F476341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 258 | 699 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300005549|Ga0070704_100199048|Ga0070704_1001990481 |
| Length | 356 |
| Sequence | MSQPDQSPRDQRSRIRLTEKVKAAGAGKLGPADLAVILGTLPRSRHPDLLVGVETSDDAGIFRLRDDLAIVNTVDFFTPVVDDPYTYGLISATNSLSDVYAMGGEPKTAMNIVCFPQSGLEKEILVEILRGGGDKATEAGVAVVGGHSVADDEIKYGMAVTGVIDPRKIIRNVGVQKGDVVVLTKPLGTGILTTALKRGHLSEEEYGAAVMSMSTLNAKAAQVMSRYSVHACTDVTGFSLMGHGCEMAMGSKLTLRLRSSLLPVLPGALRLSLEGYVTGGCQRNRNYLADKVQVADSVSRDLNEVAFDPQTSGGLLIVIPASEAPALTRELLGEGVLAAAVIGEVVAPTGVWVELV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 3 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 4 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 5 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 6 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 235 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 236 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 237 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 244 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 245 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 246 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 96.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1337615 | 2162886007 | Bacteria | 1626 |
| 2 | JGI24748J21848_1000004 | 3300002074 | Bacteria | 262344 |
| 3 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 4 | JGI24751J29686_10000003 | 3300002459 | Bacteria | 157815 |
| 5 | JGI25406J46586_10003375 | 3300003203 | Bacteria | 7520 |
| 6 | JGI25406J46586_10029515 | 3300003203 | Bacteria | 2074 |
| 7 | Ga0058860_12137405 | 3300004801 | Bacteria | 3552 |
| 8 | Ga0065714_10064425 | 3300005288 | Bacteria | 189652 |
| 9 | Ga0065704_10014094 | 3300005289 | Unclassified | 1822 |
| 10 | Ga0065704_10100121 | 3300005289 | Bacteria | 2286 |
| 11 | Ga0065712_10006311 | 3300005290 | Bacteria | 3233 |
| 12 | Ga0065712_10067727 | 3300005290 | Bacteria | 189643 |
| 13 | Ga0065715_10003739 | 3300005293 | Unclassified | 4745 |
| 14 | Ga0065715_10090321 | 3300005293 | Bacteria | 7209 |
| 15 | Ga0065715_10091106 | 3300005293 | Bacteria | 6106 |
| 16 | Ga0065715_10250985 | 3300005293 | Bacteria | 1167 |
| 17 | Ga0065707_10088064 | 3300005295 | Bacteria | 4793 |
| 18 | Ga0065707_10094598 | 3300005295 | Bacteria | 3476 |
| 19 | Ga0070658_10242258 | 3300005327 | Bacteria | 1528 |
| 20 | Ga0070676_10090647 | 3300005328 | Unclassified | 1872 |
| 21 | Ga0070676_10127539 | 3300005328 | Bacteria | 1605 |
| 22 | Ga0070690_100004956 | 3300005330 | Bacteria | 7447 |
| 23 | Ga0070690_100063346 | 3300005330 | Bacteria | 2386 |
| 24 | Ga0070690_100361939 | 3300005330 | Bacteria | 1056 |
| 25 | Ga0070670_100000223 | 3300005331 | Bacteria | 52272 |
| 26 | Ga0070670_100000832 | 3300005331 | Bacteria | 24107 |
| 27 | Ga0070670_100222499 | 3300005331 | Bacteria | 1642 |
| 28 | Ga0070670_100349392 | 3300005331 | Viruses | 1299 |
| 29 | Ga0070670_100354032 | 3300005331 | Bacteria | 1290 |
| 30 | Ga0070677_10054187 | 3300005333 | Unclassified | 1633 |
| 31 | Ga0068869_100015163 | 3300005334 | Bacteria | 5162 |
| 32 | Ga0068869_100079568 | 3300005334 | Unclassified | 2443 |
| 33 | Ga0068869_100083377 | 3300005334 | Bacteria | 2391 |
| 34 | Ga0068869_100131371 | 3300005334 | Bacteria | 1925 |
| 35 | Ga0068869_100167619 | 3300005334 | Unclassified | 1714 |
| 36 | Ga0068869_100246292 | 3300005334 | Bacteria | 1426 |
| 37 | Ga0070680_100002231 | 3300005336 | Bacteria | 14296 |
| 38 | Ga0070680_100028397 | 3300005336 | Bacteria | 4487 |
| 39 | Ga0070680_100034926 | 3300005336 | Bacteria | 4056 |
| 40 | Ga0070680_100103572 | 3300005336 | Bacteria | 2364 |
| 41 | Ga0070682_100000210 | 3300005337 | Bacteria | 42814 |
| 42 | Ga0070682_100001346 | 3300005337 | Bacteria | 13865 |
| 43 | Ga0070682_100028470 | 3300005337 | Unclassified | 3360 |
| 44 | Ga0068868_100010333 | 3300005338 | Bacteria | 6750 |
| 45 | Ga0068868_100046778 | 3300005338 | Bacteria | 3387 |
| 46 | Ga0068868_100078827 | 3300005338 | Bacteria | 2637 |
| 47 | Ga0068868_100147137 | 3300005338 | Bacteria | 1938 |
| 48 | Ga0070660_100066988 | 3300005339 | Bacteria | 2797 |
| 49 | Ga0070689_100002015 | 3300005340 | Bacteria | 13172 |
| 50 | Ga0070689_100069366 | 3300005340 | Bacteria | 2750 |
| 51 | Ga0070689_100083569 | 3300005340 | Bacteria | 2509 |
| 52 | Ga0070689_100286632 | 3300005340 | Bacteria | 1367 |
| 53 | Ga0070691_10105214 | 3300005341 | Bacteria | 1406 |
| 54 | Ga0070687_100003618 | 3300005343 | Bacteria | 6033 |
| 55 | Ga0070687_100034513 | 3300005343 | Bacteria | 2505 |
| 56 | Ga0070687_100087191 | 3300005343 | Bacteria | 1717 |
| 57 | Ga0070687_100098454 | 3300005343 | Bacteria | 1633 |
| 58 | Ga0070692_10064465 | 3300005345 | Unclassified | 1938 |
| 59 | Ga0070692_10075891 | 3300005345 | Bacteria | 1801 |
| 60 | Ga0070668_100008204 | 3300005347 | Bacteria | 7755 |
| 61 | Ga0070669_100002272 | 3300005353 | Bacteria | 13944 |
| 62 | Ga0070669_100027227 | 3300005353 | Bacteria | 4114 |
| 63 | Ga0070675_100088570 | 3300005354 | Bacteria | 2590 |
| 64 | Ga0070671_100002475 | 3300005355 | Bacteria | 14278 |
| 65 | Ga0070671_100131427 | 3300005355 | Bacteria | 2108 |
| 66 | Ga0070674_100054321 | 3300005356 | Bacteria | 2770 |
| 67 | Ga0070674_100058068 | 3300005356 | Bacteria | 2688 |
| 68 | Ga0070674_100140853 | 3300005356 | Bacteria | 1810 |
| 69 | Ga0070673_100078240 | 3300005364 | Bacteria | 2675 |
| 70 | Ga0070673_100143015 | 3300005364 | Unclassified | 2020 |
| 71 | Ga0070659_100002515 | 3300005366 | Bacteria | 13013 |
| 72 | Ga0070703_10002983 | 3300005406 | Unclassified | 4837 |
| 73 | Ga0070703_10038684 | 3300005406 | Bacteria | 1476 |
| 74 | Ga0070709_10000172 | 3300005434 | Bacteria | 40757 |
| 75 | Ga0070713_100139028 | 3300005436 | Bacteria | 2149 |
| 76 | Ga0070710_10088387 | 3300005437 | Unclassified | 1823 |
| 77 | Ga0070701_10127615 | 3300005438 | Bacteria | 1441 |
| 78 | Ga0070701_10170328 | 3300005438 | Bacteria | 1268 |
| 79 | Ga0070701_10180342 | 3300005438 | Unclassified | 1236 |
| 80 | Ga0070711_100000001 | 3300005439 | Bacteria | 370591 |
| 81 | Ga0070705_100000011 | 3300005440 | Bacteria | 101991 |
| 82 | Ga0070705_100003338 | 3300005440 | Bacteria | 7878 |
| 83 | Ga0070705_100022640 | 3300005440 | Bacteria | 3361 |
| 84 | Ga0070700_100011138 | 3300005441 | Bacteria | 4977 |
| 85 | Ga0070700_100148489 | 3300005441 | Unclassified | 1601 |
| 86 | Ga0070700_100230644 | 3300005441 | Bacteria | 1317 |
| 87 | Ga0070700_100266430 | 3300005441 | Bacteria | 1236 |
| 88 | Ga0070700_100307860 | 3300005441 | Unclassified | 1159 |
| 89 | Ga0070694_100007445 | 3300005444 | Bacteria | 6675 |
| 90 | Ga0070694_100088175 | 3300005444 | Bacteria | 2172 |
| 91 | Ga0070694_100133875 | 3300005444 | Bacteria | 1794 |
| 92 | Ga0070708_100000042 | 3300005445 | Bacteria | 83511 |
| 93 | Ga0070708_100050004 | 3300005445 | Bacteria | 3700 |
| 94 | Ga0070708_100177779 | 3300005445 | Unclassified | 1989 |
| 95 | Ga0070708_100203521 | 3300005445 | Bacteria | 1854 |
| 96 | Ga0070708_100378567 | 3300005445 | Unclassified | 1335 |
| 97 | Ga0070708_100396565 | 3300005445 | Bacteria | 1301 |
| 98 | Ga0070678_100106033 | 3300005456 | Bacteria | 2189 |
| 99 | Ga0070678_100307244 | 3300005456 | Unclassified | 1350 |
| 100 | Ga0070662_100212879 | 3300005457 | Bacteria | 1539 |
| 101 | Ga0070662_100276793 | 3300005457 | Bacteria | 1357 |
| 102 | Ga0070681_10000053 | 3300005458 | Bacteria | 81387 |
| 103 | Ga0070681_10135803 | 3300005458 | Bacteria | 2390 |
| 104 | Ga0068867_100099941 | 3300005459 | Bacteria | 2214 |
| 105 | Ga0070685_10042711 | 3300005466 | Bacteria | 2588 |
| 106 | Ga0070706_100000053 | 3300005467 | Bacteria | 139565 |
| 107 | Ga0070706_100003837 | 3300005467 | Bacteria | 14689 |
| 108 | Ga0070706_100006976 | 3300005467 | Bacteria | 10655 |
| 109 | Ga0070706_100007447 | 3300005467 | Bacteria | 10263 |
| 110 | Ga0070706_100036769 | 3300005467 | Bacteria | 4523 |
| 111 | Ga0070706_100047089 | 3300005467 | Bacteria | 3979 |
| 112 | Ga0070706_100159707 | 3300005467 | Archaea | 2104 |
| 113 | Ga0070707_100000054 | 3300005468 | Bacteria | 100665 |
| 114 | Ga0070707_100000077 | 3300005468 | Bacteria | 86719 |
| 115 | Ga0070707_100108527 | 3300005468 | Bacteria | 2692 |
| 116 | Ga0070707_100191962 | 3300005468 | Bacteria | 1992 |
| 117 | Ga0070707_100192345 | 3300005468 | Unclassified | 1989 |
| 118 | Ga0070707_100197538 | 3300005468 | Bacteria | 1961 |
| 119 | Ga0070698_100000593 | 3300005471 | Bacteria | 38912 |
| 120 | Ga0070698_100015537 | 3300005471 | Bacteria | 8041 |
| 121 | Ga0070698_100065940 | 3300005471 | Unclassified | 3645 |
| 122 | Ga0070698_100074043 | 3300005471 | Bacteria | 3411 |
| 123 | Ga0070698_100193382 | 3300005471 | Unclassified | 1972 |
| 124 | Ga0070698_100213709 | 3300005471 | Unclassified | 1863 |
| 125 | Ga0070699_100000013 | 3300005518 | Bacteria | 241303 |
| 126 | Ga0070699_100003703 | 3300005518 | Bacteria | 13518 |
| 127 | Ga0070699_100009019 | 3300005518 | Bacteria | 8640 |
| 128 | Ga0070699_100018502 | 3300005518 | Bacteria | 5983 |
| 129 | Ga0070699_100021527 | 3300005518 | Bacteria | 5560 |
| 130 | Ga0070699_100065528 | 3300005518 | Bacteria | 3152 |
| 131 | Ga0070699_100126910 | 3300005518 | Bacteria | 2247 |
| 132 | Ga0070699_100407477 | 3300005518 | Bacteria | 1230 |
| 133 | Ga0070679_100000030 | 3300005530 | Bacteria | 108148 |
| 134 | Ga0070697_100000815 | 3300005536 | Bacteria | 23370 |
| 135 | Ga0070697_100002202 | 3300005536 | Bacteria | 14960 |
| 136 | Ga0070697_100011445 | 3300005536 | Bacteria | 6935 |
| 137 | Ga0070697_100064289 | 3300005536 | Bacteria | 2997 |
| 138 | Ga0070697_100146251 | 3300005536 | Archaea | 1990 |
| 139 | Ga0070697_100307415 | 3300005536 | Bacteria | 1363 |
| 140 | Ga0068853_100031052 | 3300005539 | Unclassified | 4517 |
| 141 | Ga0070672_100039328 | 3300005543 | Unclassified | 3622 |
| 142 | Ga0070672_100077995 | 3300005543 | Bacteria | 2650 |
| 143 | Ga0070686_100003241 | 3300005544 | Bacteria | 8908 |
| 144 | Ga0070686_100003645 | 3300005544 | Bacteria | 8450 |
| 145 | Ga0070686_100040199 | 3300005544 | Unclassified | 2917 |
| 146 | Ga0070686_100059983 | 3300005544 | Bacteria | 2453 |
| 147 | Ga0070686_100104425 | 3300005544 | Unclassified | 1919 |
| 148 | Ga0070695_100024536 | 3300005545 | Bacteria | 3716 |
| 149 | Ga0070695_100155756 | 3300005545 | Unclassified | 1599 |
| 150 | Ga0070695_100265798 | 3300005545 | Bacteria | 1255 |
| 151 | Ga0070696_100000142 | 3300005546 | Bacteria | 39428 |
| 152 | Ga0070696_100016605 | 3300005546 | Bacteria | 4962 |
| 153 | Ga0070696_100029196 | 3300005546 | Bacteria | 3767 |
| 154 | Ga0070696_100060099 | 3300005546 | Bacteria | 2657 |
| 155 | Ga0070696_100128008 | 3300005546 | Bacteria | 1845 |
| 156 | Ga0070693_100001963 | 3300005547 | Bacteria | 9418 |
| 157 | Ga0070693_100011793 | 3300005547 | Unclassified | 4408 |
| 158 | Ga0070693_100019543 | 3300005547 | Bacteria | 3554 |
| 159 | Ga0070693_100020774 | 3300005547 | Unclassified | 3469 |
| 160 | Ga0070693_100076970 | 3300005547 | Bacteria | 1978 |
| 161 | Ga0070693_100134441 | 3300005547 | Bacteria | 1550 |
| 162 | Ga0070704_100199048 | 3300005549 | Bacteria | 1616 |
| 163 | Ga0070664_100000993 | 3300005564 | Bacteria | 22209 |
| 164 | Ga0070664_100312632 | 3300005564 | Bacteria | 1422 |
| 165 | Ga0068857_100000975 | 3300005577 | Bacteria | 21916 |
| 166 | Ga0068857_100190378 | 3300005577 | Bacteria | 1868 |
| 167 | Ga0068857_100204409 | 3300005577 | Unclassified | 1801 |
| 168 | Ga0068857_100228896 | 3300005577 | Unclassified | 1700 |
| 169 | Ga0068854_100064865 | 3300005578 | Bacteria | 2654 |
| 170 | Ga0068854_100148373 | 3300005578 | Bacteria | 1806 |
| 171 | Ga0068854_100203136 | 3300005578 | Unclassified | 1559 |
| 172 | Ga0068856_100020464 | 3300005614 | Bacteria | 6427 |
| 173 | Ga0070702_100091268 | 3300005615 | Bacteria | 1848 |
| 174 | Ga0070702_100141079 | 3300005615 | Bacteria | 1535 |
| 175 | Ga0070702_100209884 | 3300005615 | Bacteria | 1295 |
| 176 | Ga0068852_100160271 | 3300005616 | Bacteria | 2100 |
| 177 | Ga0068859_100007068 | 3300005617 | Bacteria | 11402 |
| 178 | Ga0068859_100012132 | 3300005617 | Bacteria | 8661 |
