_10168247
903 Ga0105248_10005593
904 Ga0105248_10040819
905 Ga0105237_10040293
906 Ga0105237_10139881
907 Ga0105237_10142743
908 Ga0105238_10030469
909 Ga0105249_10684059
910 Ga0099796_10012218
911 Ga0099796_10126931
912 Ga0105239_10099290
913 Ga0105239_10206158
914 Ga0105239_10988761
915 Ga0105239_11428972
916 Ga0157370_10054391
917 Ga0157370_10325717
918 Ga0157369_10004460
919 Ga0157369_10008484
920 Ga0157369_10020108
921 Ga0157369_10315531
922 Ga0157374_10042161
923 Ga0157378_10104514
924 Ga0163162_10066810
925 Ga0163162_10126306
926 Ga0163162_10301555
927 Ga0163162_10306928
928 Ga0157372_10100613
929 Ga0157372_10693113
930 Ga0157375_10561753
931 Ga0157375_10682842
932 Ga0163163_10085949
933 Ga0163163_10142464
934 Ga0163163_10203607
935 Ga0163163_10434809
936 Ga0182008_10084568
937 Ga0157377_10156352
938 Ga0157377_10385792
939 Ga0157379_10072811
940 Ga0157379_10242560
941 Ga0157379_10356686
942 Ga0157376_10051626
943 Ga0157376_10193620
944 Ga0157376_10287530
945 Ga0163161_10464182
946 Ga0213871_10015418
947 Ga0209677_103350
948 Ga0209564_1000384
949 Ga0209758_1000979
950 Ga0209758_1012165
951 Ga0207692_10004253
952 Ga0207692_10018462
953 Ga0207642_10022660
954 Ga0207642_10261736
955 Ga0207710_10007535
956 Ga0207710_10150618
957 Ga0207688_10045820
958 Ga0207688_10268211
959 Ga0207680_10126579
960 Ga0207685_10029943
961 Ga0207685_10033175
962 Ga0207699_10001026
963 Ga0207699_10002712
964 Ga0207699_10050687
965 Ga0207699_10053112
966 Ga0207705_10292049
967 Ga0207684_10138656
968 Ga0207654_10024004
969 Ga0207707_10000514
970 Ga0207707_10001012
971 Ga0207707_10261086
972 Ga0207695_10048405
973 Ga0207695_10060474
974 Ga0207695_10611739
975 Ga0207671_10026821
976 Ga0207671_10062722
977 Ga0207693_10004141
978 Ga0207693_10010309
979 Ga0207693_10014954
980 Ga0207693_10043741
981 Ga0207663_10000995
982 Ga0207663_10012963
983 Ga0207663_10017883
984 Ga0207663_10370681
985 Ga0207660_10004057
986 Ga0207660_10079669
987 Ga0207660_10117486
988 Ga0207657_10009295
989 Ga0207649_10097140
990 Ga0207652_10001200
991 Ga0207652_10004609
992 Ga0207652_10247068
993 Ga0207681_10071392
994 Ga0207694_10059451
995 Ga0207687_10020852
996 Ga0207700_10012075
997 Ga0207700_10037936
998 Ga0207700_10064047
999 Ga0207700_10147543
1000 Ga0207700_10184366
1001 Ga0207664_10020037
1002 Ga0207664_10025655
1003 Ga0207664_10168156
1004 Ga0207664_10455401
1005 Ga0207644_10569469
1006 Ga0207690_10101794
1007 Ga0207706_10017544
1008 Ga0207709_10240833
1009 Ga0207669_10087581
1010 Ga0207669_10317083
1011 Ga0207704_10210640
1012 Ga0207704_10545196
1013 Ga0207704_10902696
1014 Ga0207665_10002036
1015 Ga0207665_10002454
1016 Ga0207665_10025025
1017 Ga0207665_10033052
1018 Ga0207691_10043096
1019 Ga0207691_10089094
1020 Ga0207711_10059816
1021 Ga0207661_10005931
1022 Ga0207661_10006049
1023 Ga0207679_10615204
1024 Ga0207667_10034378
1025 Ga0207667_10112490
1026 Ga0207668_10056368
1027 Ga0207668_10956715
1028 Ga0207640_10040184
1029 Ga0207639_10026091
1030 Ga0207639_10032192
1031 Ga0207678_10239803
1032 Ga0207678_10394438
1033 Ga0207702_10070447
1034 Ga0207702_10312238
1035 Ga0207702_10784874
1036 Ga0207648_10040525
1037 Ga0207674_10033120
1038 Ga0207674_10313987
1039 Ga0207675_100084939
1040 Ga0207683_10012077
1041 Ga0207683_10205812
1042 Ga0207698_10103516
1043 Ga0207698_10545808
1044 Ga0209589_1003502
1045 Ga0209489_104084
1046 Ga0209700_103995
1047 Ga0209588_1015142
1048 Ga0209813_10083275
1049 Ga0268266_10046170
1050 Ga0268266_10256664
1051 Ga0268266_10266727
1052 Ga0268265_10112457
1053 Ga0268265_10131618
1054 Ga0268264_10000049
1055 Ga0268264_10222899
1056 Ga0265334_10035257
1057 Ga0307517_10002212
1058 Ga0307515_10031180
1059 Ga0307515_10334411
1060 Ga0265338_10072170
1061 Ga0307511_10187003
1062 Ga0265330_10014628
1063 Ga0265330_10042218
1064 Ga0265330_10055596
1065 Ga0265332_10061827
1066 Ga0265340_10003251
1067 Ga0265340_10012264
1068 Ga0265340_10069117
1069 Ga0265339_10009816
1070 Ga0265339_10031616
1071 Ga0265331_10050174
1072 Ga0265316_10078500
1073 Ga0265316_10169632
1074 Ga0265316_10466465
1075 Ga0307509_10091066
1076 Ga0307509_10401052
1077 Ga0265313_10026653
1078 Ga0265313_10038429
1079 Ga0307508_10083807
1080 Ga0307508_10475144
1081 Ga0265342_10012805
1082 Ga0265342_10103040
1083 Ga0307516_10316954
1084 Ga0307409_100542770
1085 Ga0307507_10076569
1086 Ga0307510_10032374
1087 Ga0307510_10268403
1088 Ga0373950_0001895
1089 Ga0373928_0007411
1090 Ga0373934_0022031
1091 Ga0373951_0025349
1092 Ga0373923_0057769
1093 Ga0373936_0096891
1094 Ga0373941_0103319
1095 Ga0373945_0052731
1096 Ga0373953_0001507
1097 Ga0373953_0062006
1098 Ga0373954_0000611
1099 Ga0373954_0065128
1100 Ga0373956_0001898
1101 Ga0373957_0073546
1102 Ga0373957_0113745
1103 Ga0373946_0071532
1104 Ga0373955_0005153
1105 Ga0373942_0008766
1106 Ga0373924_0044223
1107 Ga0373931_0002204
1108 Ga0373935_0029617
1109 Ga0373935_0043094
1110 Ga0373935_0275100
1111 Ga0373935_0327693
1112 Ga0373927_0004862
1113 Ga0373927_0028145
1114 Ga0373927_0044200
1115 Ga0373927_0050720
1116 Ga0373927_0207941
1117 Ga0373927_0376963
1118 Ga0373933_0004009
1119 Ga0373947_0011593
1120 Ga0373947_0024859
1121 Ga0373947_0100916
1122 Ga0373947_0129596
1123 Ga0373947_0150172
1124 Ga0373947_0350597
1125 Ga0373937_0051786
1126 Ga0373937_0116476
1127 Ga0373925_0016736
1128 Ga0373925_0023018
1129 Ga0373925_0025836
1130 Ga0373925_0069253
1131 Ga0373925_0152184
1132 Ga0395900_0030405
1133 Ga0395900_0035384
1134 Ga0395900_0132588
1135 Ga0395898_0006663
1136 Ga0395898_0018371
1137 Ga0395901_0040740
1138 Ga0436365_0046962
1139 Ga0436365_0704293
1140 Ga0436365_1153094
1141 Ga0436365_1787641
1142 Ga0436360_0167936
1143 Ga0436360_1041607
1144 Ga0436361_0333797
1145 Ga0436363_0733303
1146 Ga0436363_0769516
1147 Ga0436363_0994048
1148 Ga0451793_1655420
1149 Ga0451797_1390215
1150 Ga0466965_0057357
1151 Ga0466963_0038075
1152 Ga0466971_0103383
1153 Ga0466959_0046779
1154 Ga0466958_0363586
1155 Ga0466967_0040815
1156 Ga0495617_045207
1157 Ga0495592_0001347
1158 Ga0495592_0031397
1159 Ga0495603_0046216
1160 Ga0495603_0103798
1161 Ga0495603_0140120
1162 Ga0495603_0333218
1163 Ga0495629_0000388
1164 Ga0495629_0039239
1165 Ga0495629_0285951
1166 Ga0495638_0025476
1167 Ga0495638_0026381
1168 Ga0495638_0047003
1169 Ga0495651_0003758
1170 Ga0495653_0017721
1171 Ga0495653_0278670
1172 Ga0495650_0034149
1173 Ga0495580_0064617
1174 Ga0495582_0028335
1175 Ga0495582_0036177
1176 Ga0495582_0166404
1177 Ga0495639_0012959
1178 Ga0495662_0056923
1179 Ga0495664_0007894
1180 Ga0495664_0105688
1181 Ga0495664_0119627