| 179 | Ga0068859_100012145 | 3300005617 | Bacteria | 8656 |
| 180 | Ga0068859_100025911 | 3300005617 | Bacteria | 5883 |
| 181 | Ga0068859_100032153 | 3300005617 | Bacteria | 5270 |
| 182 | Ga0068859_100042357 | 3300005617 | Bacteria | 4573 |
| 183 | Ga0068859_100060003 | 3300005617 | Bacteria | 3833 |
| 184 | Ga0068859_100081126 | 3300005617 | Bacteria | 3286 |
| 185 | Ga0068859_100268515 | 3300005617 | Bacteria | 1798 |
| 186 | Ga0068859_100329059 | 3300005617 | Unclassified | 1622 |
| 187 | Ga0068864_100010943 | 3300005618 | Bacteria | 7499 |
| 188 | Ga0068864_100127453 | 3300005618 | Bacteria | 2282 |
| 189 | Ga0068864_100344366 | 3300005618 | Unclassified | 1405 |
| 190 | Ga0068864_100360564 | 3300005618 | Bacteria | 1374 |
| 191 | Ga0068864_100647532 | 3300005618 | Unclassified | 1029 |
| 192 | Ga0068866_10023361 | 3300005718 | Bacteria | 2875 |
| 193 | Ga0068861_100045022 | 3300005719 | Bacteria | 3321 |
| 194 | Ga0068861_100123195 | 3300005719 | Bacteria | 2094 |
| 195 | Ga0068861_100146057 | 3300005719 | Unclassified | 1936 |
| 196 | Ga0068861_100155583 | 3300005719 | Bacteria | 1880 |
| 197 | Ga0068861_100192133 | 3300005719 | Bacteria | 1707 |
| 198 | Ga0068861_100224486 | 3300005719 | Bacteria | 1589 |
| 199 | Ga0068861_100331902 | 3300005719 | Unclassified | 1328 |
| 200 | Ga0068851_10001956 | 3300005834 | Bacteria | 9053 |
| 201 | Ga0068851_10093969 | 3300005834 | Bacteria | 1583 |
| 202 | Ga0068870_10137998 | 3300005840 | Bacteria | 1424 |
| 203 | Ga0068870_10226527 | 3300005840 | Bacteria | 1147 |
| 204 | Ga0068863_100029077 | 3300005841 | Bacteria | 5277 |
| 205 | Ga0068863_100038234 | 3300005841 | Bacteria | 4566 |
| 206 | Ga0068863_100202130 | 3300005841 | Bacteria | 1911 |
| 207 | Ga0068863_100327197 | 3300005841 | Bacteria | 1490 |
| 208 | Ga0068863_100331448 | 3300005841 | Bacteria | 1479 |
| 209 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 210 | Ga0068858_100015618 | 3300005842 | Bacteria | 7141 |
| 211 | Ga0068858_100018142 | 3300005842 | Bacteria | 6592 |
| 212 | Ga0068858_100018604 | 3300005842 | Bacteria | 6504 |
| 213 | Ga0068858_100127881 | 3300005842 | Bacteria | 2381 |
| 214 | Ga0068858_100211798 | 3300005842 | Unclassified | 1834 |
| 215 | Ga0068858_100244599 | 3300005842 | Bacteria | 1703 |
| 216 | Ga0068860_100062022 | 3300005843 | Bacteria | 3552 |
| 217 | Ga0068860_100068444 | 3300005843 | Bacteria | 3373 |
| 218 | Ga0068860_100120344 | 3300005843 | Bacteria | 2514 |
| 219 | Ga0068860_100129295 | 3300005843 | Bacteria | 2422 |
| 220 | Ga0068862_100022410 | 3300005844 | Bacteria | 5283 |
| 221 | Ga0068862_100056733 | 3300005844 | Bacteria | 3356 |
| 222 | Ga0068862_100060739 | 3300005844 | Bacteria | 3248 |
| 223 | Ga0068862_100075997 | 3300005844 | Unclassified | 2906 |
| 224 | Ga0068862_100197680 | 3300005844 | Bacteria | 1812 |
| 225 | Ga0081455_10034672 | 3300005937 | Bacteria | 4519 |
| 226 | Ga0081455_10035005 | 3300005937 | Unclassified | 4493 |
| 227 | Ga0081539_10000063 | 3300005985 | Bacteria | 248201 |
| 228 | Ga0081539_10000481 | 3300005985 | Bacteria | 84382 |
| 229 | Ga0081539_10000505 | 3300005985 | Bacteria | 81474 |
| 230 | Ga0081539_10001527 | 3300005985 | Bacteria | 38778 |
| 231 | Ga0081539_10003540 | 3300005985 | Bacteria | 18990 |
| 232 | Ga0081539_10011665 | 3300005985 | Bacteria | 6911 |
| 233 | Ga0070715_10000024 | 3300006163 | Bacteria | 110647 |
| 234 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 235 | Ga0070716_100022229 | 3300006173 | Unclassified | 3349 |
| 236 | Ga0070716_100030114 | 3300006173 | Unclassified | 2941 |
| 237 | Ga0070716_100031763 | 3300006173 | Bacteria | 2875 |
| 238 | Ga0097621_100007343 | 3300006237 | Bacteria | 7880 |
| 239 | Ga0097621_100017050 | 3300006237 | Bacteria | 5508 |
| 240 | Ga0068871_100010860 | 3300006358 | Bacteria | 6667 |
| 241 | Ga0068871_100044081 | 3300006358 | Bacteria | 3585 |
| 242 | Ga0068871_100090330 | 3300006358 | Bacteria | 2551 |
| 243 | Ga0068871_100246900 | 3300006358 | Bacteria | 1554 |
| 244 | Ga0068871_100412566 | 3300006358 | Bacteria | 1204 |
| 245 | Ga0075428_100014706 | 3300006844 | Bacteria | 8691 |
| 246 | Ga0075428_100074253 | 3300006844 | Bacteria | 3714 |
| 247 | Ga0075430_100017261 | 3300006846 | Bacteria | 6148 |
| 248 | Ga0075430_100021301 | 3300006846 | Bacteria | 5511 |
| 249 | Ga0075430_100044394 | 3300006846 | Bacteria | 3759 |
| 250 | Ga0075430_100275422 | 3300006846 | Bacteria | 1392 |
| 251 | Ga0075430_100430194 | 3300006846 | Bacteria | 1089 |
| 252 | Ga0075431_100061591 | 3300006847 | Bacteria | 3872 |
| 253 | Ga0075431_100157924 | 3300006847 | Bacteria | 2333 |
| 254 | Ga0075431_100207546 | 3300006847 | Bacteria | 2002 |
| 255 | Ga0075431_100463409 | 3300006847 | Unclassified | 1262 |
| 256 | Ga0075433_10016589 | 3300006852 | Bacteria | 6076 |
| 257 | Ga0075433_10113416 | 3300006852 | Bacteria | 2404 |
| 258 | Ga0075433_10126172 | 3300006852 | Bacteria | 2273 |
| 259 | Ga0075433_10202530 | 3300006852 | Bacteria | 1764 |
| 260 | Ga0075433_10448625 | 3300006852 | Unclassified | 1137 |
| 261 | Ga0075434_100015289 | 3300006871 | Bacteria | 7355 |
| 262 | Ga0075434_100031077 | 3300006871 | Bacteria | 5263 |
| 263 | Ga0075434_100046071 | 3300006871 | Bacteria | 4327 |
| 264 | Ga0075434_100068328 | 3300006871 | Bacteria | 3540 |
| 265 | Ga0075434_100097509 | 3300006871 | Unclassified | 2944 |
| 266 | Ga0075434_100263547 | 3300006871 | Bacteria | 1742 |
| 267 | Ga0075434_100438326 | 3300006871 | Bacteria | 1328 |
| 268 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 269 | Ga0075436_100001803 | 3300006914 | Bacteria | 14671 |
| 270 | Ga0075436_100005634 | 3300006914 | Bacteria | 8596 |
| 271 | Ga0075436_100130482 | 3300006914 | Bacteria | 1762 |
| 272 | Ga0097620_100007068 | 3300006931 | Bacteria | 11402 |
| 273 | Ga0097620_100012131 | 3300006931 | Bacteria | 8661 |
| 274 | Ga0097620_100012145 | 3300006931 | Bacteria | 8656 |
| 275 | Ga0097620_100025911 | 3300006931 | Bacteria | 5883 |
| 276 | Ga0097620_100032153 | 3300006931 | Bacteria | 5270 |
| 277 | Ga0097620_100042356 | 3300006931 | Bacteria | 4573 |
| 278 | Ga0097620_100060005 | 3300006931 | Bacteria | 3833 |
| 279 | Ga0097620_100081129 | 3300006931 | Bacteria | 3286 |
| 280 | Ga0097620_100268509 | 3300006931 | Bacteria | 1798 |
| 281 | Ga0097620_100329059 | 3300006931 | Unclassified | 1622 |
| 282 | Ga0075435_100000689 | 3300007076 | Bacteria | 20967 |
| 283 | Ga0075435_100043657 | 3300007076 | Bacteria | 3589 |
| 284 | Ga0075435_100144084 | 3300007076 | Bacteria | 2000 |
| 285 | Ga0075435_100368076 | 3300007076 | Bacteria | 1234 |
| 286 | Ga0099794_10016619 | 3300007265 | Bacteria | 3265 |
| 287 | Ga0111539_10002073 | 3300009094 | Bacteria | 26784 |
| 288 | Ga0111539_10021012 | 3300009094 | Bacteria | 8039 |
| 289 | Ga0111539_10043272 | 3300009094 | Bacteria | 5399 |
| 290 | Ga0111539_10075324 | 3300009094 | Bacteria | 3976 |
| 291 | Ga0111539_10076926 | 3300009094 | Bacteria | 3929 |
| 292 | Ga0111539_10468096 | 3300009094 | Bacteria | 1467 |
| 293 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 294 | Ga0105247_10010710 | 3300009101 | Bacteria | 5536 |
| 295 | Ga0105247_10024038 | 3300009101 | Bacteria | 3670 |
| 296 | Ga0114129_10001970 | 3300009147 | Bacteria | 28080 |
| 297 | Ga0114129_10026989 | 3300009147 | Bacteria | 8130 |
| 298 | Ga0114129_10029655 | 3300009147 | Bacteria | 7748 |
| 299 | Ga0114129_10037669 | 3300009147 | Bacteria | 6826 |
| 300 | Ga0114129_10103290 | 3300009147 | Bacteria | 3941 |
| 301 | Ga0114129_10142560 | 3300009147 | Bacteria | 3283 |
| 302 | Ga0114129_10236022 | 3300009147 | Unclassified | 2460 |
| 303 | Ga0114129_10252410 | 3300009147 | Unclassified | 2367 |
| 304 | Ga0114129_10285625 | 3300009147 | Bacteria | 2203 |
| 305 | Ga0114129_10326501 | 3300009147 | Bacteria | 2039 |
| 306 | Ga0114129_10341933 | 3300009147 | Bacteria | 1984 |
| 307 | Ga0114129_10347258 | 3300009147 | Bacteria | 1966 |
| 308 | Ga0114129_10366736 | 3300009147 | Bacteria | 1905 |
| 309 | Ga0114129_10496983 | 3300009147 | Bacteria | 1594 |
| 310 | Ga0114129_10823858 | 3300009147 | Bacteria | 1182 |
| 311 | Ga0105243_10000037 | 3300009148 | Bacteria | 175237 |
| 312 | Ga0105243_10001856 | 3300009148 | Bacteria | 18034 |
| 313 | Ga0105243_10002586 | 3300009148 | Bacteria | 15104 |
| 314 | Ga0105243_10178955 | 3300009148 | Bacteria | 1843 |
| 315 | Ga0105241_10026459 | 3300009174 | Bacteria | 4317 |
| 316 | Ga0105241_10055416 | 3300009174 | Bacteria | 3037 |
| 317 | Ga0105241_10070579 | 3300009174 | Bacteria | 2710 |
| 318 | Ga0105241_10109508 | 3300009174 | Bacteria | 2209 |
| 319 | Ga0105241_10274335 | 3300009174 | Unclassified | 1438 |
| 320 | Ga0105241_10299486 | 3300009174 | Bacteria | 1380 |
| 321 | Ga0105241_10400550 | 3300009174 | Bacteria | 1204 |
| 322 | Ga0105242_10000276 | 3300009176 | Bacteria | 40893 |
| 323 | Ga0105242_10002534 | 3300009176 | Bacteria | 14339 |
| 324 | Ga0105242_10042712 | 3300009176 | Bacteria | 3663 |
| 325 | Ga0105242_10077113 | 3300009176 | Bacteria | 2780 |
| 326 | Ga0105242_10597151 | 3300009176 | Bacteria | 1066 |
| 327 | Ga0105248_10001987 | 3300009177 | Bacteria | 22745 |
| 328 | Ga0105248_10044241 | 3300009177 | Bacteria | 4994 |
| 329 | Ga0105248_10114735 | 3300009177 | Bacteria | 3038 |
| 330 | Ga0105248_10181845 | 3300009177 | Bacteria | 2369 |
| 331 | Ga0105248_10209409 | 3300009177 | Bacteria | 2197 |
| 332 | Ga0105248_10243410 | 3300009177 | Bacteria | 2025 |
| 333 | Ga0105248_10368877 | 3300009177 | Bacteria | 1616 |
| 334 | Ga0105248_10415580 | 3300009177 | Bacteria | 1515 |
| 335 | Ga0105237_10000521 | 3300009545 | Bacteria | 54240 |
| 336 | Ga0105238_10014544 | 3300009551 | Bacteria | 7959 |
| 337 | Ga0105249_10000201 | 3300009553 | Bacteria | 68199 |
| 338 | Ga0105249_10003117 | 3300009553 | Bacteria | 14331 |
| 339 | Ga0105249_10033991 | 3300009553 | Bacteria | 4618 |
| 340 | Ga0105249_10141454 | 3300009553 | Bacteria | 2308 |
| 341 | Ga0105239_10025216 | 3300010375 | Bacteria | 6547 |
| 342 | Ga0105239_10163707 | 3300010375 | Bacteria | 2486 |
| 343 | Ga0105239_10169569 | 3300010375 | Bacteria | 2440 |
| 344 | Ga0105239_10171201 | 3300010375 | Unclassified | 2428 |
| 345 | Ga0105246_10020812 | 3300011119 | Bacteria | 4213 |
| 346 | Ga0105246_10055773 | 3300011119 | Bacteria | 2729 |
| 347 | Ga0157373_10027431 | 3300013100 | Unclassified | 4108 |
| 348 | Ga0157373_10035143 | 3300013100 | Bacteria | 3599 |
| 349 | Ga0157374_10061420 | 3300013296 | Bacteria | 3519 |
| 350 | Ga0157374_10151739 | 3300013296 | Archaea | 2253 |
| 351 | Ga0157378_10000003 | 3300013297 | Bacteria | 203725 |
| 352 | Ga0157378_10003542 | 3300013297 | Bacteria | 13841 |
| 353 | Ga0157378_10006907 | 3300013297 | Bacteria | 9909 |
| 354 | Ga0157378_10033382 | 3300013297 | Bacteria | 4549 |
| 355 | Ga0157378_10035238 | 3300013297 | Unclassified | 4426 |
| 356 | Ga0157378_10079059 | 3300013297 | Bacteria | 2968 |
| 357 | Ga0157378_10116680 | 3300013297 | Bacteria | 2455 |
| 358 | Ga0157378_10127396 | 3300013297 | Bacteria | 2353 |
| 359 | Ga0157378_10138281 | 3300013297 | Unclassified | 2260 |
| 360 | Ga0157378_10208081 | 3300013297 | Unclassified | 1854 |
| 361 | Ga0163162_10000128 | 3300013306 | Bacteria | 68199 |
| 362 | Ga0163162_10003297 | 3300013306 | Bacteria | 15445 |
| 363 | Ga0163162_10008501 | 3300013306 | Bacteria | 10011 |
| 364 | Ga0163162_10034610 | 3300013306 | Bacteria | 5027 |
| 365 | Ga0163162_10051702 | 3300013306 | Unclassified | 4123 |
| 366 | Ga0163162_10093097 | 3300013306 | Bacteria | 3098 |
| 367 | Ga0163162_10183957 | 3300013306 | Bacteria | 2216 |
| 368 | Ga0163162_10759394 | 3300013306 | Bacteria | 1089 |
| 369 | Ga0157372_10034510 | 3300013307 | Bacteria | 5561 |
| 370 | Ga0157372_10406380 | 3300013307 | Bacteria | 1587 |
| 371 | Ga0157372_10454346 | 3300013307 | Bacteria | 1493 |
| 372 | Ga0157375_10001282 | 3300013308 | Bacteria | 21701 |
| 373 | Ga0157375_10004533 | 3300013308 | Bacteria | 12068 |
| 374 | Ga0157375_10034724 | 3300013308 | Bacteria | 4807 |
| 375 | Ga0157375_10244699 | 3300013308 | Bacteria | 1953 |
| 376 | Ga0157375_10526137 | 3300013308 | Bacteria | 1345 |
| 377 | Ga0157375_10567054 | 3300013308 | Unclassified | 1296 |
| 378 | Ga0163163_10002306 | 3300014325 | Bacteria | 16112 |
| 379 | Ga0163163_10023389 | 3300014325 | Bacteria | 5864 |
| 380 | Ga0163163_10026850 | 3300014325 | Bacteria | 5508 |
| 381 | Ga0163163_10046151 | 3300014325 | Bacteria | 4279 |
| 382 | Ga0163163_10056787 | 3300014325 | Bacteria | 3869 |
| 383 | Ga0163163_10066321 | 3300014325 | Bacteria | 3585 |
| 384 | Ga0163163_10218947 | 3300014325 | Unclassified | 1952 |
| 385 | Ga0157380_10046187 | 3300014326 | Bacteria | 3419 |
| 386 | Ga0157380_10086540 | 3300014326 | Bacteria | 2575 |
| 387 | Ga0157380_10101260 | 3300014326 | Bacteria | 2400 |
| 388 | Ga0157377_10013264 | 3300014745 | Bacteria | 4168 |
| 389 | Ga0157377_10051554 | 3300014745 | Bacteria | 2321 |
| 390 | Ga0157379_10167026 | 3300014968 | Bacteria | 1986 |
| 391 | Ga0157379_10175535 | 3300014968 | Bacteria | 1935 |
| 392 | Ga0157379_10579716 | 3300014968 | Bacteria | 1046 |
| 393 | Ga0163161_10014806 | 3300017792 | Bacteria | 5434 |
| 394 | Ga0163161_10031371 | 3300017792 | Bacteria | 3786 |
| 395 | Ga0163161_10070307 | 3300017792 | Bacteria | 2559 |
| 396 | Ga0213873_10006726 | 3300021358 | Bacteria | 2274 |
| 397 | Ga0213874_10027178 | 3300021377 | Bacteria | 1626 |
| 398 | Ga0213876_10000068 | 3300021384 | Bacteria | 125977 |
| 399 | Ga0213876_10000094 | 3300021384 | Bacteria | 100182 |
| 400 | Ga0207672_1000084 | 3300025223 | Bacteria | 12333 |
| 401 | Ga0207656_10003148 | 3300025321 | Bacteria | 5650 |
| 402 | Ga0207653_10000133 | 3300025885 | Bacteria | 53038 |
| 403 | Ga0207653_10001368 | 3300025885 | Bacteria | 7953 |
| 404 | Ga0207642_10039445 | 3300025899 | Unclassified | 2052 |
| 405 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 406 | Ga0207710_10000808 | 3300025900 | Bacteria | 16971 |
| 407 | Ga0207710_10058100 | 3300025900 | Bacteria | 1748 |
| 408 | Ga0207688_10069484 | 3300025901 | Bacteria | 1996 |
| 409 | Ga0207688_10098098 | 3300025901 | Bacteria | 1689 |
| 410 | Ga0207647_10008624 | 3300025904 | Bacteria | 7292 |
| 411 | Ga0207647_10055588 | 3300025904 | Bacteria | 2432 |
| 412 | Ga0207685_10000018 | 3300025905 | Bacteria | 145715 |
| 413 | Ga0207699_10000135 | 3300025906 | Bacteria | 50093 |
| 414 | Ga0207645_10020581 | 3300025907 | Bacteria | 4316 |
| 415 | Ga0207645_10105724 | 3300025907 | Unclassified | 1819 |
| 416 | Ga0207643_10001384 | 3300025908 | Bacteria | 13921 |
| 417 | Ga0207643_10005878 | 3300025908 | Bacteria | 6553 |
| 418 | Ga0207684_10000053 | 3300025910 | Bacteria | 225260 |
| 419 | Ga0207684_10000075 | 3300025910 | Bacteria | 183366 |
| 420 | Ga0207684_10000175 | 3300025910 | Bacteria | 106336 |
| 421 | Ga0207684_10007834 | 3300025910 | Bacteria | 9555 |
| 422 | Ga0207684_10044488 | 3300025910 | Bacteria | 3765 |
| 423 | Ga0207684_10276287 | 3300025910 | Bacteria | 1449 |
| 424 | Ga0207684_10287968 | 3300025910 | Bacteria | 1417 |
| 425 | Ga0207684_10460033 | 3300025910 | Unclassified | 1092 |
| 426 | Ga0207654_10053857 | 3300025911 | Bacteria | 2324 |
| 427 | Ga0207654_10300874 | 3300025911 | Bacteria | 1091 |
| 428 | Ga0207707_10000063 | 3300025912 | Bacteria | 108163 |
| 429 | Ga0207707_10143343 | 3300025912 | Bacteria | 2088 |
| 430 | Ga0207707_10358457 | 3300025912 | Bacteria | 1256 |
| 431 | Ga0207695_10063425 | 3300025913 | Bacteria | 3810 |
| 432 | Ga0207671_10002243 | 3300025914 | Bacteria | 20925 |
| 433 | Ga0207663_10000001 | 3300025916 | Bacteria | 591990 |
| 434 | Ga0207660_10004704 | 3300025917 | Bacteria | 8885 |
| 435 | Ga0207660_10021218 | 3300025917 | Bacteria | 4366 |
| 436 | Ga0207660_10060362 | 3300025917 | Unclassified | 2726 |
| 437 | Ga0207660_10257537 | 3300025917 | Unclassified | 1379 |
| 438 | Ga0207662_10007338 | 3300025918 | Bacteria | 5998 |
| 439 | Ga0207662_10091757 | 3300025918 | Bacteria | 1869 |
| 440 | Ga0207657_10074317 | 3300025919 | Bacteria | 2871 |
| 441 | Ga0207652_10000091 | 3300025921 | Bacteria | 98787 |
| 442 | Ga0207646_10000076 | 3300025922 | Bacteria | 135473 |
| 443 | Ga0207646_10000900 | 3300025922 | Bacteria | 38311 |
| 444 | Ga0207646_10010198 | 3300025922 | Bacteria | 9201 |
| 445 | Ga0207646_10025394 | 3300025922 | Bacteria | 5420 |
| 446 | Ga0207646_10159084 | 3300025922 | Bacteria | 2038 |
| 447 | Ga0207646_10163184 | 3300025922 | Bacteria | 2011 |
| 448 | Ga0207681_10000966 | 3300025923 | Bacteria | 18757 |
| 449 | Ga0207681_10010828 | 3300025923 | Bacteria | 5602 |
| 450 | Ga0207681_10085292 | 3300025923 | Unclassified | 2241 |
| 451 | Ga0207694_10008843 | 3300025924 | Bacteria | 7597 |
| 452 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 453 | Ga0207650_10005207 | 3300025925 | Bacteria | 8869 |
| 454 | Ga0207650_10105768 | 3300025925 | Bacteria | 2173 |
| 455 | Ga0207650_10107413 | 3300025925 | Bacteria | 2156 |
| 456 | Ga0207700_10138581 | 3300025928 | Bacteria | 1996 |
| 457 | Ga0207644_10000636 | 3300025931 | Bacteria | 22253 |
| 458 | Ga0207706_10127571 | 3300025933 | Bacteria | 2237 |
| 459 | Ga0207706_10133299 | 3300025933 | Bacteria | 2185 |
| 460 | Ga0207706_10137694 | 3300025933 | Bacteria | 2148 |
| 461 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 462 | Ga0207686_10000127 | 3300025934 | Bacteria | 61880 |
| 463 | Ga0207686_10001296 | 3300025934 | Bacteria | 14326 |
| 464 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 465 | Ga0207709_10001732 | 3300025935 | Bacteria | 14688 |
| 466 | Ga0207709_10012319 | 3300025935 | Unclassified | 4712 |
| 467 | Ga0207709_10211324 | 3300025935 | Unclassified | 1393 |
| 468 | Ga0207709_10325175 | 3300025935 | Bacteria | 1152 |
| 469 | Ga0207670_10000756 | 3300025936 | Bacteria | 16999 |
| 470 | Ga0207670_10034615 | 3300025936 | Bacteria | 3267 |
| 471 | Ga0207670_10065483 | 3300025936 | Bacteria | 2494 |
| 472 | Ga0207670_10237301 | 3300025936 | Bacteria | 1403 |
| 473 | Ga0207669_10181883 | 3300025937 | Unclassified | 1508 |
| 474 | Ga0207704_10064467 | 3300025938 | Bacteria | 2289 |
| 475 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 476 | Ga0207665_10023684 | 3300025939 | Bacteria | 4044 |
| 477 | Ga0207665_10040686 | 3300025939 | Bacteria | 3102 |
| 478 | Ga0207665_10043262 | 3300025939 | Bacteria | 3011 |
| 479 | Ga0207665_10125245 | 3300025939 | Bacteria | 1819 |
| 480 | Ga0207691_10008051 | 3300025940 | Bacteria | 10131 |
| 481 | Ga0207691_10072423 | 3300025940 | Bacteria | 3108 |
| 482 | Ga0207711_10051152 | 3300025941 | Bacteria | 3538 |
| 483 | Ga0207711_10092863 | 3300025941 | Bacteria | 2657 |
| 484 | Ga0207711_10139558 | 3300025941 | Bacteria | 2179 |
| 485 | Ga0207689_10004147 | 3300025942 | Bacteria | 13173 |
| 486 | Ga0207689_10015886 | 3300025942 | Bacteria | 6376 |
| 487 | Ga0207689_10197730 | 3300025942 | Bacteria | 1659 |
| 488 | Ga0207689_10248533 | 3300025942 | Bacteria | 1471 |
| 489 | Ga0207689_10258583 | 3300025942 | Bacteria | 1440 |
| 490 | Ga0207689_10334182 | 3300025942 | Unclassified | 1258 |
| 491 | Ga0207679_10070831 | 3300025945 | Bacteria | 2628 |
| 492 | Ga0207679_10199279 | 3300025945 | Bacteria | 1671 |
| 493 | Ga0207651_10056474 | 3300025960 | Bacteria | 2702 |
| 494 | Ga0207651_10423580 | 3300025960 | Bacteria | 1137 |
| 495 | Ga0207712_10000259 | 3300025961 | Bacteria | 51318 |
| 496 | Ga0207712_10014084 | 3300025961 | Bacteria | 5134 |
| 497 | Ga0207712_10050006 | 3300025961 | Bacteria | 2917 |
| 498 | Ga0207712_10075341 | 3300025961 | Bacteria | 2439 |
| 499 | Ga0207668_10002115 | 3300025972 | Bacteria | 11592 |
| 500 | Ga0207677_10070868 | 3300026023 | Bacteria | 2458 |
| 501 | Ga0207677_10142628 | 3300026023 | Bacteria | 1837 |
| 502 | Ga0207703_10000158 | 3300026035 | Bacteria | 78397 |
| 503 | Ga0207703_10033181 | 3300026035 | Bacteria | 4090 |
| 504 | Ga0207703_10106590 | 3300026035 | Unclassified | 2384 |
| 505 | Ga0207703_10115494 | 3300026035 | Unclassified | 2297 |
| 506 | Ga0207703_10139092 | 3300026035 | Bacteria | 2105 |
| 507 | Ga0207703_10140058 | 3300026035 | Unclassified | 2098 |
| 508 | Ga0207703_10195785 | 3300026035 | Bacteria | 1793 |
| 509 | Ga0207703_10269747 | 3300026035 | Archaea | 1541 |
| 510 | Ga0207703_10274780 | 3300026035 | Bacteria | 1528 |
| 511 | Ga0207703_10294039 | 3300026035 | Bacteria | 1479 |
| 512 | Ga0207639_10328729 | 3300026041 | Unclassified | 1359 |
| 513 | Ga0207708_10001411 | 3300026075 | Bacteria | 18027 |
| 514 | Ga0207708_10024047 | 3300026075 | Bacteria | 4607 |
| 515 | Ga0207708_10069370 | 3300026075 | Bacteria | 2699 |
| 516 | Ga0207708_10110412 | 3300026075 | Bacteria | 2134 |
| 517 | Ga0207702_10041969 | 3300026078 | Bacteria | 3836 |
| 518 | Ga0207641_10509349 | 3300026088 | Bacteria | 1170 |
| 519 | Ga0207648_10440568 | 3300026089 | Bacteria | 1185 |
| 520 | Ga0207648_10534254 | 3300026089 | Unclassified | 1076 |
| 521 | Ga0207676_10003650 | 3300026095 | Bacteria | 10884 |
| 522 | Ga0207676_10060804 | 3300026095 | Bacteria | 2989 |
| 523 | Ga0207676_10164944 | 3300026095 | Bacteria | 1924 |
| 524 | Ga0207676_10166525 | 3300026095 | Bacteria | 1916 |
| 525 | Ga0207676_10271609 | 3300026095 | Bacteria | 1536 |
| 526 | Ga0207674_10000058 | 3300026116 | Bacteria | 113012 |
| 527 | Ga0207674_10041265 | 3300026116 | Bacteria | 4774 |
| 528 | Ga0207674_10151902 | 3300026116 | Bacteria | 2272 |
| 529 | Ga0207674_10216492 | 3300026116 | Bacteria | 1864 |
| 530 | Ga0207674_10247125 | 3300026116 | Unclassified | 1731 |
| 531 | Ga0207674_10443566 | 3300026116 | Bacteria | 1254 |
| 532 | Ga0207675_100018476 | 3300026118 | Bacteria | 6503 |
| 533 | Ga0207675_100019567 | 3300026118 | Bacteria | 6317 |
| 534 | Ga0207675_100026731 | 3300026118 | Bacteria | 5371 |
| 535 | Ga0207675_100045493 | 3300026118 | Bacteria | 4100 |
| 536 | Ga0207675_100063633 | 3300026118 | Bacteria | 3447 |
| 537 | Ga0207675_100101016 | 3300026118 | Bacteria | 2717 |
| 538 | Ga0207675_100156763 | 3300026118 | Bacteria | 2170 |
| 539 | Ga0207675_100312992 | 3300026118 | Unclassified | 1531 |
| 540 | Ga0207675_100475963 | 3300026118 | Unclassified | 1241 |
| 541 | Ga0207683_10056980 | 3300026121 | Bacteria | 3429 |
| 542 | Ga0207683_10149236 | 3300026121 | Bacteria | 2109 |
| 543 | Ga0207698_10090003 | 3300026142 | Unclassified | 2509 |
| 544 | Ga0207698_10136274 | 3300026142 | Bacteria | 2107 |
| 545 | Ga0207428_10007052 | 3300027907 | Bacteria | 10291 |
| 546 | Ga0207428_10020238 | 3300027907 | Bacteria | 5657 |
| 547 | Ga0207428_10030203 | 3300027907 | Unclassified | 4483 |
| 548 | Ga0207428_10068043 | 3300027907 | Bacteria | 2802 |
| 549 | Ga0268265_10043384 | 3300028380 | Bacteria | 3343 |
| 550 | Ga0268265_10151949 | 3300028380 | Bacteria | 1954 |
| 551 | Ga0268264_10009644 | 3300028381 | Bacteria | 7998 |
| 552 | Ga0268264_10054523 | 3300028381 | Bacteria | 3338 |
| 553 | Ga0268264_10382992 | 3300028381 | Bacteria | 1347 |
| 554 | Ga0307408_100087903 | 3300031548 | Bacteria | 2340 |
| 555 | Ga0307408_100268235 | 3300031548 | Bacteria | 1416 |
| 556 | Ga0307405_10009530 | 3300031731 | Bacteria | 4983 |
| 557 | Ga0307405_10051723 | 3300031731 | Bacteria | 2550 |
| 558 | Ga0307405_10205402 | 3300031731 | Bacteria | 1434 |
| 559 | Ga0316577_10014294 | 3300031733 | Unclassified | 4355 |
| 560 | Ga0316577_10070805 | 3300031733 | Bacteria | 1946 |
| 561 | Ga0307410_10006757 | 3300031852 | Bacteria | 6221 |
| 562 | Ga0307410_10079440 | 3300031852 | Bacteria | 2299 |
| 563 | Ga0307406_10001697 | 3300031901 | Bacteria | 12099 |
| 564 | Ga0307407_10018518 | 3300031903 | Bacteria | 3524 |
| 565 | Ga0307412_10008182 | 3300031911 | Bacteria | 5962 |
| 566 | Ga0307412_10010460 | 3300031911 | Bacteria | 5344 |
| 567 | Ga0307412_10284482 | 3300031911 | Bacteria | 1300 |
| 568 | Ga0307409_100038578 | 3300031995 | Unclassified | 3535 |
| 569 | Ga0307409_100056583 | 3300031995 | Bacteria | 3034 |
| 570 | Ga0307416_100012028 | 3300032002 | Bacteria | 5808 |
| 571 | Ga0307416_100150381 | 3300032002 | Bacteria | 2134 |
| 572 | Ga0307416_100244694 | 3300032002 | Bacteria | 1741 |
| 573 | Ga0307416_100456675 | 3300032002 | Unclassified | 1331 |
| 574 | Ga0307414_10003043 | 3300032004 | Bacteria | 8895 |
| 575 | Ga0307414_10292018 | 3300032004 | Unclassified | 1375 |