1182 Ga0495585_0027101
1183 Ga0495606_0135477
1184 Ga0495608_0011088
1185 Ga0495608_0122979
1186 Ga0495610_0054995
1187 Ga0495628_0071510
1188 Ga0495628_0076997
1189 Ga0495630_0049306
1190 Ga0495630_0178396
1191 Ga0495652_0002755
1192 Ga0495652_0171536
1193 Ga0495652_0197156
1194 Ga0495652_0376167
1195 Ga0495665_0011166
1196 Ga0495640_0009675
1197 Ga0495640_0048652
1198 Ga0495645_0013630
1199 Ga0495622_0040606
1200 Ga0495633_0054767
1201 Ga0495633_0113441
1202 Ga0495667_0003989
1203 Ga0495656_0318773
1204 Ga0495634_0008124
1205 Ga0495634_0018721
1206 Ga0495634_0028639
1207 Ga0495611_0189063
1208 Ga0495635_0000278
1209 Ga0495588_0020818
1210 Ga0495599_0001883
1211 Ga0495623_0014126
1212 Ga0495646_0027150
1213 Ga0495646_0033123
1214 Ga0495647_0003016
1215 Ga0495658_0028970
1216 Ga0495669_0126149
1217 Ga0495613_0019077
1218 Ga0495613_0052291
1219 Ga0495624_0161353
1220 Ga0495670_0050620
1221 Ga0495671_0070182
1222 Ga0495600_0070808
1223 Ga0495581_0029850
1224 Ga0495604_0006228
1225 Ga0495604_0191300
1226 Ga0495674_0024456
1227 Ga0495674_0599653
1228 Ga0495672_0014613
1229 Ga0495672_0028598
1230 Ga0495672_0033373
1231 Ga0495676_0143197
1232 Ga0495680_0001213
1233 Ga0495675_0010868
1234 Ga0495673_0059846
1235 Ga0495684_0000161
1236 Ga0495684_0007850
1237 Ga0495684_0311749
1238 Ga0495593_0000707
1239 Ga0495593_0067256
1240 Ga0495593_0071916
1241 Ga0495593_0167877
1242 Ga0495593_0229078
1243 Ga0496100_0152844
1244 Ga0496100_0198628
1245 Ga0496100_0348333
1246 Ga0496101_0029687
1247 Ga0496101_0066739
1248 Ga0496102_0140603
1249 Ga0496102_0239417
1250 Ga0496104_0167720
1251 Ga0496104_0359416
1252 Ga0496104_0389744
1253 Ga0496104_0478887
1254 Ga0496104_0841392
1255 Ga0496105_0011867
1256 Ga0496105_0046894
1257 Ga0496105_0077423
1258 Ga0496106_0231165
1259 Ga0496107_0002722
1260 Ga0496107_0029803
1261 Ga0496107_0072309
1262 Ga0496107_0103445
1263 Ga0496108_0000792
1264 Ga0496108_0036715
1265 Ga0496108_0085022
1266 Ga0496108_0281491
1267 Ga0496108_0397536
1268 Ga0496108_0655600
1269 Ga0496109_0102220
1270 Ga0496109_0336717
1271 Ga0496109_0367207
1272 Ga0496110_0078644
1273 Ga0496110_0208039
1274 Ga0496111_0076753
1275 Ga0496111_0207368
1276 Ga0496111_0210723
1277 Ga0496111_0231605
1278 Ga0496111_0615249
1279 Ga0496112_0053183
1280 Ga0496112_0061146
1281 Ga0496113_0085515
1282 Ga0496113_0174224
1283 Ga0496114_0453793
1284 Ga0496114_0476340
1285 Ga0496114_0920488
1286 Ga0496115_0023207
1287 Ga0496115_0049251
1288 Ga0496115_0055274
1289 Ga0496115_0318572
1290 Ga0496115_0469112
1291 Ga0496121_0006401
1292 Ga0496121_0017018
1293 Ga0496121_0055421
1294 Ga0496121_0090735
1295 Ga0496121_0194447
1296 Ga0496121_0205326
1297 Ga0496121_0483748
1298 Ga0496124_0229533
1299 Ga0496124_0574545
1300 Ga0496125_0000243
1301 Ga0496125_0003560
1302 Ga0496126_0006360
1303 Ga0496126_0026526
1304 Ga0496126_0061203
1305 Ga0496126_0064692
1306 Ga0496126_0084298
1307 Ga0496126_0103728
1308 Ga0496126_0309518
1309 Ga0501034_0053245
1310 Ga0501034_0175214
1311 Ga0501034_0265617
1312 Ga0501036_0455310
1313 Ga0501039_0283053
1314 Ga0501041_0168786
1315 Ga0501047_0624864
1316 Ga0501067_0013330
1317 Ga0501070_0160503
1318 Ga0501080_0446253
1319 Ga0501035_0000904
1320 Ga0501035_0323490
1321 Ga0501044_0168686
1322 Ga0501044_0465654