| 576 | Ga0307415_100044997 | 3300032126 | Bacteria | 2956 |
| 577 | Ga0307415_100085996 | 3300032126 | Bacteria | 2261 |
| 578 | Ga0373951_0000704 | 3300035091 | Bacteria | 9185 |
| 579 | Ga0373942_0018891 | 3300035207 | Unclassified | 1715 |
| 580 | Ga0316584_0222976 | 3300036712 | Bacteria | 1384 |
| 581 | Ga0395900_0072279 | 3300037418 | Bacteria | 3547 |
| 582 | Ga0395905_0003272 | 3300037471 | Bacteria | 17409 |
| 583 | Ga0395905_0118981 | 3300037471 | Bacteria | 2483 |
| 584 | Ga0316581_0040790 | 3300037588 | Bacteria | 1414 |
| 585 | Ga0395901_0223438 | 3300038443 | Bacteria | 1968 |
| 586 | Ga0395901_0492305 | 3300038443 | Bacteria | 1249 |
| 587 | Ga0242422_04061 | 3300038699 | Bacteria | 935 |
| 588 | Ga0436365_0289912 | 3300039437 | Bacteria | 336570 |
| 589 | Ga0436365_0362873 | 3300039437 | Bacteria | 2303 |
| 590 | Ga0436365_0461431 | 3300039437 | Bacteria | 13193 |
| 591 | Ga0436365_0762848 | 3300039437 | Bacteria | 1474 |
| 592 | Ga0436365_0922078 | 3300039437 | Bacteria | 2479 |
| 593 | Ga0436365_1855834 | 3300039437 | Bacteria | 101657 |
| 594 | Ga0436360_0905083 | 3300039438 | Bacteria | 3907 |
| 595 | Ga0436360_1202911 | 3300039438 | Bacteria | 4036 |
| 596 | Ga0436363_0848427 | 3300039450 | Bacteria | 1320 |
| 597 | Ga0436363_1366655 | 3300039450 | Bacteria | 5155 |
| 598 | Ga0436363_1555706 | 3300039450 | Bacteria | 4757 |
| 599 | Ga0436362_0238646 | 3300039453 | Bacteria | 5471 |
| 600 | Ga0439462_0038101 | 3300042015 | Bacteria | 1282 |
| 601 | Ga0451577_0244069 | 3300042876 | Bacteria | 1625 |
| 602 | Ga0453683_0035457 | 3300044673 | Bacteria | 3143 |
| 603 | Ga0466966_0145827 | 3300044684 | Bacteria | 1445 |
| 604 | Ga0466961_0010407 | 3300044693 | Bacteria | 5935 |
| 605 | Ga0466963_0000529 | 3300044694 | Bacteria | 17918 |
| 606 | Ga0466963_0001029 | 3300044694 | Bacteria | 14473 |
| 607 | Ga0466963_0197063 | 3300044694 | Bacteria | 1408 |
| 608 | Ga0453684_0106606 | 3300044712 | Bacteria | 3415 |
| 609 | Ga0453684_0514922 | 3300044712 | Bacteria | 1323 |
| 610 | Ga0466971_0027874 | 3300044719 | Bacteria | 2530 |
| 611 | Ga0466957_0001729 | 3300044842 | Bacteria | 11503 |
| 612 | Ga0466959_0004805 | 3300045049 | Bacteria | 9123 |
| 613 | Ga0466959_0039345 | 3300045049 | Bacteria | 3494 |
| 614 | Ga0451576_0009797 | 3300045051 | Bacteria | 11073 |
| 615 | Ga0451576_0317466 | 3300045051 | Bacteria | 1630 |
| 616 | Ga0466958_0002786 | 3300045836 | Bacteria | 8888 |
| 617 | Ga0466967_0147509 | 3300045976 | Bacteria | 2195 |
| 618 | Ga0495610_0036772 | 3300046512 | Bacteria | 2499 |
| 619 | Ga0495663_0000141 | 3300046525 | Bacteria | 29337 |
| 620 | Ga0495652_0229147 | 3300046529 | Bacteria | 1391 |
| 621 | Ga0495621_0000577 | 3300046539 | Bacteria | 9154 |
| 622 | Ga0495621_0024228 | 3300046539 | Bacteria | 2026 |
| 623 | Ga0495621_0071521 | 3300046539 | Bacteria | 1279 |
| 624 | Ga0495670_0083029 | 3300046691 | Bacteria | 1634 |
| 625 | Ga0495672_0031489 | 3300047320 | Bacteria | 3311 |
| 626 | Ga0495680_0265660 | 3300047322 | Bacteria | 1213 |
| 627 | Ga0496104_0088689 | 3300048907 | Bacteria | 2955 |
| 628 | Ga0496104_0217274 | 3300048907 | Bacteria | 1824 |
| 629 | Ga0496106_0000699 | 3300048909 | Bacteria | 24103 |
| 630 | Ga0496106_0351967 | 3300048909 | Eukaryota | 1183 |
| 631 | Ga0496108_0137876 | 3300048911 | Bacteria | 2100 |
| 632 | Ga0496109_0000068 | 3300048912 | Bacteria | 110206 |
| 633 | Ga0496113_0310197 | 3300048916 | Bacteria | 1264 |
| 634 | Ga0501291_007196 | 3300049514 | Unclassified | 1502 |
| 635 | Ga0501298_010622 | 3300049521 | Unclassified | 1587 |
| 636 | Ga0501038_0007479 | 3300049574 | Bacteria | 10078 |
| 637 | Ga0501041_0276930 | 3300049577 | Unclassified | 1056 |
| 638 | Ga0501046_0270341 | 3300049580 | Bacteria | 1247 |
| 639 | Ga0501075_0246789 | 3300049591 | Unclassified | 1361 |
| 640 | Ga0501198_016832 | 3300049649 | Unclassified | 1133 |
| 641 | Ga0501202_000926 | 3300049652 | Bacteria | 4515 |
| 642 | Ga0501216_002105 | 3300049660 | Bacteria | 2791 |
| 643 | Ga0501217_007572 | 3300049661 | Unclassified | 2331 |
| 644 | Ga0501223_019820 | 3300049663 | Bacteria | 1320 |
| 645 | Ga0501223_020264 | 3300049663 | Unclassified | 1304 |
| 646 | Ga0501224_001637 | 3300049664 | Unclassified | 2999 |
| 647 | Ga0501249_023683 | 3300049679 | Unclassified | 1349 |
| 648 | Ga0501225_0003414 | 3300049705 | Bacteria | 4819 |
| 649 | Ga0501225_0005625 | 3300049705 | Unclassified | 3673 |
| 650 | Ga0501081_0313987 | 3300049743 | Unclassified | 1151 |
| 651 | Ga0501272_002671 | 3300049769 | Bacteria | 1773 |
| 652 | Ga0501273_005407 | 3300049770 | Unclassified | 1441 |
| 653 | Ga0501204_003138 | 3300049850 | Unclassified | 1719 |
| 654 | Ga0501212_003908 | 3300049851 | Unclassified | 1894 |
| 655 | nmdc:mga05p37_100796_c1 | 3300050507 | Unclassified | 3557 |
| 656 | nmdc:mga05p37_13047_c1 | 3300050507 | Bacteria | 9943 |
| 657 | nmdc:mga05p37_1311_c1 | 3300050507 | Bacteria | 28942 |
| 658 | nmdc:mga05p37_143270_c1 | 3300050507 | Unclassified | 2927 |
| 659 | nmdc:mga05p37_149278_c1 | 3300050507 | Bacteria | 2860 |
| 660 | nmdc:mga05p37_65024_c1 | 3300050507 | Bacteria | 4488 |
| 661 | nmdc:mga05p37_79373_c1 | 3300050507 | Bacteria | 4041 |
| 662 | nmdc:mga09592_118109_c1 | 3300050508 | Bacteria | 2276 |
| 663 | nmdc:mga09592_131622_c1 | 3300050508 | Bacteria | 2152 |
| 664 | nmdc:mga0qj67_265920_c1 | 3300050509 | Bacteria | 1391 |
| 665 | nmdc:mga0qj67_330481_c1 | 3300050509 | Bacteria | 1234 |
| 666 | nmdc:mga0qj67_353494_c1 | 3300050509 | Bacteria | 1188 |
| 667 | nmdc:mga06r32_19052_c1 | 3300050510 | Bacteria | 6292 |
| 668 | nmdc:mga06r32_213119_c1 | 3300050510 | Bacteria | 1919 |
| 669 | nmdc:mga06r32_30395_c1 | 3300050510 | Bacteria | 5067 |
| 670 | nmdc:mga06r32_99732_c1 | 3300050510 | Bacteria | 2849 |
| 671 | nmdc:mga08y16_12546_c1 | 3300050511 | Bacteria | 8917 |
| 672 | nmdc:mga08y16_172186_c1 | 3300050511 | Bacteria | 2249 |
| 673 | nmdc:mga08y16_274777_c1 | 3300050511 | Unclassified | 1739 |
| 674 | nmdc:mga08y16_304335_c1 | 3300050511 | Bacteria | 1643 |
| 675 | nmdc:mga08y16_5499_c1 | 3300050511 | Bacteria | 13248 |
| 676 | nmdc:mga08y16_8851_c1 | 3300050511 | Bacteria | 10566 |
| 677 | nmdc:mga0n895_105790_c1 | 3300050512 | Bacteria | 2826 |
| 678 | nmdc:mga0n895_145682_c1 | 3300050512 | Unclassified | 2398 |
| 679 | nmdc:mga0n895_6791_c1 | 3300050512 | Bacteria | 9766 |
| 680 | nmdc:mga0rr50_127700_c1 | 3300050513 | Bacteria | 2032 |
| 681 | nmdc:mga0rr50_3567_c1 | 3300050513 | Bacteria | 8989 |
| 682 | nmdc:mga0rr50_61526_c1 | 3300050513 | Bacteria | 2829 |
| 683 | nmdc:mga08x19_165449_c1 | 3300050514 | Bacteria | 1504 |
| 684 | nmdc:mga08x19_3501_c1 | 3300050514 | Bacteria | 9341 |
| 685 | nmdc:mga08x19_63905_c1 | 3300050514 | Bacteria | 2389 |
| 686 | nmdc:mga08x19_78771_c1 | 3300050514 | Unclassified | 2160 |
| 687 | nmdc:mga08x19_7_c1 | 3300050514 | Bacteria | 437351 |
| 688 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 689 | nmdc:mga0a205_135702_c1 | 3300050515 | Bacteria | 2361 |
| 690 | nmdc:mga0a205_17483_c2 | 3300050515 | Unclassified | 3444 |
| 691 | nmdc:mga0a205_183634_c1 | 3300050515 | Bacteria | 1985 |
| 692 | nmdc:mga0a205_296833_c1 | 3300050515 | Unclassified | 1489 |
| 693 | nmdc:mga0a205_383514_c1 | 3300050515 | Bacteria | 1270 |
| 694 | nmdc:mga0a205_39448_c1 | 3300050515 | Bacteria | 4545 |
| 695 | nmdc:mga0a205_89580_c1 | 3300050515 | Bacteria | 2974 |
| 696 | Ga0495655_0001853 | 3300053083 | Bacteria | 3296 |
| 697 | Ga0500641_0150771 | 3300053096 | Bacteria | 1004 |
| 698 | Ga0501084_0319581 | 3300054114 | Unclassified | 1311 |
| 699 | Ga0530510_0109749 | 3300061734 | Bacteria | 2020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0848427 | Ga0436363_0848427_60_1073 | 242 |
| 2 | 3300005440 | Ga0070705_100000011 | Ga0070705_1000000118 | 273 |
| 3 | 3300046512 | Ga0495610_0036772 | Ga0495610_0036772_134_1096 | 274 |
| 4 | 3300026118 | Ga0207675_100312992 | Ga0207675_1003129921 | 282 |
| 5 | 3300005330 | Ga0070690_100004956 | Ga0070690_1000049565 | 284 |
| 6 | 3300005338 | Ga0068868_100147137 | Ga0068868_1001471372 | 284 |
| 7 | 3300005343 | Ga0070687_100034513 | Ga0070687_1000345132 | 284 |
| 8 | 3300005441 | Ga0070700_100307860 | Ga0070700_1003078601 | 284 |
| 9 | 3300005444 | Ga0070694_100133875 | Ga0070694_1001338752 | 284 |
| 10 | 3300005543 | Ga0070672_100077995 | Ga0070672_1000779952 | 284 |
| 11 | 3300005544 | Ga0070686_100003241 | Ga0070686_1000032413 | 284 |
| 12 | 3300005617 | Ga0068859_100268515 | Ga0068859_1002685151 | 284 |
| 13 | 3300005719 | Ga0068861_100331902 | Ga0068861_1003319022 | 284 |
| 14 | 3300005842 | Ga0068858_100244599 | Ga0068858_1002445992 | 284 |
| 15 | 3300006931 | Ga0097620_100268509 | Ga0097620_1002685091 | 284 |
| 16 | 3300013297 | Ga0157378_10035238 | Ga0157378_100352384 | 284 |
| 17 | 3300017792 | Ga0163161_10070307 | Ga0163161_100703073 | 284 |
| 18 | 3300025918 | Ga0207662_10091757 | Ga0207662_100917572 | 284 |
| 19 | 3300025933 | Ga0207706_10137694 | Ga0207706_101376942 | 284 |
| 20 | 3300025942 | Ga0207689_10334182 | Ga0207689_103341821 | 284 |
| 21 | 3300026118 | Ga0207675_100475963 | Ga0207675_1004759631 | 284 |
| 22 | 3300005293 | Ga0065715_10003739 | Ga0065715_100037392 | 285 |
| 23 | 3300005293 | Ga0065715_10091106 | Ga0065715_100911068 | 285 |
| 24 | 3300005340 | Ga0070689_100002015 | Ga0070689_10000201510 | 285 |
| 25 | 3300005340 | Ga0070689_100286632 | Ga0070689_1002866322 | 285 |
| 26 | 3300005364 | Ga0070673_100143015 | Ga0070673_1001430152 | 285 |
| 27 | 3300005438 | Ga0070701_10180342 | Ga0070701_101803421 | 285 |
| 28 | 3300005440 | Ga0070705_100022640 | Ga0070705_1000226404 | 285 |
| 29 | 3300005545 | Ga0070695_100024536 | Ga0070695_1000245362 | 285 |
| 30 | 3300005545 | Ga0070695_100155756 | Ga0070695_1001557561 | 285 |
| 31 | 3300005617 | Ga0068859_100025911 | Ga0068859_1000259114 | 285 |
| 32 | 3300005617 | Ga0068859_100060003 | Ga0068859_1000600033 | 285 |
| 33 | 3300005617 | Ga0068859_100081126 | Ga0068859_1000811263 | 285 |
| 34 | 3300005618 | Ga0068864_100360564 | Ga0068864_1003605642 | 285 |
| 35 | 3300005841 | Ga0068863_100038234 | Ga0068863_1000382343 | 285 |
| 36 | 3300005841 | Ga0068863_100202130 | Ga0068863_1002021302 | 285 |
| 37 | 3300005985 | Ga0081539_10003540 | Ga0081539_100035401 | 285 |
| 38 | 3300006358 | Ga0068871_100010860 | Ga0068871_1000108604 | 285 |
| 39 | 3300006871 | Ga0075434_100015289 | Ga0075434_1000152892 | 285 |
| 40 | 3300006931 | Ga0097620_100025911 | Ga0097620_1000259114 | 285 |
| 41 | 3300006931 | Ga0097620_100060005 | Ga0097620_1000600053 | 285 |
| 42 | 3300006931 | Ga0097620_100081129 | Ga0097620_1000811293 | 285 |
| 43 | 3300009177 | Ga0105248_10181845 | Ga0105248_101818452 | 285 |
| 44 | 3300009177 | Ga0105248_10243410 | Ga0105248_102434102 | 285 |
| 45 | 3300009177 | Ga0105248_10415580 | Ga0105248_104155803 | 285 |
| 46 | 3300009551 | Ga0105238_10014544 | Ga0105238_100145444 | 285 |
| 47 | 3300013100 | Ga0157373_10035143 | Ga0157373_100351432 | 285 |
| 48 | 3300013308 | Ga0157375_10244699 | Ga0157375_102446992 | 285 |
| 49 | 3300025900 | Ga0207710_10000808 | Ga0207710_100008083 | 285 |
| 50 | 3300025904 | Ga0207647_10055588 | Ga0207647_100555882 | 285 |
| 51 | 3300025908 | Ga0207643_10001384 | Ga0207643_1000138414 | 285 |
| 52 | 3300025924 | Ga0207694_10008843 | Ga0207694_100088433 | 285 |
| 53 | 3300025936 | Ga0207670_10000756 | Ga0207670_100007566 | 285 |
| 54 | 3300025936 | Ga0207670_10237301 | Ga0207670_102373011 | 285 |
| 55 | 3300025941 | Ga0207711_10092863 | Ga0207711_100928631 | 285 |
| 56 | 3300025960 | Ga0207651_10423580 | Ga0207651_104235801 | 285 |
| 57 | 3300026035 | Ga0207703_10106590 | Ga0207703_101065902 | 285 |
| 58 | 3300026041 | Ga0207639_10328729 | Ga0207639_103287292 | 285 |
| 59 | 3300026095 | Ga0207676_10003650 | Ga0207676_100036508 | 285 |
| 60 | 3300026095 | Ga0207676_10166525 | Ga0207676_101665252 | 285 |
| 61 | 3300032004 | Ga0307414_10292018 | Ga0307414_102920181 | 285 |
| 62 | 3300035091 | Ga0373951_0000704 | Ga0373951_0000704_215_1075 | 285 |
| 63 | 3300035207 | Ga0373942_0018891 | Ga0373942_0018891_554_1414 | 285 |
| 64 | 3300038699 | Ga0242422_04061 | Ga0242422_04061_34_894 | 285 |
| 65 | 3300048911 | Ga0496108_0137876 | Ga0496108_0137876_22_879 | 285 |
| 66 | 3300050515 | nmdc:mga0a205_89580_c1 | nmdc:mga0a205_89580_c1_1250_2116 | 285 |
| 67 | 3300049521 | Ga0501298_010622 | Ga0501298_010622_74_943 | 286 |
| 68 | 3300049770 | Ga0501273_005407 | Ga0501273_005407_194_1063 | 286 |
| 69 | 3300049850 | Ga0501204_003138 | Ga0501204_003138_700_1569 | 286 |
| 70 | 3300011119 | Ga0105246_10020812 | Ga0105246_100208123 | 287 |
| 71 | 3300025923 | Ga0207681_10085292 | Ga0207681_100852923 | 287 |
| 72 | 3300026116 | Ga0207674_10443566 | Ga0207674_104435662 | 287 |
| 73 | 3300009176 | Ga0105242_10077113 | Ga0105242_100771132 | 288 |
| 74 | 3300061734 | Ga0530510_0109749 | Ga0530510_0109749_580_1575 | 288 |
| 75 | 3300005617 | Ga0068859_100042357 | Ga0068859_1000423572 | 292 |
| 76 | 3300006931 | Ga0097620_100042356 | Ga0097620_1000423562 | 292 |
| 77 | 3300009177 | Ga0105248_10044241 | Ga0105248_100442413 | 292 |
| 78 | 3300042015 | Ga0439462_0038101 | Ga0439462_0038101_150_1109 | 292 |
| 79 | 3300049649 | Ga0501198_016832 | Ga0501198_016832_193_1080 | 292 |
| 80 | 3300049769 | Ga0501272_002671 | Ga0501272_002671_527_1414 | 292 |
| 81 | 3300032002 | Ga0307416_100150381 | Ga0307416_1001503811 | 293 |
| 82 | 3300050510 | nmdc:mga06r32_213119_c1 | nmdc:mga06r32_213119_c1_19_981 | 294 |
| 83 | 3300005544 | Ga0070686_100003645 | Ga0070686_10000364510 | 295 |
| 84 | 3300005937 | Ga0081455_10034672 | Ga0081455_100346722 | 295 |
| 85 | 3300006852 | Ga0075433_10202530 | Ga0075433_102025301 | 295 |
| 86 | 3300006871 | Ga0075434_100438326 | Ga0075434_1004383261 | 295 |
| 87 | 3300007076 | Ga0075435_100144084 | Ga0075435_1001440842 | 295 |
| 88 | 3300009094 | Ga0111539_10076926 | Ga0111539_100769261 | 295 |
| 89 | 3300009147 | Ga0114129_10326501 | Ga0114129_103265011 | 295 |
| 90 | 3300009177 | Ga0105248_10368877 | Ga0105248_103688772 | 295 |
| 91 | 3300027907 | Ga0207428_10020238 | Ga0207428_100202383 | 295 |
| 92 | 3300050508 | nmdc:mga09592_131622_c1 | nmdc:mga09592_131622_c1_49_936 | 295 |
| 93 | 3300050510 | nmdc:mga06r32_99732_c1 | nmdc:mga06r32_99732_c1_1784_2677 | 295 |
| 94 | 3300050511 | nmdc:mga08y16_5499_c1 | nmdc:mga08y16_5499_c1_11682_12569 | 295 |
| 95 | 3300050513 | nmdc:mga0rr50_127700_c1 | nmdc:mga0rr50_127700_c1_333_1220 | 295 |
| 96 | 3300050515 | nmdc:mga0a205_135702_c1 | nmdc:mga0a205_135702_c1_582_1469 | 295 |
| 97 | 3300021358 | Ga0213873_10006726 | Ga0213873_100067261 | 297 |
| 98 | 3300039437 | Ga0436365_0362873 | Ga0436365_0362873_281_1294 | 297 |
| 99 | 3300039453 | Ga0436362_0238646 | Ga0436362_0238646_2191_3204 | 297 |
| 100 | 3300021377 | Ga0213874_10027178 | Ga0213874_100271782 | 298 |
| 101 | 3300039437 | Ga0436365_0461431 | Ga0436365_0461431_4318_5352 | 298 |
| 102 | 3300039437 | Ga0436365_0922078 | Ga0436365_0922078_879_1823 | 298 |
| 103 | 3300039438 | Ga0436360_1202911 | Ga0436360_1202911_2145_3158 | 298 |
| 104 | 3300039450 | Ga0436363_1366655 | Ga0436363_1366655_1035_2048 | 298 |
| 105 | 3300039450 | Ga0436363_1555706 | Ga0436363_1555706_213_1226 | 298 |
| 106 | 3300044684 | Ga0466966_0145827 | Ga0466966_0145827_101_1045 | 298 |
| 107 | 3300044693 | Ga0466961_0010407 | Ga0466961_0010407_3231_4262 | 298 |
| 108 | 3300044694 | Ga0466963_0000529 | Ga0466963_0000529_6008_6952 | 298 |
| 109 | 3300044694 | Ga0466963_0001029 | Ga0466963_0001029_12564_13595 | 298 |
| 110 | 3300044719 | Ga0466971_0027874 | Ga0466971_0027874_180_1211 | 298 |
| 111 | 3300044842 | Ga0466957_0001729 | Ga0466957_0001729_9233_10177 | 298 |
| 112 | 3300045049 | Ga0466959_0004805 | Ga0466959_0004805_3613_4557 | 298 |
| 113 | 3300045049 | Ga0466959_0039345 | Ga0466959_0039345_917_1948 | 298 |
| 114 | 3300045836 | Ga0466958_0002786 | Ga0466958_0002786_6727_7671 | 298 |
| 115 | 3300045976 | Ga0466967_0147509 | Ga0466967_0147509_435_1379 | 298 |
| 116 | 3300005295 | Ga0065707_10094598 | Ga0065707_100945983 | 302 |
| 117 | 3300005327 | Ga0070658_10242258 | Ga0070658_102422581 | 302 |
| 118 | 3300005330 | Ga0070690_100361939 | Ga0070690_1003619391 | 302 |
| 119 | 3300005331 | Ga0070670_100222499 | Ga0070670_1002224991 | 302 |
| 120 | 3300005336 | Ga0070680_100034926 | Ga0070680_1000349264 | 302 |
| 121 | 3300005459 | Ga0068867_100099941 | Ga0068867_1000999413 | 302 |
| 122 | 3300005564 | Ga0070664_100312632 | Ga0070664_1003126322 | 302 |
| 123 | 3300006844 | Ga0075428_100074253 | Ga0075428_1000742532 | 302 |
| 124 | 3300006846 | Ga0075430_100017261 | Ga0075430_1000172612 | 302 |
| 125 | 3300006846 | Ga0075430_100044394 | Ga0075430_1000443943 | 302 |
| 126 | 3300006846 | Ga0075430_100275422 | Ga0075430_1002754221 | 302 |
| 127 | 3300006846 | Ga0075430_100430194 | Ga0075430_1004301941 | 302 |
| 128 | 3300006847 | Ga0075431_100207546 | Ga0075431_1002075463 | 302 |
| 129 | 3300006871 | Ga0075434_100031077 | Ga0075434_1000310773 | 302 |
| 130 | 3300025933 | Ga0207706_10127571 | Ga0207706_101275711 | 302 |
| 131 | 3300025936 | Ga0207670_10034615 | Ga0207670_100346153 | 302 |
| 132 | 3300031731 | Ga0307405_10205402 | Ga0307405_102054022 | 302 |
| 133 | 3300031911 | Ga0307412_10284482 | Ga0307412_102844821 | 302 |
| 134 | 3300031995 | Ga0307409_100056583 | Ga0307409_1000565833 | 302 |
| 135 | 3300032126 | Ga0307415_100085996 | Ga0307415_1000859963 | 302 |
| 136 | 3300039438 | Ga0436360_0905083 | Ga0436360_0905083_2717_3664 | 302 |
| 137 | 3300044694 | Ga0466963_0197063 | Ga0466963_0197063_416_1384 | 302 |
| 138 | 3300046529 | Ga0495652_0229147 | Ga0495652_0229147_45_1094 | 302 |
| 139 | 3300050507 | nmdc:mga05p37_79373_c1 | nmdc:mga05p37_79373_c1_1105_2073 | 302 |
| 140 | 3300050509 | nmdc:mga0qj67_265920_c1 | nmdc:mga0qj67_265920_c1_110_1078 | 302 |
| 141 | 3300050509 | nmdc:mga0qj67_353494_c1 | nmdc:mga0qj67_353494_c1_164_1132 | 302 |
| 142 | 3300050510 | nmdc:mga06r32_19052_c1 | nmdc:mga06r32_19052_c1_5223_6191 | 302 |
| 143 | 3300050510 | nmdc:mga06r32_30395_c1 | nmdc:mga06r32_30395_c1_2591_3559 | 302 |
| 144 | 3300050512 | nmdc:mga0n895_6791_c1 | nmdc:mga0n895_6791_c1_4855_5823 | 302 |
| 145 | 3300004801 | Ga0058860_12137405 | Ga0058860_121374052 | 303 |
| 146 | 3300005356 | Ga0070674_100140853 | Ga0070674_1001408532 | 303 |
| 147 | 3300005438 | Ga0070701_10170328 | Ga0070701_101703282 | 303 |
| 148 | 3300005441 | Ga0070700_100266430 | Ga0070700_1002664301 | 303 |
| 149 | 3300005466 | Ga0070685_10042711 | Ga0070685_100427112 | 303 |
| 150 | 3300005617 | Ga0068859_100032153 | Ga0068859_1000321534 | 303 |
| 151 | 3300005719 | Ga0068861_100192133 | Ga0068861_1001921332 | 303 |
| 152 | 3300005985 | Ga0081539_10011665 | Ga0081539_100116652 | 303 |
| 153 | 3300006847 | Ga0075431_100157924 | Ga0075431_1001579242 | 303 |
| 154 | 3300006931 | Ga0097620_100032153 | Ga0097620_1000321532 | 303 |
| 155 | 3300009094 | Ga0111539_10075324 | Ga0111539_100753242 | 303 |
| 156 | 3300009101 | Ga0105247_10024038 | Ga0105247_100240382 | 303 |
| 157 | 3300009147 | Ga0114129_10347258 | Ga0114129_103472581 | 303 |
| 158 | 3300009553 | Ga0105249_10141454 | Ga0105249_101414542 | 303 |
| 159 | 3300013297 | Ga0157378_10127396 | Ga0157378_101273961 | 303 |
| 160 | 3300013306 | Ga0163162_10093097 | Ga0163162_100930972 | 303 |
| 161 | 3300013308 | Ga0157375_10034724 | Ga0157375_100347244 | 303 |
| 162 | 3300014326 | Ga0157380_10101260 | Ga0157380_101012601 | 303 |
| 163 | 3300025900 | Ga0207710_10058100 | Ga0207710_100581001 | 303 |
| 164 | 3300025961 | Ga0207712_10075341 | Ga0207712_100753412 | 303 |
| 165 | 3300026035 | Ga0207703_10274780 | Ga0207703_102747801 | 303 |
| 166 | 3300026118 | Ga0207675_100045493 | Ga0207675_1000454932 | 303 |
| 167 | 3300028380 | Ga0268265_10151949 | Ga0268265_101519492 | 303 |
| 168 | 3300050511 | nmdc:mga08y16_12546_c1 | nmdc:mga08y16_12546_c1_1420_2334 | 303 |
| 169 | 3300005445 | Ga0070708_100396565 | Ga0070708_1003965651 | 305 |
| 170 | 3300005289 | Ga0065704_10014094 | Ga0065704_100140942 | 306 |
| 171 | 3300005467 | Ga0070706_100006976 | Ga0070706_1000069766 | 306 |
| 172 | 3300005536 | Ga0070697_100000815 | Ga0070697_10000081520 | 306 |
| 173 | 3300005536 | Ga0070697_100002202 | Ga0070697_1000022028 | 306 |
| 174 | 3300013308 | Ga0157375_10001282 | Ga0157375_100012826 | 306 |
| 175 | 3300014325 | Ga0163163_10218947 | Ga0163163_102189472 | 306 |
| 176 | 3300025910 | Ga0207684_10007834 | Ga0207684_100078346 | 306 |
| 177 | 3300026116 | Ga0207674_10151902 | Ga0207674_101519022 | 306 |
| 178 | 3300047320 | Ga0495672_0031489 | Ga0495672_0031489_832_1752 | 306 |
| 179 | 2162886007 | SwRhRL2b_contig_1337615 | SwRhRL2b_0471.00004490 | 307 |
| 180 | 3300002074 | JGI24748J21848_1000004 | JGI24748J21848_1000004226 | 307 |
| 181 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001696 | 307 |
| 182 | 3300002459 | JGI24751J29686_10000003 | JGI24751J29686_1000000345 | 307 |
| 183 | 3300003203 | JGI25406J46586_10003375 | JGI25406J46586_100033756 | 307 |
| 184 | 3300003203 | JGI25406J46586_10029515 | JGI25406J46586_100295151 | 307 |
| 185 | 3300005288 | Ga0065714_10064425 | Ga0065714_10064425106 | 307 |
| 186 | 3300005289 | Ga0065704_10100121 | Ga0065704_101001212 | 307 |
| 187 | 3300005290 | Ga0065712_10006311 | Ga0065712_100063111 | 307 |
| 188 | 3300005290 | Ga0065712_10067727 | Ga0065712_10067727106 | 307 |
| 189 | 3300005293 | Ga0065715_10090321 | Ga0065715_100903213 | 307 |
| 190 | 3300005293 | Ga0065715_10250985 | Ga0065715_102509851 | 307 |
| 191 | 3300005295 | Ga0065707_10088064 | Ga0065707_100880642 | 307 |
| 192 | 3300005328 | Ga0070676_10090647 | Ga0070676_100906472 | 307 |
| 193 | 3300005328 | Ga0070676_10127539 | Ga0070676_101275392 | 307 |
| 194 | 3300005330 | Ga0070690_100063346 | Ga0070690_1000633463 | 307 |
| 195 | 3300005331 | Ga0070670_100000223 | Ga0070670_1000002239 | 307 |
| 196 | 3300005331 | Ga0070670_100000832 | Ga0070670_1000008324 | 307 |
| 197 | 3300005331 | Ga0070670_100349392 | Ga0070670_1003493922 | 307 |
| 198 | 3300005331 | Ga0070670_100354032 | Ga0070670_1003540321 | 307 |
| 199 | 3300005333 | Ga0070677_10054187 | Ga0070677_100541872 | 307 |
| 200 | 3300005334 | Ga0068869_100015163 | Ga0068869_1000151632 | 307 |
| 201 | 3300005334 | Ga0068869_100079568 | Ga0068869_1000795682 | 307 |
| 202 | 3300005334 | Ga0068869_100083377 | Ga0068869_1000833773 | 307 |
| 203 | 3300005334 | Ga0068869_100131371 | Ga0068869_1001313711 | 307 |
| 204 | 3300005334 | Ga0068869_100167619 | Ga0068869_1001676191 | 307 |
| 205 | 3300005334 | Ga0068869_100246292 | Ga0068869_1002462922 | 307 |
| 206 | 3300005336 | Ga0070680_100002231 | Ga0070680_1000022315 | 307 |
| 207 | 3300005336 | Ga0070680_100028397 | Ga0070680_1000283972 | 307 |
| 208 | 3300005336 | Ga0070680_100103572 | Ga0070680_1001035722 | 307 |
| 209 | 3300005337 | Ga0070682_100000210 | Ga0070682_10000021013 | 307 |
| 210 | 3300005337 | Ga0070682_100001346 | Ga0070682_10000134616 | 307 |
| 211 | 3300005337 | Ga0070682_100028470 | Ga0070682_1000284703 | 307 |
| 212 | 3300005338 | Ga0068868_100010333 | Ga0068868_1000103332 | 307 |
| 213 | 3300005338 | Ga0068868_100046778 | Ga0068868_1000467782 | 307 |
| 214 | 3300005338 | Ga0068868_100078827 | Ga0068868_1000788272 | 307 |
| 215 | 3300005339 | Ga0070660_100066988 | Ga0070660_1000669883 | 307 |
| 216 | 3300005340 | Ga0070689_100069366 | Ga0070689_1000693664 | 307 |
| 217 | 3300005340 | Ga0070689_100083569 | Ga0070689_1000835692 | 307 |
| 218 | 3300005341 | Ga0070691_10105214 | Ga0070691_101052142 | 307 |
| 219 | 3300005343 | Ga0070687_100003618 | Ga0070687_1000036184 | 307 |
| 220 | 3300005343 | Ga0070687_100087191 | Ga0070687_1000871912 | 307 |
| 221 | 3300005343 | Ga0070687_100098454 | Ga0070687_1000984542 | 307 |
| 222 | 3300005345 | Ga0070692_10064465 | Ga0070692_100644653 | 307 |
| 223 | 3300005345 | Ga0070692_10075891 | Ga0070692_100758912 | 307 |
| 224 | 3300005347 | Ga0070668_100008204 | Ga0070668_1000082044 | 307 |
| 225 | 3300005353 | Ga0070669_100002272 | Ga0070669_1000022724 | 307 |
| 226 | 3300005353 | Ga0070669_100027227 | Ga0070669_1000272272 | 307 |
| 227 | 3300005354 | Ga0070675_100088570 | Ga0070675_1000885701 | 307 |
| 228 | 3300005355 | Ga0070671_100002475 | Ga0070671_1000024758 | 307 |
| 229 | 3300005355 | Ga0070671_100131427 | Ga0070671_1001314272 | 307 |