1323 nmdc:mga07m45_295693_c1
1324 nmdc:mga09592_30270_c1
1325 nmdc:mga08x19_165610_c1
1326 nmdc:mga0a205_165849_c1
1327 Ga0495601_0083575
1328 Ga0495601_0089172
1329 Ga0495601_0110134
1330 Ga0495601_0219423
1331 Ga0495601_0284575
1332 Ga0495601_0415710
1333 Ga0495612_0023480
1334 Ga0495595_0002151
1335 Ga0495595_0019276
1336 Ga0495619_0001354
1337 Ga0495619_0068250
1338 Ga0495619_0189719
1339 Ga0495619_0452467
1340 Ga0500581_030744
1341 Ga0500647_0116930
1342 Ga0500566_0000288
1343 Ga0500566_0149438
1344 Ga0500641_0006163
1345 Ga0500641_0108974
1346 Ga0500650_0011842
1347 Ga0500572_003081
1348 Ga0500595_005666
1349 Ga0500595_011180
1350 Ga0500595_018417
1351 Ga0500595_080519
1352 Ga0500597_213677
1353 Ga0500608_018708
1354 Ga0500614_009355
1355 Ga0500559_0000393
1356 Ga0500559_0068806
1357 Ga0500568_0008039
1358 Ga0500568_0015491
1359 Ga0500577_0001891
1360 Ga0500590_060708
1361 Ga0500590_216986
1362 Ga0500603_009718
1363 Ga0500603_050643
1364 Ga0500604_0004008
1365 Ga0500616_0000046
1366 Ga0500616_0004625
1367 Ga0500624_004975
1368 Ga0500638_002593
1369 Ga0500638_175109
1370 Ga0500639_004787
1371 Ga0500639_132645
1372 Ga0500636_0087629
1373 Ga0500637_0000174
1374 Ga0500637_0101673
1375 Ga0500637_0344714
1376 Ga0500552_008871
1377 Ga0500552_026530
1378 Ga0500601_005500
1379 Ga0500661_000298
1380 Ga0501082_0318012
1381 Ga0466962_0124762
1382 2507505729
1383 2508539928
1384 2508695993
1385 2513889734
1386 2515627743
1387 2524435602
1388 2524533252
1389 2723842161
1390 2745079858
1391 2893066966
1392 2903778096
1393 2906633757
1394 2935614783
1395 2935649176
1396 2935658052
1397 2935826177
1398 2935853673
1399 2935978408
1400 2935985460
1401 2936012271
1402 2936020648
1403 2936029564
1404 2936051971
1405 2936056772
1406 8016585645
1407 8016635110
1408 8019622168
1409 8019631144
1410 8019639475
1411 8019677373
1412 8019687581
1413 8056679279
1414 8056683516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

83

221

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8325 14 228
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8319 14 228
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8248 14 228
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8241 14 228
6u15-assembly1.cif.gz_A human thymine dna glycosylase n140a mutant bound to dna with 2'-f-5-carboxyl-dc substrate analog 0.703 65 88
ID Description Score Start End Superfamily
af_P9WIJ5_2_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.8365 68 87 3.40.630.20
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8003 41 146 3.60.21.10
af_K7TM89_136_328_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7487 38 124 3.60.21.10
af_P87154_267_496_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7337 64 87 3.30.420.10
af_O62218_254_453_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7215 64 87 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A336JQT6-F1-model_v4 Putative phosphoesterase 0.9808 14 234 GO:0016787
AF-A0A537T9T2-F1-model_v4 Ligase-associated DNA damage response endonuclease PdeM (EC 3.1.-.-) 0.9767 14 234 GO:0004519
GO:0016874
AF-A0A7W3YHU8-F1-model_v4 deleted 0.9738 14 234
AF-A0A1V4I393-F1-model_v4 Phosphoesterase 0.9735 14 234 GO:0016787
AF-A0A1H8NGS3-F1-model_v4 Putative phosphoesterase 0.97 12 234 GO:0016787

Map