| 230 | 3300005356 | Ga0070674_100054321 | Ga0070674_1000543214 | 307 |
| 231 | 3300005356 | Ga0070674_100058068 | Ga0070674_1000580681 | 307 |
| 232 | 3300005364 | Ga0070673_100078240 | Ga0070673_1000782401 | 307 |
| 233 | 3300005366 | Ga0070659_100002515 | Ga0070659_10000251512 | 307 |
| 234 | 3300005406 | Ga0070703_10002983 | Ga0070703_100029833 | 307 |
| 235 | 3300005406 | Ga0070703_10038684 | Ga0070703_100386843 | 307 |
| 236 | 3300005434 | Ga0070709_10000172 | Ga0070709_100001727 | 307 |
| 237 | 3300005436 | Ga0070713_100139028 | Ga0070713_1001390282 | 307 |
| 238 | 3300005437 | Ga0070710_10088387 | Ga0070710_100883872 | 307 |
| 239 | 3300005438 | Ga0070701_10127615 | Ga0070701_101276151 | 307 |
| 240 | 3300005439 | Ga0070711_100000001 | Ga0070711_10000000186 | 307 |
| 241 | 3300005440 | Ga0070705_100003338 | Ga0070705_1000033384 | 307 |
| 242 | 3300005441 | Ga0070700_100011138 | Ga0070700_1000111382 | 307 |
| 243 | 3300005441 | Ga0070700_100148489 | Ga0070700_1001484892 | 307 |
| 244 | 3300005441 | Ga0070700_100230644 | Ga0070700_1002306441 | 307 |
| 245 | 3300005444 | Ga0070694_100007445 | Ga0070694_1000074459 | 307 |
| 246 | 3300005444 | Ga0070694_100088175 | Ga0070694_1000881752 | 307 |
| 247 | 3300005445 | Ga0070708_100000042 | Ga0070708_10000004224 | 307 |
| 248 | 3300005445 | Ga0070708_100050004 | Ga0070708_1000500044 | 307 |
| 249 | 3300005445 | Ga0070708_100177779 | Ga0070708_1001777792 | 307 |
| 250 | 3300005445 | Ga0070708_100203521 | Ga0070708_1002035211 | 307 |
| 251 | 3300005445 | Ga0070708_100378567 | Ga0070708_1003785671 | 307 |
| 252 | 3300005456 | Ga0070678_100106033 | Ga0070678_1001060332 | 307 |
| 253 | 3300005456 | Ga0070678_100307244 | Ga0070678_1003072442 | 307 |
| 254 | 3300005457 | Ga0070662_100212879 | Ga0070662_1002128792 | 307 |
| 255 | 3300005457 | Ga0070662_100276793 | Ga0070662_1002767931 | 307 |
| 256 | 3300005458 | Ga0070681_10000053 | Ga0070681_1000005351 | 307 |
| 257 | 3300005458 | Ga0070681_10135803 | Ga0070681_101358032 | 307 |
| 258 | 3300005467 | Ga0070706_100000053 | Ga0070706_100000053117 | 307 |
| 259 | 3300005467 | Ga0070706_100003837 | Ga0070706_1000038378 | 307 |
| 260 | 3300005467 | Ga0070706_100007447 | Ga0070706_10000744713 | 307 |
| 261 | 3300005467 | Ga0070706_100036769 | Ga0070706_1000367692 | 307 |
| 262 | 3300005467 | Ga0070706_100047089 | Ga0070706_1000470892 | 307 |
| 263 | 3300005467 | Ga0070706_100159707 | Ga0070706_1001597072 | 307 |
| 264 | 3300005468 | Ga0070707_100000054 | Ga0070707_10000005417 | 307 |
| 265 | 3300005468 | Ga0070707_100000077 | Ga0070707_10000007721 | 307 |
| 266 | 3300005468 | Ga0070707_100108527 | Ga0070707_1001085272 | 307 |
| 267 | 3300005468 | Ga0070707_100191962 | Ga0070707_1001919622 | 307 |
| 268 | 3300005468 | Ga0070707_100192345 | Ga0070707_1001923452 | 307 |
| 269 | 3300005468 | Ga0070707_100197538 | Ga0070707_1001975382 | 307 |
| 270 | 3300005471 | Ga0070698_100000593 | Ga0070698_1000005937 | 307 |
| 271 | 3300005471 | Ga0070698_100015537 | Ga0070698_1000155374 | 307 |
| 272 | 3300005471 | Ga0070698_100065940 | Ga0070698_1000659402 | 307 |
| 273 | 3300005471 | Ga0070698_100074043 | Ga0070698_1000740431 | 307 |
| 274 | 3300005471 | Ga0070698_100193382 | Ga0070698_1001933822 | 307 |
| 275 | 3300005471 | Ga0070698_100213709 | Ga0070698_1002137092 | 307 |
| 276 | 3300005518 | Ga0070699_100000013 | Ga0070699_100000013174 | 307 |
| 277 | 3300005518 | Ga0070699_100003703 | Ga0070699_1000037037 | 307 |
| 278 | 3300005518 | Ga0070699_100009019 | Ga0070699_1000090195 | 307 |
| 279 | 3300005518 | Ga0070699_100018502 | Ga0070699_1000185029 | 307 |
| 280 | 3300005518 | Ga0070699_100021527 | Ga0070699_1000215277 | 307 |
| 281 | 3300005518 | Ga0070699_100065528 | Ga0070699_1000655282 | 307 |
| 282 | 3300005518 | Ga0070699_100126910 | Ga0070699_1001269102 | 307 |
| 283 | 3300005518 | Ga0070699_100407477 | Ga0070699_1004074771 | 307 |
| 284 | 3300005530 | Ga0070679_100000030 | Ga0070679_10000003076 | 307 |
| 285 | 3300005536 | Ga0070697_100011445 | Ga0070697_1000114458 | 307 |
| 286 | 3300005536 | Ga0070697_100064289 | Ga0070697_1000642893 | 307 |
| 287 | 3300005536 | Ga0070697_100146251 | Ga0070697_1001462511 | 307 |
| 288 | 3300005536 | Ga0070697_100307415 | Ga0070697_1003074151 | 307 |
| 289 | 3300005539 | Ga0068853_100031052 | Ga0068853_1000310523 | 307 |
| 290 | 3300005543 | Ga0070672_100039328 | Ga0070672_1000393283 | 307 |
| 291 | 3300005544 | Ga0070686_100040199 | Ga0070686_1000401992 | 307 |
| 292 | 3300005544 | Ga0070686_100059983 | Ga0070686_1000599832 | 307 |
| 293 | 3300005544 | Ga0070686_100104425 | Ga0070686_1001044253 | 307 |
| 294 | 3300005545 | Ga0070695_100265798 | Ga0070695_1002657981 | 307 |
| 295 | 3300005546 | Ga0070696_100000142 | Ga0070696_10000014222 | 307 |
| 296 | 3300005546 | Ga0070696_100016605 | Ga0070696_1000166056 | 307 |
| 297 | 3300005546 | Ga0070696_100029196 | Ga0070696_1000291963 | 307 |
| 298 | 3300005546 | Ga0070696_100060099 | Ga0070696_1000600992 | 307 |
| 299 | 3300005546 | Ga0070696_100128008 | Ga0070696_1001280082 | 307 |
| 300 | 3300005547 | Ga0070693_100001963 | Ga0070693_1000019637 | 307 |
| 301 | 3300005547 | Ga0070693_100011793 | Ga0070693_1000117936 | 307 |
| 302 | 3300005547 | Ga0070693_100019543 | Ga0070693_1000195433 | 307 |
| 303 | 3300005547 | Ga0070693_100020774 | Ga0070693_1000207743 | 307 |
| 304 | 3300005547 | Ga0070693_100076970 | Ga0070693_1000769702 | 307 |
| 305 | 3300005547 | Ga0070693_100134441 | Ga0070693_1001344412 | 307 |
| 306 | 3300005549 | Ga0070704_100199048 | Ga0070704_1001990481 | 307 |
| 307 | 3300005564 | Ga0070664_100000993 | Ga0070664_10000099310 | 307 |
| 308 | 3300005577 | Ga0068857_100000975 | Ga0068857_10000097522 | 307 |
| 309 | 3300005577 | Ga0068857_100190378 | Ga0068857_1001903782 | 307 |
| 310 | 3300005577 | Ga0068857_100204409 | Ga0068857_1002044092 | 307 |
| 311 | 3300005577 | Ga0068857_100228896 | Ga0068857_1002288962 | 307 |
| 312 | 3300005578 | Ga0068854_100064865 | Ga0068854_1000648652 | 307 |
| 313 | 3300005578 | Ga0068854_100148373 | Ga0068854_1001483732 | 307 |
| 314 | 3300005578 | Ga0068854_100203136 | Ga0068854_1002031361 | 307 |
| 315 | 3300005614 | Ga0068856_100020464 | Ga0068856_1000204641 | 307 |
| 316 | 3300005615 | Ga0070702_100091268 | Ga0070702_1000912682 | 307 |
| 317 | 3300005615 | Ga0070702_100141079 | Ga0070702_1001410792 | 307 |
| 318 | 3300005615 | Ga0070702_100209884 | Ga0070702_1002098842 | 307 |
| 319 | 3300005616 | Ga0068852_100160271 | Ga0068852_1001602712 | 307 |
| 320 | 3300005617 | Ga0068859_100007068 | Ga0068859_1000070687 | 307 |
| 321 | 3300005617 | Ga0068859_100012132 | Ga0068859_1000121324 | 307 |
| 322 | 3300005617 | Ga0068859_100012145 | Ga0068859_10001214512 | 307 |
| 323 | 3300005617 | Ga0068859_100329059 | Ga0068859_1003290592 | 307 |
| 324 | 3300005618 | Ga0068864_100010943 | Ga0068864_1000109432 | 307 |
| 325 | 3300005618 | Ga0068864_100127453 | Ga0068864_1001274532 | 307 |
| 326 | 3300005618 | Ga0068864_100344366 | Ga0068864_1003443661 | 307 |
| 327 | 3300005618 | Ga0068864_100647532 | Ga0068864_1006475321 | 307 |
| 328 | 3300005718 | Ga0068866_10023361 | Ga0068866_100233612 | 307 |
| 329 | 3300005719 | Ga0068861_100045022 | Ga0068861_1000450225 | 307 |
| 330 | 3300005719 | Ga0068861_100123195 | Ga0068861_1001231952 | 307 |
| 331 | 3300005719 | Ga0068861_100146057 | Ga0068861_1001460572 | 307 |
| 332 | 3300005719 | Ga0068861_100155583 | Ga0068861_1001555832 | 307 |
| 333 | 3300005719 | Ga0068861_100224486 | Ga0068861_1002244861 | 307 |
| 334 | 3300005834 | Ga0068851_10001956 | Ga0068851_100019565 | 307 |
| 335 | 3300005834 | Ga0068851_10093969 | Ga0068851_100939692 | 307 |
| 336 | 3300005840 | Ga0068870_10137998 | Ga0068870_101379981 | 307 |
| 337 | 3300005840 | Ga0068870_10226527 | Ga0068870_102265272 | 307 |
| 338 | 3300005841 | Ga0068863_100029077 | Ga0068863_1000290775 | 307 |
| 339 | 3300005841 | Ga0068863_100327197 | Ga0068863_1003271971 | 307 |
| 340 | 3300005841 | Ga0068863_100331448 | Ga0068863_1003314482 | 307 |
| 341 | 3300005842 | Ga0068858_100000005 | Ga0068858_10000000543 | 307 |
| 342 | 3300005842 | Ga0068858_100015618 | Ga0068858_1000156182 | 307 |
| 343 | 3300005842 | Ga0068858_100018142 | Ga0068858_1000181425 | 307 |
| 344 | 3300005842 | Ga0068858_100018604 | Ga0068858_1000186042 | 307 |
| 345 | 3300005842 | Ga0068858_100127881 | Ga0068858_1001278811 | 307 |
| 346 | 3300005842 | Ga0068858_100211798 | Ga0068858_1002117982 | 307 |
| 347 | 3300005843 | Ga0068860_100062022 | Ga0068860_1000620222 | 307 |
| 348 | 3300005843 | Ga0068860_100068444 | Ga0068860_1000684442 | 307 |
| 349 | 3300005843 | Ga0068860_100120344 | Ga0068860_1001203442 | 307 |
| 350 | 3300005843 | Ga0068860_100129295 | Ga0068860_1001292954 | 307 |
| 351 | 3300005844 | Ga0068862_100022410 | Ga0068862_1000224103 | 307 |
| 352 | 3300005844 | Ga0068862_100056733 | Ga0068862_1000567331 | 307 |
| 353 | 3300005844 | Ga0068862_100060739 | Ga0068862_1000607392 | 307 |
| 354 | 3300005844 | Ga0068862_100075997 | Ga0068862_1000759973 | 307 |
| 355 | 3300005844 | Ga0068862_100197680 | Ga0068862_1001976801 | 307 |
| 356 | 3300005937 | Ga0081455_10035005 | Ga0081455_100350051 | 307 |
| 357 | 3300005985 | Ga0081539_10000063 | Ga0081539_10000063151 | 307 |
| 358 | 3300005985 | Ga0081539_10000481 | Ga0081539_1000048169 | 307 |
| 359 | 3300005985 | Ga0081539_10000505 | Ga0081539_100005055 | 307 |
| 360 | 3300005985 | Ga0081539_10001527 | Ga0081539_1000152727 | 307 |
| 361 | 3300006163 | Ga0070715_10000024 | Ga0070715_1000002486 | 307 |
| 362 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001308 | 307 |
| 363 | 3300006173 | Ga0070716_100022229 | Ga0070716_1000222293 | 307 |
| 364 | 3300006173 | Ga0070716_100030114 | Ga0070716_1000301144 | 307 |
| 365 | 3300006173 | Ga0070716_100031763 | Ga0070716_1000317632 | 307 |
| 366 | 3300006237 | Ga0097621_100007343 | Ga0097621_1000073433 | 307 |
| 367 | 3300006237 | Ga0097621_100017050 | Ga0097621_1000170506 | 307 |
| 368 | 3300006358 | Ga0068871_100044081 | Ga0068871_1000440812 | 307 |
| 369 | 3300006358 | Ga0068871_100090330 | Ga0068871_1000903302 | 307 |
| 370 | 3300006358 | Ga0068871_100246900 | Ga0068871_1002469002 | 307 |
| 371 | 3300006358 | Ga0068871_100412566 | Ga0068871_1004125662 | 307 |
| 372 | 3300006844 | Ga0075428_100014706 | Ga0075428_1000147066 | 307 |
| 373 | 3300006846 | Ga0075430_100021301 | Ga0075430_1000213012 | 307 |
| 374 | 3300006847 | Ga0075431_100061591 | Ga0075431_1000615914 | 307 |
| 375 | 3300006847 | Ga0075431_100463409 | Ga0075431_1004634092 | 307 |
| 376 | 3300006852 | Ga0075433_10016589 | Ga0075433_100165893 | 307 |
| 377 | 3300006852 | Ga0075433_10113416 | Ga0075433_101134162 | 307 |
| 378 | 3300006852 | Ga0075433_10126172 | Ga0075433_101261722 | 307 |
| 379 | 3300006852 | Ga0075433_10448625 | Ga0075433_104486251 | 307 |
| 380 | 3300006871 | Ga0075434_100046071 | Ga0075434_1000460712 | 307 |
| 381 | 3300006871 | Ga0075434_100068328 | Ga0075434_1000683284 | 307 |
| 382 | 3300006871 | Ga0075434_100097509 | Ga0075434_1000975093 | 307 |
| 383 | 3300006871 | Ga0075434_100263547 | Ga0075434_1002635472 | 307 |
| 384 | 3300006914 | Ga0075436_100000002 | Ga0075436_10000000220 | 307 |
| 385 | 3300006914 | Ga0075436_100001803 | Ga0075436_10000180315 | 307 |
| 386 | 3300006914 | Ga0075436_100005634 | Ga0075436_1000056348 | 307 |
| 387 | 3300006914 | Ga0075436_100130482 | Ga0075436_1001304822 | 307 |
| 388 | 3300006931 | Ga0097620_100007068 | Ga0097620_1000070687 | 307 |
| 389 | 3300006931 | Ga0097620_100012131 | Ga0097620_1000121314 | 307 |
| 390 | 3300006931 | Ga0097620_100012145 | Ga0097620_10001214512 | 307 |
| 391 | 3300006931 | Ga0097620_100329059 | Ga0097620_1003290592 | 307 |
| 392 | 3300007076 | Ga0075435_100000689 | Ga0075435_1000006897 | 307 |
| 393 | 3300007076 | Ga0075435_100043657 | Ga0075435_1000436575 | 307 |
| 394 | 3300007076 | Ga0075435_100368076 | Ga0075435_1003680762 | 307 |
| 395 | 3300007265 | Ga0099794_10016619 | Ga0099794_100166192 | 307 |
| 396 | 3300009094 | Ga0111539_10002073 | Ga0111539_100020736 | 307 |
| 397 | 3300009094 | Ga0111539_10021012 | Ga0111539_100210125 | 307 |
| 398 | 3300009094 | Ga0111539_10043272 | Ga0111539_100432722 | 307 |
| 399 | 3300009094 | Ga0111539_10468096 | Ga0111539_104680961 | 307 |
| 400 | 3300009101 | Ga0105247_10000002 | Ga0105247_10000002302 | 307 |
| 401 | 3300009101 | Ga0105247_10010710 | Ga0105247_100107104 | 307 |
| 402 | 3300009147 | Ga0114129_10001970 | Ga0114129_1000197022 | 307 |
| 403 | 3300009147 | Ga0114129_10026989 | Ga0114129_100269899 | 307 |
| 404 | 3300009147 | Ga0114129_10029655 | Ga0114129_1002965510 | 307 |
| 405 | 3300009147 | Ga0114129_10037669 | Ga0114129_100376692 | 307 |
| 406 | 3300009147 | Ga0114129_10103290 | Ga0114129_101032903 | 307 |
| 407 | 3300009147 | Ga0114129_10142560 | Ga0114129_101425603 | 307 |
| 408 | 3300009147 | Ga0114129_10236022 | Ga0114129_102360222 | 307 |
| 409 | 3300009147 | Ga0114129_10252410 | Ga0114129_102524102 | 307 |
| 410 | 3300009147 | Ga0114129_10285625 | Ga0114129_102856252 | 307 |
| 411 | 3300009147 | Ga0114129_10341933 | Ga0114129_103419332 | 307 |
| 412 | 3300009147 | Ga0114129_10366736 | Ga0114129_103667362 | 307 |
| 413 | 3300009147 | Ga0114129_10496983 | Ga0114129_104969832 | 307 |
| 414 | 3300009147 | Ga0114129_10823858 | Ga0114129_108238582 | 307 |
| 415 | 3300009148 | Ga0105243_10000037 | Ga0105243_1000003774 | 307 |
| 416 | 3300009148 | Ga0105243_10001856 | Ga0105243_100018563 | 307 |
| 417 | 3300009148 | Ga0105243_10002586 | Ga0105243_100025866 | 307 |
| 418 | 3300009148 | Ga0105243_10178955 | Ga0105243_101789552 | 307 |
| 419 | 3300009174 | Ga0105241_10026459 | Ga0105241_100264595 | 307 |
| 420 | 3300009174 | Ga0105241_10055416 | Ga0105241_100554161 | 307 |
| 421 | 3300009174 | Ga0105241_10070579 | Ga0105241_100705792 | 307 |
| 422 | 3300009174 | Ga0105241_10109508 | Ga0105241_101095081 | 307 |
| 423 | 3300009174 | Ga0105241_10274335 | Ga0105241_102743352 | 307 |
| 424 | 3300009174 | Ga0105241_10299486 | Ga0105241_102994862 | 307 |
| 425 | 3300009174 | Ga0105241_10400550 | Ga0105241_104005501 | 307 |
| 426 | 3300009176 | Ga0105242_10000276 | Ga0105242_1000027630 | 307 |
| 427 | 3300009176 | Ga0105242_10002534 | Ga0105242_100025342 | 307 |
| 428 | 3300009176 | Ga0105242_10042712 | Ga0105242_100427122 | 307 |
| 429 | 3300009176 | Ga0105242_10597151 | Ga0105242_105971511 | 307 |
| 430 | 3300009177 | Ga0105248_10001987 | Ga0105248_100019876 | 307 |
| 431 | 3300009177 | Ga0105248_10114735 | Ga0105248_101147354 | 307 |
| 432 | 3300009177 | Ga0105248_10209409 | Ga0105248_102094092 | 307 |
| 433 | 3300009545 | Ga0105237_10000521 | Ga0105237_1000052128 | 307 |
| 434 | 3300009553 | Ga0105249_10000201 | Ga0105249_1000020146 | 307 |
| 435 | 3300009553 | Ga0105249_10003117 | Ga0105249_100031174 | 307 |
| 436 | 3300009553 | Ga0105249_10033991 | Ga0105249_100339915 | 307 |
| 437 | 3300010375 | Ga0105239_10025216 | Ga0105239_100252162 | 307 |
| 438 | 3300010375 | Ga0105239_10163707 | Ga0105239_101637072 | 307 |
| 439 | 3300010375 | Ga0105239_10169569 | Ga0105239_101695692 | 307 |
| 440 | 3300010375 | Ga0105239_10171201 | Ga0105239_101712012 | 307 |
| 441 | 3300011119 | Ga0105246_10055773 | Ga0105246_100557732 | 307 |
| 442 | 3300013100 | Ga0157373_10027431 | Ga0157373_100274313 | 307 |
| 443 | 3300013296 | Ga0157374_10061420 | Ga0157374_100614205 | 307 |
| 444 | 3300013296 | Ga0157374_10151739 | Ga0157374_101517393 | 307 |
| 445 | 3300013297 | Ga0157378_10000003 | Ga0157378_10000003102 | 307 |
| 446 | 3300013297 | Ga0157378_10003542 | Ga0157378_100035428 | 307 |
| 447 | 3300013297 | Ga0157378_10006907 | Ga0157378_100069078 | 307 |
| 448 | 3300013297 | Ga0157378_10033382 | Ga0157378_100333823 | 307 |
| 449 | 3300013297 | Ga0157378_10079059 | Ga0157378_100790594 | 307 |
| 450 | 3300013297 | Ga0157378_10116680 | Ga0157378_101166802 | 307 |
| 451 | 3300013297 | Ga0157378_10138281 | Ga0157378_101382812 | 307 |
| 452 | 3300013297 | Ga0157378_10208081 | Ga0157378_102080812 | 307 |
| 453 | 3300013306 | Ga0163162_10000128 | Ga0163162_1000012846 | 307 |
| 454 | 3300013306 | Ga0163162_10003297 | Ga0163162_100032975 | 307 |
| 455 | 3300013306 | Ga0163162_10008501 | Ga0163162_100085017 | 307 |
| 456 | 3300013306 | Ga0163162_10034610 | Ga0163162_100346106 | 307 |
| 457 | 3300013306 | Ga0163162_10051702 | Ga0163162_100517022 | 307 |
| 458 | 3300013306 | Ga0163162_10183957 | Ga0163162_101839571 | 307 |
| 459 | 3300013306 | Ga0163162_10759394 | Ga0163162_107593941 | 307 |
| 460 | 3300013307 | Ga0157372_10034510 | Ga0157372_100345103 | 307 |
| 461 | 3300013307 | Ga0157372_10406380 | Ga0157372_104063802 | 307 |
| 462 | 3300013307 | Ga0157372_10454346 | Ga0157372_104543461 | 307 |
| 463 | 3300013308 | Ga0157375_10004533 | Ga0157375_100045339 | 307 |
| 464 | 3300013308 | Ga0157375_10526137 | Ga0157375_105261371 | 307 |
| 465 | 3300013308 | Ga0157375_10567054 | Ga0157375_105670541 | 307 |
| 466 | 3300014325 | Ga0163163_10002306 | Ga0163163_100023068 | 307 |
| 467 | 3300014325 | Ga0163163_10023389 | Ga0163163_100233896 | 307 |
| 468 | 3300014325 | Ga0163163_10026850 | Ga0163163_100268508 | 307 |
| 469 | 3300014325 | Ga0163163_10046151 | Ga0163163_100461515 | 307 |
| 470 | 3300014325 | Ga0163163_10056787 | Ga0163163_100567872 | 307 |
| 471 | 3300014325 | Ga0163163_10066321 | Ga0163163_100663213 | 307 |
| 472 | 3300014326 | Ga0157380_10046187 | Ga0157380_100461872 | 307 |
| 473 | 3300014326 | Ga0157380_10086540 | Ga0157380_100865402 | 307 |
| 474 | 3300014745 | Ga0157377_10013264 | Ga0157377_100132641 | 307 |
| 475 | 3300014745 | Ga0157377_10051554 | Ga0157377_100515542 | 307 |
| 476 | 3300014968 | Ga0157379_10167026 | Ga0157379_101670262 | 307 |
| 477 | 3300014968 | Ga0157379_10175535 | Ga0157379_101755352 | 307 |
| 478 | 3300014968 | Ga0157379_10579716 | Ga0157379_105797161 | 307 |
| 479 | 3300017792 | Ga0163161_10014806 | Ga0163161_100148063 | 307 |
| 480 | 3300017792 | Ga0163161_10031371 | Ga0163161_100313712 | 307 |
| 481 | 3300021384 | Ga0213876_10000068 | Ga0213876_1000006855 | 307 |
| 482 | 3300021384 | Ga0213876_10000094 | Ga0213876_1000009423 | 307 |
| 483 | 3300025223 | Ga0207672_1000084 | Ga0207672_100008411 | 307 |
| 484 | 3300025321 | Ga0207656_10003148 | Ga0207656_100031483 | 307 |
| 485 | 3300025885 | Ga0207653_10000133 | Ga0207653_1000013352 | 307 |
| 486 | 3300025885 | Ga0207653_10001368 | Ga0207653_100013685 | 307 |
| 487 | 3300025899 | Ga0207642_10039445 | Ga0207642_100394451 | 307 |
| 488 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002301 | 307 |
| 489 | 3300025901 | Ga0207688_10069484 | Ga0207688_100694842 | 307 |
| 490 | 3300025901 | Ga0207688_10098098 | Ga0207688_100980982 | 307 |
| 491 | 3300025904 | Ga0207647_10008624 | Ga0207647_100086246 | 307 |
| 492 | 3300025905 | Ga0207685_10000018 | Ga0207685_1000001882 | 307 |
| 493 | 3300025906 | Ga0207699_10000135 | Ga0207699_1000013525 | 307 |
| 494 | 3300025907 | Ga0207645_10020581 | Ga0207645_100205813 | 307 |
| 495 | 3300025907 | Ga0207645_10105724 | Ga0207645_101057242 | 307 |
| 496 | 3300025908 | Ga0207643_10005878 | Ga0207643_100058789 | 307 |
| 497 | 3300025910 | Ga0207684_10000053 | Ga0207684_1000005383 | 307 |
| 498 | 3300025910 | Ga0207684_10000075 | Ga0207684_1000007579 | 307 |
| 499 | 3300025910 | Ga0207684_10000175 | Ga0207684_1000017581 | 307 |
| 500 | 3300025910 | Ga0207684_10044488 | Ga0207684_100444882 | 307 |
| 501 | 3300025910 | Ga0207684_10276287 | Ga0207684_102762871 | 307 |
| 502 | 3300025910 | Ga0207684_10287968 | Ga0207684_102879681 | 307 |
| 503 | 3300025910 | Ga0207684_10460033 | Ga0207684_104600331 | 307 |
| 504 | 3300025911 | Ga0207654_10053857 | Ga0207654_100538572 | 307 |
| 505 | 3300025911 | Ga0207654_10300874 | Ga0207654_103008741 | 307 |
| 506 | 3300025912 | Ga0207707_10000063 | Ga0207707_1000006374 | 307 |
| 507 | 3300025912 | Ga0207707_10143343 | Ga0207707_101433432 | 307 |
| 508 | 3300025912 | Ga0207707_10358457 | Ga0207707_103584571 | 307 |
| 509 | 3300025913 | Ga0207695_10063425 | Ga0207695_100634251 | 307 |
| 510 | 3300025914 | Ga0207671_10002243 | Ga0207671_1000224316 | 307 |
| 511 | 3300025916 | Ga0207663_10000001 | Ga0207663_1000000141 | 307 |
| 512 | 3300025917 | Ga0207660_10004704 | Ga0207660_100047046 | 307 |
| 513 | 3300025917 | Ga0207660_10021218 | Ga0207660_100212185 | 307 |
| 514 | 3300025917 | Ga0207660_10060362 | Ga0207660_100603622 | 307 |
| 515 | 3300025917 | Ga0207660_10257537 | Ga0207660_102575372 | 307 |
| 516 | 3300025918 | Ga0207662_10007338 | Ga0207662_100073383 | 307 |
| 517 | 3300025919 | Ga0207657_10074317 | Ga0207657_100743173 | 307 |
| 518 | 3300025921 | Ga0207652_10000091 | Ga0207652_1000009128 | 307 |
| 519 | 3300025922 | Ga0207646_10000076 | Ga0207646_1000007691 | 307 |
| 520 | 3300025922 | Ga0207646_10000900 | Ga0207646_1000090016 | 307 |
| 521 | 3300025922 | Ga0207646_10010198 | Ga0207646_100101983 | 307 |
| 522 | 3300025922 | Ga0207646_10025394 | Ga0207646_100253946 | 307 |
| 523 | 3300025922 | Ga0207646_10159084 | Ga0207646_101590842 | 307 |
| 524 | 3300025922 | Ga0207646_10163184 | Ga0207646_101631841 | 307 |
| 525 | 3300025923 | Ga0207681_10000966 | Ga0207681_1000096615 | 307 |
| 526 | 3300025923 | Ga0207681_10010828 | Ga0207681_100108284 | 307 |
| 527 | 3300025925 | Ga0207650_10000007 | Ga0207650_10000007288 | 307 |
| 528 | 3300025925 | Ga0207650_10005207 | Ga0207650_100052073 | 307 |
| 529 | 3300025925 | Ga0207650_10105768 | Ga0207650_101057682 | 307 |
| 530 | 3300025925 | Ga0207650_10107413 | Ga0207650_101074132 | 307 |
| 531 | 3300025928 | Ga0207700_10138581 | Ga0207700_101385812 | 307 |
| 532 | 3300025931 | Ga0207644_10000636 | Ga0207644_1000063621 | 307 |
| 533 | 3300025933 | Ga0207706_10133299 | Ga0207706_101332991 | 307 |
| 534 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003262 | 307 |
| 535 | 3300025934 | Ga0207686_10000127 | Ga0207686_1000012748 | 307 |
| 536 | 3300025934 | Ga0207686_10001296 | Ga0207686_1000129614 | 307 |
| 537 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017321 | 307 |
| 538 | 3300025935 | Ga0207709_10001732 | Ga0207709_100017326 | 307 |
| 539 | 3300025935 | Ga0207709_10012319 | Ga0207709_100123193 | 307 |
| 540 | 3300025935 | Ga0207709_10211324 | Ga0207709_102113241 | 307 |
| 541 | 3300025935 | Ga0207709_10325175 | Ga0207709_103251751 | 307 |
| 542 | 3300025936 | Ga0207670_10065483 | Ga0207670_100654832 | 307 |
| 543 | 3300025937 | Ga0207669_10181883 | Ga0207669_101818831 | 307 |
| 544 | 3300025938 | Ga0207704_10064467 | Ga0207704_100644671 | 307 |
| 545 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002180 | 307 |
| 546 | 3300025939 | Ga0207665_10023684 | Ga0207665_100236843 | 307 |
| 547 | 3300025939 | Ga0207665_10040686 | Ga0207665_100406864 | 307 |
| 548 | 3300025939 | Ga0207665_10043262 | Ga0207665_100432622 | 307 |
| 549 | 3300025939 | Ga0207665_10125245 | Ga0207665_101252452 | 307 |
| 550 | 3300025940 | Ga0207691_10008051 | Ga0207691_100080512 | 307 |
| 551 | 3300025940 | Ga0207691_10072423 | Ga0207691_100724231 | 307 |
| 552 | 3300025941 | Ga0207711_10051152 | Ga0207711_100511522 | 307 |
| 553 | 3300025941 | Ga0207711_10139558 | Ga0207711_101395583 | 307 |
| 554 | 3300025942 | Ga0207689_10004147 | Ga0207689_1000414711 | 307 |
| 555 | 3300025942 | Ga0207689_10015886 | Ga0207689_100158862 | 307 |
| 556 | 3300025942 | Ga0207689_10197730 | Ga0207689_101977301 | 307 |
| 557 | 3300025942 | Ga0207689_10248533 | Ga0207689_102485332 | 307 |
| 558 | 3300025942 | Ga0207689_10258583 | Ga0207689_102585831 | 307 |
| 559 | 3300025945 | Ga0207679_10070831 | Ga0207679_100708312 | 307 |
| 560 | 3300025945 | Ga0207679_10199279 | Ga0207679_101992792 | 307 |
| 561 | 3300025960 | Ga0207651_10056474 | Ga0207651_100564742 | 307 |
| 562 | 3300025961 | Ga0207712_10000259 | Ga0207712_1000025915 | 307 |
| 563 | 3300025961 | Ga0207712_10014084 | Ga0207712_100140846 | 307 |
| 564 | 3300025961 | Ga0207712_10050006 | Ga0207712_100500062 | 307 |
| 565 | 3300025972 | Ga0207668_10002115 | Ga0207668_1000211512 | 307 |
| 566 | 3300026023 | Ga0207677_10070868 | Ga0207677_100708682 | 307 |
| 567 | 3300026023 | Ga0207677_10142628 | Ga0207677_101426282 | 307 |
| 568 | 3300026035 | Ga0207703_10000158 | Ga0207703_1000015840 | 307 |
| 569 | 3300026035 | Ga0207703_10033181 | Ga0207703_100331813 | 307 |
| 570 | 3300026035 | Ga0207703_10115494 | Ga0207703_101154942 | 307 |
| 571 | 3300026035 | Ga0207703_10139092 | Ga0207703_101390921 | 307 |
| 572 | 3300026035 | Ga0207703_10140058 | Ga0207703_101400582 | 307 |
| 573 | 3300026035 | Ga0207703_10195785 | Ga0207703_101957852 | 307 |
| 574 | 3300026035 | Ga0207703_10269747 | Ga0207703_102697471 | 307 |
| 575 | 3300026035 | Ga0207703_10294039 | Ga0207703_102940392 | 307 |
| 576 | 3300026075 | Ga0207708_10001411 | Ga0207708_100014117 | 307 |
| 577 | 3300026075 | Ga0207708_10024047 | Ga0207708_100240477 | 307 |
| 578 | 3300026075 | Ga0207708_10069370 | Ga0207708_100693702 | 307 |
| 579 | 3300026075 | Ga0207708_10110412 | Ga0207708_101104122 | 307 |
| 580 | 3300026078 | Ga0207702_10041969 | Ga0207702_100419691 | 307 |
| 581 | 3300026088 | Ga0207641_10509349 | Ga0207641_105093492 | 307 |
| 582 | 3300026089 | Ga0207648_10440568 | Ga0207648_104405681 | 307 |
| 583 | 3300026089 | Ga0207648_10534254 | Ga0207648_105342541 | 307 |
| 584 | 3300026095 | Ga0207676_10060804 | Ga0207676_100608043 | 307 |
| 585 | 3300026095 | Ga0207676_10164944 | Ga0207676_101649442 | 307 |
| 586 | 3300026095 | Ga0207676_10271609 | Ga0207676_102716091 | 307 |
| 587 | 3300026116 | Ga0207674_10000058 | Ga0207674_10000058100 | 307 |
| 588 | 3300026116 | Ga0207674_10041265 | Ga0207674_100412651 | 307 |
| 589 | 3300026116 | Ga0207674_10216492 | Ga0207674_102164921 | 307 |
| 590 | 3300026116 | Ga0207674_10247125 | Ga0207674_102471252 | 307 |
| 591 | 3300026118 | Ga0207675_100018476 | Ga0207675_1000184765 | 307 |
| 592 | 3300026118 | Ga0207675_100019567 | Ga0207675_1000195676 | 307 |
| 593 | 3300026118 | Ga0207675_100026731 | Ga0207675_1000267311 | 307 |
| 594 | 3300026118 | Ga0207675_100063633 | Ga0207675_1000636332 | 307 |
| 595 | 3300026118 | Ga0207675_100101016 | Ga0207675_1001010163 | 307 |
| 596 | 3300026118 | Ga0207675_100156763 | Ga0207675_1001567632 | 307 |
| 597 | 3300026121 | Ga0207683_10056980 | Ga0207683_100569802 | 307 |
| 598 | 3300026121 | Ga0207683_10149236 | Ga0207683_101492362 | 307 |
| 599 | 3300026142 | Ga0207698_10090003 | Ga0207698_100900034 | 307 |
| 600 | 3300026142 | Ga0207698_10136274 | Ga0207698_101362741 | 307 |
| 601 | 3300027907 | Ga0207428_10007052 | Ga0207428_100070523 | 307 |
| 602 | 3300027907 | Ga0207428_10030203 | Ga0207428_100302032 | 307 |
| 603 | 3300027907 | Ga0207428_10068043 | Ga0207428_100680432 | 307 |
| 604 | 3300028380 | Ga0268265_10043384 | Ga0268265_100433843 | 307 |
| 605 | 3300028381 | Ga0268264_10009644 | Ga0268264_100096449 | 307 |
| 606 | 3300028381 | Ga0268264_10054523 | Ga0268264_100545231 | 307 |
| 607 | 3300028381 | Ga0268264_10382992 | Ga0268264_103829921 | 307 |
| 608 | 3300031548 | Ga0307408_100087903 | Ga0307408_1000879031 | 307 |
| 609 | 3300031548 | Ga0307408_100268235 | Ga0307408_1002682351 | 307 |
| 610 | 3300031731 | Ga0307405_10009530 | Ga0307405_100095307 | 307 |
| 611 | 3300031731 | Ga0307405_10051723 | Ga0307405_100517232 | 307 |
| 612 | 3300031733 | Ga0316577_10014294 | Ga0316577_100142943 | 307 |
| 613 | 3300031733 | Ga0316577_10070805 | Ga0316577_100708053 | 307 |
| 614 | 3300031852 | Ga0307410_10006757 | Ga0307410_100067571 | 307 |
| 615 | 3300031852 | Ga0307410_10079440 | Ga0307410_100794402 | 307 |
| 616 | 3300031901 | Ga0307406_10001697 | Ga0307406_100016974 | 307 |
| 617 | 3300031903 | Ga0307407_10018518 | Ga0307407_100185183 | 307 |
| 618 | 3300031911 | Ga0307412_10008182 | Ga0307412_100081822 | 307 |
| 619 | 3300031911 | Ga0307412_10010460 | Ga0307412_100104602 | 307 |
| 620 | 3300031995 | Ga0307409_100038578 | Ga0307409_1000385782 | 307 |
| 621 | 3300032002 | Ga0307416_100012028 | Ga0307416_1000120284 | 307 |
| 622 | 3300032002 | Ga0307416_100244694 | Ga0307416_1002446941 | 307 |
| 623 | 3300032002 | Ga0307416_100456675 | Ga0307416_1004566751 | 307 |
| 624 | 3300032004 | Ga0307414_10003043 | Ga0307414_100030432 | 307 |
| 625 | 3300032126 | Ga0307415_100044997 | Ga0307415_1000449972 | 307 |
| 626 | 3300036712 | Ga0316584_0222976 | Ga0316584_0222976_153_1118 | 307 |
| 627 | 3300037418 | Ga0395900_0072279 | Ga0395900_0072279_1182_2144 | 307 |
| 628 | 3300037471 | Ga0395905_0003272 | Ga0395905_0003272_3757_4713 | 307 |
| 629 | 3300037471 | Ga0395905_0118981 | Ga0395905_0118981_1331_2290 | 307 |
| 630 | 3300037588 | Ga0316581_0040790 | Ga0316581_0040790_105_1082 | 307 |
| 631 | 3300038443 | Ga0395901_0223438 | Ga0395901_0223438_887_1846 | 307 |
| 632 | 3300038443 | Ga0395901_0492305 | Ga0395901_0492305_235_1203 | 307 |
| 633 | 3300039437 | Ga0436365_0289912 | Ga0436365_0289912_277922_278878 | 307 |
| 634 | 3300039437 | Ga0436365_0762848 | Ga0436365_0762848_492_1448 | 307 |
| 635 | 3300039437 | Ga0436365_1855834 | Ga0436365_1855834_66815_67771 | 307 |
| 636 | 3300042876 | Ga0451577_0244069 | Ga0451577_0244069_272_1234 | 307 |
| 637 | 3300044673 | Ga0453683_0035457 | Ga0453683_0035457_128_1090 | 307 |
| 638 | 3300044712 | Ga0453684_0106606 | Ga0453684_0106606_1835_2797 | 307 |
| 639 | 3300044712 | Ga0453684_0514922 | Ga0453684_0514922_170_1123 | 307 |
| 640 | 3300045051 | Ga0451576_0009797 | Ga0451576_0009797_7919_8881 | 307 |
| 641 | 3300045051 | Ga0451576_0317466 | Ga0451576_0317466_55_1023 | 307 |
| 642 | 3300046525 | Ga0495663_0000141 | Ga0495663_0000141_24046_25008 | 307 |
| 643 | 3300046539 | Ga0495621_0000577 | Ga0495621_0000577_7665_8627 | 307 |
| 644 | 3300046539 | Ga0495621_0024228 | Ga0495621_0024228_12_989 | 307 |
| 645 | 3300046539 | Ga0495621_0071521 | Ga0495621_0071521_101_1063 | 307 |
| 646 | 3300046691 | Ga0495670_0083029 | Ga0495670_0083029_355_1317 | 307 |
| 647 | 3300047322 | Ga0495680_0265660 | Ga0495680_0265660_44_1006 | 307 |
| 648 | 3300048907 | Ga0496104_0088689 | Ga0496104_0088689_80_1042 | 307 |
| 649 | 3300048907 | Ga0496104_0217274 | Ga0496104_0217274_626_1585 | 307 |
| 650 | 3300048909 | Ga0496106_0000699 | Ga0496106_0000699_2996_3958 | 307 |
| 651 | 3300048909 | Ga0496106_0351967 | Ga0496106_0351967_100_1062 | 307 |
| 652 | 3300048912 | Ga0496109_0000068 | Ga0496109_0000068_40043_40966 | 307 |
| 653 | 3300048916 | Ga0496113_0310197 | Ga0496113_0310197_133_1095 | 307 |
| 654 | 3300049514 | Ga0501291_007196 | Ga0501291_007196_432_1391 | 307 |
| 655 | 3300049574 | Ga0501038_0007479 | Ga0501038_0007479_3086_4045 | 307 |
| 656 | 3300049577 | Ga0501041_0276930 | Ga0501041_0276930_50_979 | 307 |
| 657 | 3300049580 | Ga0501046_0270341 | Ga0501046_0270341_167_1090 | 307 |
| 658 | 3300049591 | Ga0501075_0246789 | Ga0501075_0246789_152_1081 | 307 |
| 659 | 3300049652 | Ga0501202_000926 | Ga0501202_000926_551_1483 | 307 |
| 660 | 3300049660 | Ga0501216_002105 | Ga0501216_002105_150_1109 | 307 |
| 661 | 3300049661 | Ga0501217_007572 | Ga0501217_007572_115_1074 | 307 |
| 662 | 3300049663 | Ga0501223_019820 | Ga0501223_019820_298_1260 | 307 |
| 663 | 3300049663 | Ga0501223_020264 | Ga0501223_020264_241_1200 | 307 |
| 664 | 3300049664 | Ga0501224_001637 | Ga0501224_001637_911_1843 | 307 |
| 665 | 3300049679 | Ga0501249_023683 | Ga0501249_023683_166_1125 | 307 |
| 666 | 3300049705 | Ga0501225_0003414 | Ga0501225_0003414_730_1689 | 307 |
| 667 | 3300049705 | Ga0501225_0005625 | Ga0501225_0005625_979_1911 | 307 |
| 668 | 3300049743 | Ga0501081_0313987 | Ga0501081_0313987_140_1069 | 307 |
| 669 | 3300049851 | Ga0501212_003908 | Ga0501212_003908_815_1801 | 307 |
| 670 | 3300050507 | nmdc:mga05p37_100796_c1 | nmdc:mga05p37_100796_c1_1810_2769 | 307 |
| 671 | 3300050507 | nmdc:mga05p37_13047_c1 | nmdc:mga05p37_13047_c1_7207_8166 | 307 |
| 672 | 3300050507 | nmdc:mga05p37_1311_c1 | nmdc:mga05p37_1311_c1_17885_18847 | 307 |
| 673 | 3300050507 | nmdc:mga05p37_143270_c1 | nmdc:mga05p37_143270_c1_808_1767 | 307 |
| 674 | 3300050507 | nmdc:mga05p37_149278_c1 | nmdc:mga05p37_149278_c1_974_1933 | 307 |
| 675 | 3300050507 | nmdc:mga05p37_65024_c1 | nmdc:mga05p37_65024_c1_654_1649 | 307 |
| 676 | 3300050508 | nmdc:mga09592_118109_c1 | nmdc:mga09592_118109_c1_328_1308 | 307 |
| 677 | 3300050509 | nmdc:mga0qj67_330481_c1 | nmdc:mga0qj67_330481_c1_43_1023 | 307 |
| 678 | 3300050511 | nmdc:mga08y16_172186_c1 | nmdc:mga08y16_172186_c1_381_1310 | 307 |
| 679 | 3300050511 | nmdc:mga08y16_274777_c1 | nmdc:mga08y16_274777_c1_755_1678 | 307 |
| 680 | 3300050511 | nmdc:mga08y16_304335_c1 | nmdc:mga08y16_304335_c1_252_1175 | 307 |
| 681 | 3300050511 | nmdc:mga08y16_8851_c1 | nmdc:mga08y16_8851_c1_7013_7981 | 307 |
| 682 | 3300050512 | nmdc:mga0n895_105790_c1 | nmdc:mga0n895_105790_c1_10_933 | 307 |
| 683 | 3300050512 | nmdc:mga0n895_145682_c1 | nmdc:mga0n895_145682_c1_547_1509 | 307 |
| 684 | 3300050513 | nmdc:mga0rr50_3567_c1 | nmdc:mga0rr50_3567_c1_4242_5204 | 307 |
| 685 | 3300050513 | nmdc:mga0rr50_61526_c1 | nmdc:mga0rr50_61526_c1_1747_2709 | 307 |
| 686 | 3300050514 | nmdc:mga08x19_165449_c1 | nmdc:mga08x19_165449_c1_255_1193 | 307 |
| 687 | 3300050514 | nmdc:mga08x19_3501_c1 | nmdc:mga08x19_3501_c1_5176_6171 | 307 |
| 688 | 3300050514 | nmdc:mga08x19_63905_c1 | nmdc:mga08x19_63905_c1_1111_2073 | 307 |
| 689 | 3300050514 | nmdc:mga08x19_78771_c1 | nmdc:mga08x19_78771_c1_20_982 | 307 |
| 690 | 3300050514 | nmdc:mga08x19_7_c1 | nmdc:mga08x19_7_c1_317272_318234 | 307 |
| 691 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_390264_391226 | 307 |
| 692 | 3300050515 | nmdc:mga0a205_17483_c2 | nmdc:mga0a205_17483_c2_1237_2199 | 307 |
| 693 | 3300050515 | nmdc:mga0a205_183634_c1 | nmdc:mga0a205_183634_c1_743_1705 | 307 |
| 694 | 3300050515 | nmdc:mga0a205_296833_c1 | nmdc:mga0a205_296833_c1_21_989 | 307 |
| 695 | 3300050515 | nmdc:mga0a205_383514_c1 | nmdc:mga0a205_383514_c1_155_1117 | 307 |
| 696 | 3300050515 | nmdc:mga0a205_39448_c1 | nmdc:mga0a205_39448_c1_382_1344 | 307 |
| 697 | 3300053083 | Ga0495655_0001853 | Ga0495655_0001853_231_1193 | 307 |
| 698 | 3300053096 | Ga0500641_0150771 | Ga0500641_0150771_41_964 | 307 |
| 699 | 3300054114 | Ga0501084_0319581 | Ga0501084_0319581_125_1054 | 307 |
| 700 | iso_pu_bacteria | 2523533628 | 2524003480 | 307 |
| 701 | iso_pu_bacteria | 2857460504 | 2857460840 | 307 |
| 702 | iso_pu_bacteria | 2857465823 | 2857471170 | 307 |
| 703 | iso_pu_bacteria | 2857591370 | 2857595505 | 307 |
| 704 | iso_pu_bacteria | 2898907183 | 2898907868 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yye-assembly1.cif.gz_A | crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp | 0.947 | 9 | 307 |
| 2zau-assembly1.cif.gz_B-2 | crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus | 0.9464 | 10 | 307 |
| 2yye-assembly1.cif.gz_B | crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp | 0.9459 | 9 | 307 |
| 2zau-assembly1.cif.gz_C-2 | crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus | 0.9455 | 11 | 307 |
| 2zod-assembly1.cif.gz_B | crystal structure of selenophosphate synthetase from aquifex aeolicus | 0.9444 | 12 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yyeA01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9556 | 9 | 115 | 3.30.1330.10 |
| 3u0oA01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9514 | 3 | 121 | 3.30.1330.10 |
| 3u0oB01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9492 | 3 | 117 | 3.30.1330.10 |
| 2zauB01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain | 0.9285 | 10 | 115 | 3.30.1330.10 |
| 2yydA02 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.9248 | 124 | 307 | 3.90.650.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1BZZ3-F1-model_v4 | Selenide, water dikinase SelD (EC 2.7.9.3) | 0.9886 | 1 | 219 |
GO:0004756
GO:0005524 GO:0005737 GO:0016260 |
| AF-A0A7C3HQ18-F1-model_v4 | cysteine desulfurase (EC 2.8.1.7) | 0.9829 | 3 | 226 |
GO:0005524
GO:0016226 GO:0016301 GO:0031071 GO:0046872 GO:0051536 |
| AF-A0A7C3F926-F1-model_v4 | Selenide, water dikinase SelD (EC 2.7.9.3) | 0.9806 | 33 | 307 |
GO:0004756
GO:0005524 GO:0005737 GO:0016260 |
| AF-A0A660VM40-F1-model_v4 | Selenide, water dikinase SelD (EC 2.7.9.3) | 0.9799 | 1 | 307 |
GO:0004756
GO:0005524 GO:0005737 GO:0016260 |
| AF-A0A7V6JV69-F1-model_v4 | Selenide, water dikinase (EC 2.7.9.3) (Selenium donor protein) (Selenophosphate synthase) | 0.9793 | 3 | 307 |
GO:0000287
GO:0004756 GO:0005524 GO:0005737 GO:0016260 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar