F476341

General Info

Members Datasets Scaffolds Average Seq Length
704 258 699 315

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100199048|Ga0070704_1001990481
Length 356
Sequence MSQPDQSPRDQRSRIRLTEKVKAAGAGKLGPADLAVILGTLPRSRHPDLLVGVETSDDAGIFRLRDDLAIVNTVDFFTPVVDDPYTYGLISATNSLSDVYAMGGEPKTAMNIVCFPQSGLEKEILVEILRGGGDKATEAGVAVVGGHSVADDEIKYGMAVTGVIDPRKIIRNVGVQKGDVVVLTKPLGTGILTTALKRGHLSEEEYGAAVMSMSTLNAKAAQVMSRYSVHACTDVTGFSLMGHGCEMAMGSKLTLRLRSSLLPVLPGALRLSLEGYVTGGCQRNRNYLADKVQVADSVSRDLNEVAFDPQTSGGLLIVIPASEAPALTRELLGEGVLAAAVIGEVVAPTGVWVELV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
3 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
4 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
5 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
6 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
234 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
235 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
245 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.14
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.99
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1337615 2162886007 Bacteria 1626
2 JGI24748J21848_1000004 3300002074 Bacteria 262344
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI24751J29686_10000003 3300002459 Bacteria 157815
5 JGI25406J46586_10003375 3300003203 Bacteria 7520
6 JGI25406J46586_10029515 3300003203 Bacteria 2074
7 Ga0058860_12137405 3300004801 Bacteria 3552
8 Ga0065714_10064425 3300005288 Bacteria 189652
9 Ga0065704_10014094 3300005289 Unclassified 1822
10 Ga0065704_10100121 3300005289 Bacteria 2286
11 Ga0065712_10006311 3300005290 Bacteria 3233
12 Ga0065712_10067727 3300005290 Bacteria 189643
13 Ga0065715_10003739 3300005293 Unclassified 4745
14 Ga0065715_10090321 3300005293 Bacteria 7209
15 Ga0065715_10091106 3300005293 Bacteria 6106
16 Ga0065715_10250985 3300005293 Bacteria 1167
17 Ga0065707_10088064 3300005295 Bacteria 4793
18 Ga0065707_10094598 3300005295 Bacteria 3476
19 Ga0070658_10242258 3300005327 Bacteria 1528
20 Ga0070676_10090647 3300005328 Unclassified 1872
21 Ga0070676_10127539 3300005328 Bacteria 1605
22 Ga0070690_100004956 3300005330 Bacteria 7447
23 Ga0070690_100063346 3300005330 Bacteria 2386
24 Ga0070690_100361939 3300005330 Bacteria 1056
25 Ga0070670_100000223 3300005331 Bacteria 52272
26 Ga0070670_100000832 3300005331 Bacteria 24107
27 Ga0070670_100222499 3300005331 Bacteria 1642
28 Ga0070670_100349392 3300005331 Viruses 1299
29 Ga0070670_100354032 3300005331 Bacteria 1290
30 Ga0070677_10054187 3300005333 Unclassified 1633
31 Ga0068869_100015163 3300005334 Bacteria 5162
32 Ga0068869_100079568 3300005334 Unclassified 2443
33 Ga0068869_100083377 3300005334 Bacteria 2391
34 Ga0068869_100131371 3300005334 Bacteria 1925
35 Ga0068869_100167619 3300005334 Unclassified 1714
36 Ga0068869_100246292 3300005334 Bacteria 1426
37 Ga0070680_100002231 3300005336 Bacteria 14296
38 Ga0070680_100028397 3300005336 Bacteria 4487
39 Ga0070680_100034926 3300005336 Bacteria 4056
40 Ga0070680_100103572 3300005336 Bacteria 2364
41 Ga0070682_100000210 3300005337 Bacteria 42814
42 Ga0070682_100001346 3300005337 Bacteria 13865
43 Ga0070682_100028470 3300005337 Unclassified 3360
44 Ga0068868_100010333 3300005338 Bacteria 6750
45 Ga0068868_100046778 3300005338 Bacteria 3387
46 Ga0068868_100078827 3300005338 Bacteria 2637
47 Ga0068868_100147137 3300005338 Bacteria 1938
48 Ga0070660_100066988 3300005339 Bacteria 2797
49 Ga0070689_100002015 3300005340 Bacteria 13172
50 Ga0070689_100069366 3300005340 Bacteria 2750
51 Ga0070689_100083569 3300005340 Bacteria 2509
52 Ga0070689_100286632 3300005340 Bacteria 1367
53 Ga0070691_10105214 3300005341 Bacteria 1406
54 Ga0070687_100003618 3300005343 Bacteria 6033
55 Ga0070687_100034513 3300005343 Bacteria 2505
56 Ga0070687_100087191 3300005343 Bacteria 1717
57 Ga0070687_100098454 3300005343 Bacteria 1633
58 Ga0070692_10064465 3300005345 Unclassified 1938
59 Ga0070692_10075891 3300005345 Bacteria 1801
60 Ga0070668_100008204 3300005347 Bacteria 7755
61 Ga0070669_100002272 3300005353 Bacteria 13944
62 Ga0070669_100027227 3300005353 Bacteria 4114
63 Ga0070675_100088570 3300005354 Bacteria 2590
64 Ga0070671_100002475 3300005355 Bacteria 14278
65 Ga0070671_100131427 3300005355 Bacteria 2108
66 Ga0070674_100054321 3300005356 Bacteria 2770
67 Ga0070674_100058068 3300005356 Bacteria 2688
68 Ga0070674_100140853 3300005356 Bacteria 1810
69 Ga0070673_100078240 3300005364 Bacteria 2675
70 Ga0070673_100143015 3300005364 Unclassified 2020
71 Ga0070659_100002515 3300005366 Bacteria 13013
72 Ga0070703_10002983 3300005406 Unclassified 4837
73 Ga0070703_10038684 3300005406 Bacteria 1476
74 Ga0070709_10000172 3300005434 Bacteria 40757
75 Ga0070713_100139028 3300005436 Bacteria 2149
76 Ga0070710_10088387 3300005437 Unclassified 1823
77 Ga0070701_10127615 3300005438 Bacteria 1441
78 Ga0070701_10170328 3300005438 Bacteria 1268
79 Ga0070701_10180342 3300005438 Unclassified 1236
80 Ga0070711_100000001 3300005439 Bacteria 370591
81 Ga0070705_100000011 3300005440 Bacteria 101991
82 Ga0070705_100003338 3300005440 Bacteria 7878
83 Ga0070705_100022640 3300005440 Bacteria 3361
84 Ga0070700_100011138 3300005441 Bacteria 4977
85 Ga0070700_100148489 3300005441 Unclassified 1601
86 Ga0070700_100230644 3300005441 Bacteria 1317
87 Ga0070700_100266430 3300005441 Bacteria 1236
88 Ga0070700_100307860 3300005441 Unclassified 1159
89 Ga0070694_100007445 3300005444 Bacteria 6675
90 Ga0070694_100088175 3300005444 Bacteria 2172
91 Ga0070694_100133875 3300005444 Bacteria 1794
92 Ga0070708_100000042 3300005445 Bacteria 83511
93 Ga0070708_100050004 3300005445 Bacteria 3700
94 Ga0070708_100177779 3300005445 Unclassified 1989
95 Ga0070708_100203521 3300005445 Bacteria 1854
96 Ga0070708_100378567 3300005445 Unclassified 1335
97 Ga0070708_100396565 3300005445 Bacteria 1301
98 Ga0070678_100106033 3300005456 Bacteria 2189
99 Ga0070678_100307244 3300005456 Unclassified 1350
100 Ga0070662_100212879 3300005457 Bacteria 1539
101 Ga0070662_100276793 3300005457 Bacteria 1357
102 Ga0070681_10000053 3300005458 Bacteria 81387
103 Ga0070681_10135803 3300005458 Bacteria 2390
104 Ga0068867_100099941 3300005459 Bacteria 2214
105 Ga0070685_10042711 3300005466 Bacteria 2588
106 Ga0070706_100000053 3300005467 Bacteria 139565
107 Ga0070706_100003837 3300005467 Bacteria 14689
108 Ga0070706_100006976 3300005467 Bacteria 10655
109 Ga0070706_100007447 3300005467 Bacteria 10263
110 Ga0070706_100036769 3300005467 Bacteria 4523
111 Ga0070706_100047089 3300005467 Bacteria 3979
112 Ga0070706_100159707 3300005467 Archaea 2104
113 Ga0070707_100000054 3300005468 Bacteria 100665
114 Ga0070707_100000077 3300005468 Bacteria 86719
115 Ga0070707_100108527 3300005468 Bacteria 2692
116 Ga0070707_100191962 3300005468 Bacteria 1992
117 Ga0070707_100192345 3300005468 Unclassified 1989
118 Ga0070707_100197538 3300005468 Bacteria 1961
119 Ga0070698_100000593 3300005471 Bacteria 38912
120 Ga0070698_100015537 3300005471 Bacteria 8041
121 Ga0070698_100065940 3300005471 Unclassified 3645
122 Ga0070698_100074043 3300005471 Bacteria 3411
123 Ga0070698_100193382 3300005471 Unclassified 1972
124 Ga0070698_100213709 3300005471 Unclassified 1863
125 Ga0070699_100000013 3300005518 Bacteria 241303
126 Ga0070699_100003703 3300005518 Bacteria 13518
127 Ga0070699_100009019 3300005518 Bacteria 8640
128 Ga0070699_100018502 3300005518 Bacteria 5983
129 Ga0070699_100021527 3300005518 Bacteria 5560
130 Ga0070699_100065528 3300005518 Bacteria 3152
131 Ga0070699_100126910 3300005518 Bacteria 2247
132 Ga0070699_100407477 3300005518 Bacteria 1230
133 Ga0070679_100000030 3300005530 Bacteria 108148
134 Ga0070697_100000815 3300005536 Bacteria 23370
135 Ga0070697_100002202 3300005536 Bacteria 14960
136 Ga0070697_100011445 3300005536 Bacteria 6935
137 Ga0070697_100064289 3300005536 Bacteria 2997
138 Ga0070697_100146251 3300005536 Archaea 1990
139 Ga0070697_100307415 3300005536 Bacteria 1363
140 Ga0068853_100031052 3300005539 Unclassified 4517
141 Ga0070672_100039328 3300005543 Unclassified 3622
142 Ga0070672_100077995 3300005543 Bacteria 2650
143 Ga0070686_100003241 3300005544 Bacteria 8908
144 Ga0070686_100003645 3300005544 Bacteria 8450
145 Ga0070686_100040199 3300005544 Unclassified 2917
146 Ga0070686_100059983 3300005544 Bacteria 2453
147 Ga0070686_100104425 3300005544 Unclassified 1919
148 Ga0070695_100024536 3300005545 Bacteria 3716
149 Ga0070695_100155756 3300005545 Unclassified 1599
150 Ga0070695_100265798 3300005545 Bacteria 1255
151 Ga0070696_100000142 3300005546 Bacteria 39428
152 Ga0070696_100016605 3300005546 Bacteria 4962
153 Ga0070696_100029196 3300005546 Bacteria 3767
154 Ga0070696_100060099 3300005546 Bacteria 2657
155 Ga0070696_100128008 3300005546 Bacteria 1845
156 Ga0070693_100001963 3300005547 Bacteria 9418
157 Ga0070693_100011793 3300005547 Unclassified 4408
158 Ga0070693_100019543 3300005547 Bacteria 3554
159 Ga0070693_100020774 3300005547 Unclassified 3469
160 Ga0070693_100076970 3300005547 Bacteria 1978
161 Ga0070693_100134441 3300005547 Bacteria 1550
162 Ga0070704_100199048 3300005549 Bacteria 1616
163 Ga0070664_100000993 3300005564 Bacteria 22209
164 Ga0070664_100312632 3300005564 Bacteria 1422
165 Ga0068857_100000975 3300005577 Bacteria 21916
166 Ga0068857_100190378 3300005577 Bacteria 1868
167 Ga0068857_100204409 3300005577 Unclassified 1801
168 Ga0068857_100228896 3300005577 Unclassified 1700
169 Ga0068854_100064865 3300005578 Bacteria 2654
170 Ga0068854_100148373 3300005578 Bacteria 1806
171 Ga0068854_100203136 3300005578 Unclassified 1559
172 Ga0068856_100020464 3300005614 Bacteria 6427
173 Ga0070702_100091268 3300005615 Bacteria 1848
174 Ga0070702_100141079 3300005615 Bacteria 1535
175 Ga0070702_100209884 3300005615 Bacteria 1295
176 Ga0068852_100160271 3300005616 Bacteria 2100
177 Ga0068859_100007068 3300005617 Bacteria 11402
178 Ga0068859_100012132 3300005617 Bacteria 8661
179 Ga0068859_100012145 3300005617 Bacteria 8656
180 Ga0068859_100025911 3300005617 Bacteria 5883
181 Ga0068859_100032153 3300005617 Bacteria 5270
182 Ga0068859_100042357 3300005617 Bacteria 4573
183 Ga0068859_100060003 3300005617 Bacteria 3833
184 Ga0068859_100081126 3300005617 Bacteria 3286
185 Ga0068859_100268515 3300005617 Bacteria 1798
186 Ga0068859_100329059 3300005617 Unclassified 1622
187 Ga0068864_100010943 3300005618 Bacteria 7499
188 Ga0068864_100127453 3300005618 Bacteria 2282
189 Ga0068864_100344366 3300005618 Unclassified 1405
190 Ga0068864_100360564 3300005618 Bacteria 1374
191 Ga0068864_100647532 3300005618 Unclassified 1029
192 Ga0068866_10023361 3300005718 Bacteria 2875
193 Ga0068861_100045022 3300005719 Bacteria 3321
194 Ga0068861_100123195 3300005719 Bacteria 2094
195 Ga0068861_100146057 3300005719 Unclassified 1936
196 Ga0068861_100155583 3300005719 Bacteria 1880
197 Ga0068861_100192133 3300005719 Bacteria 1707
198 Ga0068861_100224486 3300005719 Bacteria 1589
199 Ga0068861_100331902 3300005719 Unclassified 1328
200 Ga0068851_10001956 3300005834 Bacteria 9053
201 Ga0068851_10093969 3300005834 Bacteria 1583
202 Ga0068870_10137998 3300005840 Bacteria 1424
203 Ga0068870_10226527 3300005840 Bacteria 1147
204 Ga0068863_100029077 3300005841 Bacteria 5277
205 Ga0068863_100038234 3300005841 Bacteria 4566
206 Ga0068863_100202130 3300005841 Bacteria 1911
207 Ga0068863_100327197 3300005841 Bacteria 1490
208 Ga0068863_100331448 3300005841 Bacteria 1479
209 Ga0068858_100000005 3300005842 Bacteria 305830
210 Ga0068858_100015618 3300005842 Bacteria 7141
211 Ga0068858_100018142 3300005842 Bacteria 6592
212 Ga0068858_100018604 3300005842 Bacteria 6504
213 Ga0068858_100127881 3300005842 Bacteria 2381
214 Ga0068858_100211798 3300005842 Unclassified 1834
215 Ga0068858_100244599 3300005842 Bacteria 1703
216 Ga0068860_100062022 3300005843 Bacteria 3552
217 Ga0068860_100068444 3300005843 Bacteria 3373
218 Ga0068860_100120344 3300005843 Bacteria 2514
219 Ga0068860_100129295 3300005843 Bacteria 2422
220 Ga0068862_100022410 3300005844 Bacteria 5283
221 Ga0068862_100056733 3300005844 Bacteria 3356
222 Ga0068862_100060739 3300005844 Bacteria 3248
223 Ga0068862_100075997 3300005844 Unclassified 2906
224 Ga0068862_100197680 3300005844 Bacteria 1812
225 Ga0081455_10034672 3300005937 Bacteria 4519
226 Ga0081455_10035005 3300005937 Unclassified 4493
227 Ga0081539_10000063 3300005985 Bacteria 248201
228 Ga0081539_10000481 3300005985 Bacteria 84382
229 Ga0081539_10000505 3300005985 Bacteria 81474
230 Ga0081539_10001527 3300005985 Bacteria 38778
231 Ga0081539_10003540 3300005985 Bacteria 18990
232 Ga0081539_10011665 3300005985 Bacteria 6911
233 Ga0070715_10000024 3300006163 Bacteria 110647
234 Ga0070716_100000001 3300006173 Bacteria 400668
235 Ga0070716_100022229 3300006173 Unclassified 3349
236 Ga0070716_100030114 3300006173 Unclassified 2941
237 Ga0070716_100031763 3300006173 Bacteria 2875
238 Ga0097621_100007343 3300006237 Bacteria 7880
239 Ga0097621_100017050 3300006237 Bacteria 5508
240 Ga0068871_100010860 3300006358 Bacteria 6667
241 Ga0068871_100044081 3300006358 Bacteria 3585
242 Ga0068871_100090330 3300006358 Bacteria 2551
243 Ga0068871_100246900 3300006358 Bacteria 1554
244 Ga0068871_100412566 3300006358 Bacteria 1204
245 Ga0075428_100014706 3300006844 Bacteria 8691
246 Ga0075428_100074253 3300006844 Bacteria 3714
247 Ga0075430_100017261 3300006846 Bacteria 6148
248 Ga0075430_100021301 3300006846 Bacteria 5511
249 Ga0075430_100044394 3300006846 Bacteria 3759
250 Ga0075430_100275422 3300006846 Bacteria 1392
251 Ga0075430_100430194 3300006846 Bacteria 1089
252 Ga0075431_100061591 3300006847 Bacteria 3872
253 Ga0075431_100157924 3300006847 Bacteria 2333
254 Ga0075431_100207546 3300006847 Bacteria 2002
255 Ga0075431_100463409 3300006847 Unclassified 1262
256 Ga0075433_10016589 3300006852 Bacteria 6076
257 Ga0075433_10113416 3300006852 Bacteria 2404
258 Ga0075433_10126172 3300006852 Bacteria 2273
259 Ga0075433_10202530 3300006852 Bacteria 1764
260 Ga0075433_10448625 3300006852 Unclassified 1137
261 Ga0075434_100015289 3300006871 Bacteria 7355
262 Ga0075434_100031077 3300006871 Bacteria 5263
263 Ga0075434_100046071 3300006871 Bacteria 4327
264 Ga0075434_100068328 3300006871 Bacteria 3540
265 Ga0075434_100097509 3300006871 Unclassified 2944
266 Ga0075434_100263547 3300006871 Bacteria 1742
267 Ga0075434_100438326 3300006871 Bacteria 1328
268 Ga0075436_100000002 3300006914 Bacteria 475522
269 Ga0075436_100001803 3300006914 Bacteria 14671
270 Ga0075436_100005634 3300006914 Bacteria 8596
271 Ga0075436_100130482 3300006914 Bacteria 1762
272 Ga0097620_100007068 3300006931 Bacteria 11402
273 Ga0097620_100012131 3300006931 Bacteria 8661
274 Ga0097620_100012145 3300006931 Bacteria 8656
275 Ga0097620_100025911 3300006931 Bacteria 5883
276 Ga0097620_100032153 3300006931 Bacteria 5270
277 Ga0097620_100042356 3300006931 Bacteria 4573
278 Ga0097620_100060005 3300006931 Bacteria 3833
279 Ga0097620_100081129 3300006931 Bacteria 3286
280 Ga0097620_100268509 3300006931 Bacteria 1798
281 Ga0097620_100329059 3300006931 Unclassified 1622
282 Ga0075435_100000689 3300007076 Bacteria 20967
283 Ga0075435_100043657 3300007076 Bacteria 3589
284 Ga0075435_100144084 3300007076 Bacteria 2000
285 Ga0075435_100368076 3300007076 Bacteria 1234
286 Ga0099794_10016619 3300007265 Bacteria 3265
287 Ga0111539_10002073 3300009094 Bacteria 26784
288 Ga0111539_10021012 3300009094 Bacteria 8039
289 Ga0111539_10043272 3300009094 Bacteria 5399
290 Ga0111539_10075324 3300009094 Bacteria 3976
291 Ga0111539_10076926 3300009094 Bacteria 3929
292 Ga0111539_10468096 3300009094 Bacteria 1467
293 Ga0105247_10000002 3300009101 Bacteria 724587
294 Ga0105247_10010710 3300009101 Bacteria 5536
295 Ga0105247_10024038 3300009101 Bacteria 3670
296 Ga0114129_10001970 3300009147 Bacteria 28080
297 Ga0114129_10026989 3300009147 Bacteria 8130
298 Ga0114129_10029655 3300009147 Bacteria 7748
299 Ga0114129_10037669 3300009147 Bacteria 6826
300 Ga0114129_10103290 3300009147 Bacteria 3941
301 Ga0114129_10142560 3300009147 Bacteria 3283
302 Ga0114129_10236022 3300009147 Unclassified 2460
303 Ga0114129_10252410 3300009147 Unclassified 2367
304 Ga0114129_10285625 3300009147 Bacteria 2203
305 Ga0114129_10326501 3300009147 Bacteria 2039
306 Ga0114129_10341933 3300009147 Bacteria 1984
307 Ga0114129_10347258 3300009147 Bacteria 1966
308 Ga0114129_10366736 3300009147 Bacteria 1905
309 Ga0114129_10496983 3300009147 Bacteria 1594
310 Ga0114129_10823858 3300009147 Bacteria 1182
311 Ga0105243_10000037 3300009148 Bacteria 175237
312 Ga0105243_10001856 3300009148 Bacteria 18034
313 Ga0105243_10002586 3300009148 Bacteria 15104
314 Ga0105243_10178955 3300009148 Bacteria 1843
315 Ga0105241_10026459 3300009174 Bacteria 4317
316 Ga0105241_10055416 3300009174 Bacteria 3037
317 Ga0105241_10070579 3300009174 Bacteria 2710
318 Ga0105241_10109508 3300009174 Bacteria 2209
319 Ga0105241_10274335 3300009174 Unclassified 1438
320 Ga0105241_10299486 3300009174 Bacteria 1380
321 Ga0105241_10400550 3300009174 Bacteria 1204
322 Ga0105242_10000276 3300009176 Bacteria 40893
323 Ga0105242_10002534 3300009176 Bacteria 14339
324 Ga0105242_10042712 3300009176 Bacteria 3663
325 Ga0105242_10077113 3300009176 Bacteria 2780
326 Ga0105242_10597151 3300009176 Bacteria 1066
327 Ga0105248_10001987 3300009177 Bacteria 22745
328 Ga0105248_10044241 3300009177 Bacteria 4994
329 Ga0105248_10114735 3300009177 Bacteria 3038
330 Ga0105248_10181845 3300009177 Bacteria 2369
331 Ga0105248_10209409 3300009177 Bacteria 2197
332 Ga0105248_10243410 3300009177 Bacteria 2025
333 Ga0105248_10368877 3300009177 Bacteria 1616
334 Ga0105248_10415580 3300009177 Bacteria 1515
335 Ga0105237_10000521 3300009545 Bacteria 54240
336 Ga0105238_10014544 3300009551 Bacteria 7959
337 Ga0105249_10000201 3300009553 Bacteria 68199
338 Ga0105249_10003117 3300009553 Bacteria 14331
339 Ga0105249_10033991 3300009553 Bacteria 4618
340 Ga0105249_10141454 3300009553 Bacteria 2308
341 Ga0105239_10025216 3300010375 Bacteria 6547
342 Ga0105239_10163707 3300010375 Bacteria 2486
343 Ga0105239_10169569 3300010375 Bacteria 2440
344 Ga0105239_10171201 3300010375 Unclassified 2428
345 Ga0105246_10020812 3300011119 Bacteria 4213
346 Ga0105246_10055773 3300011119 Bacteria 2729
347 Ga0157373_10027431 3300013100 Unclassified 4108
348 Ga0157373_10035143 3300013100 Bacteria 3599
349 Ga0157374_10061420 3300013296 Bacteria 3519
350 Ga0157374_10151739 3300013296 Archaea 2253
351 Ga0157378_10000003 3300013297 Bacteria 203725
352 Ga0157378_10003542 3300013297 Bacteria 13841
353 Ga0157378_10006907 3300013297 Bacteria 9909
354 Ga0157378_10033382 3300013297 Bacteria 4549
355 Ga0157378_10035238 3300013297 Unclassified 4426
356 Ga0157378_10079059 3300013297 Bacteria 2968
357 Ga0157378_10116680 3300013297 Bacteria 2455
358 Ga0157378_10127396 3300013297 Bacteria 2353
359 Ga0157378_10138281 3300013297 Unclassified 2260
360 Ga0157378_10208081 3300013297 Unclassified 1854
361 Ga0163162_10000128 3300013306 Bacteria 68199
362 Ga0163162_10003297 3300013306 Bacteria 15445
363 Ga0163162_10008501 3300013306 Bacteria 10011
364 Ga0163162_10034610 3300013306 Bacteria 5027
365 Ga0163162_10051702 3300013306 Unclassified 4123
366 Ga0163162_10093097 3300013306 Bacteria 3098
367 Ga0163162_10183957 3300013306 Bacteria 2216
368 Ga0163162_10759394 3300013306 Bacteria 1089
369 Ga0157372_10034510 3300013307 Bacteria 5561
370 Ga0157372_10406380 3300013307 Bacteria 1587
371 Ga0157372_10454346 3300013307 Bacteria 1493
372 Ga0157375_10001282 3300013308 Bacteria 21701
373 Ga0157375_10004533 3300013308 Bacteria 12068
374 Ga0157375_10034724 3300013308 Bacteria 4807
375 Ga0157375_10244699 3300013308 Bacteria 1953
376 Ga0157375_10526137 3300013308 Bacteria 1345
377 Ga0157375_10567054 3300013308 Unclassified 1296
378 Ga0163163_10002306 3300014325 Bacteria 16112
379 Ga0163163_10023389 3300014325 Bacteria 5864
380 Ga0163163_10026850 3300014325 Bacteria 5508
381 Ga0163163_10046151 3300014325 Bacteria 4279
382 Ga0163163_10056787 3300014325 Bacteria 3869
383 Ga0163163_10066321 3300014325 Bacteria 3585
384 Ga0163163_10218947 3300014325 Unclassified 1952
385 Ga0157380_10046187 3300014326 Bacteria 3419
386 Ga0157380_10086540 3300014326 Bacteria 2575
387 Ga0157380_10101260 3300014326 Bacteria 2400
388 Ga0157377_10013264 3300014745 Bacteria 4168
389 Ga0157377_10051554 3300014745 Bacteria 2321
390 Ga0157379_10167026 3300014968 Bacteria 1986
391 Ga0157379_10175535 3300014968 Bacteria 1935
392 Ga0157379_10579716 3300014968 Bacteria 1046
393 Ga0163161_10014806 3300017792 Bacteria 5434
394 Ga0163161_10031371 3300017792 Bacteria 3786
395 Ga0163161_10070307 3300017792 Bacteria 2559
396 Ga0213873_10006726 3300021358 Bacteria 2274
397 Ga0213874_10027178 3300021377 Bacteria 1626
398 Ga0213876_10000068 3300021384 Bacteria 125977
399 Ga0213876_10000094 3300021384 Bacteria 100182
400 Ga0207672_1000084 3300025223 Bacteria 12333
401 Ga0207656_10003148 3300025321 Bacteria 5650
402 Ga0207653_10000133 3300025885 Bacteria 53038
403 Ga0207653_10001368 3300025885 Bacteria 7953
404 Ga0207642_10039445 3300025899 Unclassified 2052
405 Ga0207710_10000002 3300025900 Bacteria 1251998
406 Ga0207710_10000808 3300025900 Bacteria 16971
407 Ga0207710_10058100 3300025900 Bacteria 1748
408 Ga0207688_10069484 3300025901 Bacteria 1996
409 Ga0207688_10098098 3300025901 Bacteria 1689
410 Ga0207647_10008624 3300025904 Bacteria 7292
411 Ga0207647_10055588 3300025904 Bacteria 2432
412 Ga0207685_10000018 3300025905 Bacteria 145715
413 Ga0207699_10000135 3300025906 Bacteria 50093
414 Ga0207645_10020581 3300025907 Bacteria 4316
415 Ga0207645_10105724 3300025907 Unclassified 1819
416 Ga0207643_10001384 3300025908 Bacteria 13921
417 Ga0207643_10005878 3300025908 Bacteria 6553
418 Ga0207684_10000053 3300025910 Bacteria 225260
419 Ga0207684_10000075 3300025910 Bacteria 183366
420 Ga0207684_10000175 3300025910 Bacteria 106336
421 Ga0207684_10007834 3300025910 Bacteria 9555
422 Ga0207684_10044488 3300025910 Bacteria 3765
423 Ga0207684_10276287 3300025910 Bacteria 1449
424 Ga0207684_10287968 3300025910 Bacteria 1417
425 Ga0207684_10460033 3300025910 Unclassified 1092
426 Ga0207654_10053857 3300025911 Bacteria 2324
427 Ga0207654_10300874 3300025911 Bacteria 1091
428 Ga0207707_10000063 3300025912 Bacteria 108163
429 Ga0207707_10143343 3300025912 Bacteria 2088
430 Ga0207707_10358457 3300025912 Bacteria 1256
431 Ga0207695_10063425 3300025913 Bacteria 3810
432 Ga0207671_10002243 3300025914 Bacteria 20925
433 Ga0207663_10000001 3300025916 Bacteria 591990
434 Ga0207660_10004704 3300025917 Bacteria 8885
435 Ga0207660_10021218 3300025917 Bacteria 4366
436 Ga0207660_10060362 3300025917 Unclassified 2726
437 Ga0207660_10257537 3300025917 Unclassified 1379
438 Ga0207662_10007338 3300025918 Bacteria 5998
439 Ga0207662_10091757 3300025918 Bacteria 1869
440 Ga0207657_10074317 3300025919 Bacteria 2871
441 Ga0207652_10000091 3300025921 Bacteria 98787
442 Ga0207646_10000076 3300025922 Bacteria 135473
443 Ga0207646_10000900 3300025922 Bacteria 38311
444 Ga0207646_10010198 3300025922 Bacteria 9201
445 Ga0207646_10025394 3300025922 Bacteria 5420
446 Ga0207646_10159084 3300025922 Bacteria 2038
447 Ga0207646_10163184 3300025922 Bacteria 2011
448 Ga0207681_10000966 3300025923 Bacteria 18757
449 Ga0207681_10010828 3300025923 Bacteria 5602
450 Ga0207681_10085292 3300025923 Unclassified 2241
451 Ga0207694_10008843 3300025924 Bacteria 7597
452 Ga0207650_10000007 3300025925 Bacteria 530810
453 Ga0207650_10005207 3300025925 Bacteria 8869
454 Ga0207650_10105768 3300025925 Bacteria 2173
455 Ga0207650_10107413 3300025925 Bacteria 2156
456 Ga0207700_10138581 3300025928 Bacteria 1996
457 Ga0207644_10000636 3300025931 Bacteria 22253
458 Ga0207706_10127571 3300025933 Bacteria 2237
459 Ga0207706_10133299 3300025933 Bacteria 2185
460 Ga0207706_10137694 3300025933 Bacteria 2148
461 Ga0207686_10000003 3300025934 Bacteria 376934
462 Ga0207686_10000127 3300025934 Bacteria 61880
463 Ga0207686_10001296 3300025934 Bacteria 14326
464 Ga0207709_10000017 3300025935 Bacteria 470753
465 Ga0207709_10001732 3300025935 Bacteria 14688
466 Ga0207709_10012319 3300025935 Unclassified 4712
467 Ga0207709_10211324 3300025935 Unclassified 1393
468 Ga0207709_10325175 3300025935 Bacteria 1152
469 Ga0207670_10000756 3300025936 Bacteria 16999
470 Ga0207670_10034615 3300025936 Bacteria 3267
471 Ga0207670_10065483 3300025936 Bacteria 2494
472 Ga0207670_10237301 3300025936 Bacteria 1403
473 Ga0207669_10181883 3300025937 Unclassified 1508
474 Ga0207704_10064467 3300025938 Bacteria 2289
475 Ga0207665_10000002 3300025939 Bacteria 267895
476 Ga0207665_10023684 3300025939 Bacteria 4044
477 Ga0207665_10040686 3300025939 Bacteria 3102
478 Ga0207665_10043262 3300025939 Bacteria 3011
479 Ga0207665_10125245 3300025939 Bacteria 1819
480 Ga0207691_10008051 3300025940 Bacteria 10131
481 Ga0207691_10072423 3300025940 Bacteria 3108
482 Ga0207711_10051152 3300025941 Bacteria 3538
483 Ga0207711_10092863 3300025941 Bacteria 2657
484 Ga0207711_10139558 3300025941 Bacteria 2179
485 Ga0207689_10004147 3300025942 Bacteria 13173
486 Ga0207689_10015886 3300025942 Bacteria 6376
487 Ga0207689_10197730 3300025942 Bacteria 1659
488 Ga0207689_10248533 3300025942 Bacteria 1471
489 Ga0207689_10258583 3300025942 Bacteria 1440
490 Ga0207689_10334182 3300025942 Unclassified 1258
491 Ga0207679_10070831 3300025945 Bacteria 2628
492 Ga0207679_10199279 3300025945 Bacteria 1671
493 Ga0207651_10056474 3300025960 Bacteria 2702
494 Ga0207651_10423580 3300025960 Bacteria 1137
495 Ga0207712_10000259 3300025961 Bacteria 51318
496 Ga0207712_10014084 3300025961 Bacteria 5134
497 Ga0207712_10050006 3300025961 Bacteria 2917
498 Ga0207712_10075341 3300025961 Bacteria 2439
499 Ga0207668_10002115 3300025972 Bacteria 11592
500 Ga0207677_10070868 3300026023 Bacteria 2458
501 Ga0207677_10142628 3300026023 Bacteria 1837
502 Ga0207703_10000158 3300026035 Bacteria 78397
503 Ga0207703_10033181 3300026035 Bacteria 4090
504 Ga0207703_10106590 3300026035 Unclassified 2384
505 Ga0207703_10115494 3300026035 Unclassified 2297
506 Ga0207703_10139092 3300026035 Bacteria 2105
507 Ga0207703_10140058 3300026035 Unclassified 2098
508 Ga0207703_10195785 3300026035 Bacteria 1793
509 Ga0207703_10269747 3300026035 Archaea 1541
510 Ga0207703_10274780 3300026035 Bacteria 1528
511 Ga0207703_10294039 3300026035 Bacteria 1479
512 Ga0207639_10328729 3300026041 Unclassified 1359
513 Ga0207708_10001411 3300026075 Bacteria 18027
514 Ga0207708_10024047 3300026075 Bacteria 4607
515 Ga0207708_10069370 3300026075 Bacteria 2699
516 Ga0207708_10110412 3300026075 Bacteria 2134
517 Ga0207702_10041969 3300026078 Bacteria 3836
518 Ga0207641_10509349 3300026088 Bacteria 1170
519 Ga0207648_10440568 3300026089 Bacteria 1185
520 Ga0207648_10534254 3300026089 Unclassified 1076
521 Ga0207676_10003650 3300026095 Bacteria 10884
522 Ga0207676_10060804 3300026095 Bacteria 2989
523 Ga0207676_10164944 3300026095 Bacteria 1924
524 Ga0207676_10166525 3300026095 Bacteria 1916
525 Ga0207676_10271609 3300026095 Bacteria 1536
526 Ga0207674_10000058 3300026116 Bacteria 113012
527 Ga0207674_10041265 3300026116 Bacteria 4774
528 Ga0207674_10151902 3300026116 Bacteria 2272
529 Ga0207674_10216492 3300026116 Bacteria 1864
530 Ga0207674_10247125 3300026116 Unclassified 1731
531 Ga0207674_10443566 3300026116 Bacteria 1254
532 Ga0207675_100018476 3300026118 Bacteria 6503
533 Ga0207675_100019567 3300026118 Bacteria 6317
534 Ga0207675_100026731 3300026118 Bacteria 5371
535 Ga0207675_100045493 3300026118 Bacteria 4100
536 Ga0207675_100063633 3300026118 Bacteria 3447
537 Ga0207675_100101016 3300026118 Bacteria 2717
538 Ga0207675_100156763 3300026118 Bacteria 2170
539 Ga0207675_100312992 3300026118 Unclassified 1531
540 Ga0207675_100475963 3300026118 Unclassified 1241
541 Ga0207683_10056980 3300026121 Bacteria 3429
542 Ga0207683_10149236 3300026121 Bacteria 2109
543 Ga0207698_10090003 3300026142 Unclassified 2509
544 Ga0207698_10136274 3300026142 Bacteria 2107
545 Ga0207428_10007052 3300027907 Bacteria 10291
546 Ga0207428_10020238 3300027907 Bacteria 5657
547 Ga0207428_10030203 3300027907 Unclassified 4483
548 Ga0207428_10068043 3300027907 Bacteria 2802
549 Ga0268265_10043384 3300028380 Bacteria 3343
550 Ga0268265_10151949 3300028380 Bacteria 1954
551 Ga0268264_10009644 3300028381 Bacteria 7998
552 Ga0268264_10054523 3300028381 Bacteria 3338
553 Ga0268264_10382992 3300028381 Bacteria 1347
554 Ga0307408_100087903 3300031548 Bacteria 2340
555 Ga0307408_100268235 3300031548 Bacteria 1416
556 Ga0307405_10009530 3300031731 Bacteria 4983
557 Ga0307405_10051723 3300031731 Bacteria 2550
558 Ga0307405_10205402 3300031731 Bacteria 1434
559 Ga0316577_10014294 3300031733 Unclassified 4355
560 Ga0316577_10070805 3300031733 Bacteria 1946
561 Ga0307410_10006757 3300031852 Bacteria 6221
562 Ga0307410_10079440 3300031852 Bacteria 2299
563 Ga0307406_10001697 3300031901 Bacteria 12099
564 Ga0307407_10018518 3300031903 Bacteria 3524
565 Ga0307412_10008182 3300031911 Bacteria 5962
566 Ga0307412_10010460 3300031911 Bacteria 5344
567 Ga0307412_10284482 3300031911 Bacteria 1300
568 Ga0307409_100038578 3300031995 Unclassified 3535
569 Ga0307409_100056583 3300031995 Bacteria 3034
570 Ga0307416_100012028 3300032002 Bacteria 5808
571 Ga0307416_100150381 3300032002 Bacteria 2134
572 Ga0307416_100244694 3300032002 Bacteria 1741
573 Ga0307416_100456675 3300032002 Unclassified 1331
574 Ga0307414_10003043 3300032004 Bacteria 8895
575 Ga0307414_10292018 3300032004 Unclassified 1375
576 Ga0307415_100044997 3300032126 Bacteria 2956
577 Ga0307415_100085996 3300032126 Bacteria 2261
578 Ga0373951_0000704 3300035091 Bacteria 9185
579 Ga0373942_0018891 3300035207 Unclassified 1715
580 Ga0316584_0222976 3300036712 Bacteria 1384
581 Ga0395900_0072279 3300037418 Bacteria 3547
582 Ga0395905_0003272 3300037471 Bacteria 17409
583 Ga0395905_0118981 3300037471 Bacteria 2483
584 Ga0316581_0040790 3300037588 Bacteria 1414
585 Ga0395901_0223438 3300038443 Bacteria 1968
586 Ga0395901_0492305 3300038443 Bacteria 1249
587 Ga0242422_04061 3300038699 Bacteria 935
588 Ga0436365_0289912 3300039437 Bacteria 336570
589 Ga0436365_0362873 3300039437 Bacteria 2303
590 Ga0436365_0461431 3300039437 Bacteria 13193
591 Ga0436365_0762848 3300039437 Bacteria 1474
592 Ga0436365_0922078 3300039437 Bacteria 2479
593 Ga0436365_1855834 3300039437 Bacteria 101657
594 Ga0436360_0905083 3300039438 Bacteria 3907
595 Ga0436360_1202911 3300039438 Bacteria 4036
596 Ga0436363_0848427 3300039450 Bacteria 1320
597 Ga0436363_1366655 3300039450 Bacteria 5155
598 Ga0436363_1555706 3300039450 Bacteria 4757
599 Ga0436362_0238646 3300039453 Bacteria 5471
600 Ga0439462_0038101 3300042015 Bacteria 1282
601 Ga0451577_0244069 3300042876 Bacteria 1625
602 Ga0453683_0035457 3300044673 Bacteria 3143
603 Ga0466966_0145827 3300044684 Bacteria 1445
604 Ga0466961_0010407 3300044693 Bacteria 5935
605 Ga0466963_0000529 3300044694 Bacteria 17918
606 Ga0466963_0001029 3300044694 Bacteria 14473
607 Ga0466963_0197063 3300044694 Bacteria 1408
608 Ga0453684_0106606 3300044712 Bacteria 3415
609 Ga0453684_0514922 3300044712 Bacteria 1323
610 Ga0466971_0027874 3300044719 Bacteria 2530
611 Ga0466957_0001729 3300044842 Bacteria 11503
612 Ga0466959_0004805 3300045049 Bacteria 9123
613 Ga0466959_0039345 3300045049 Bacteria 3494
614 Ga0451576_0009797 3300045051 Bacteria 11073
615 Ga0451576_0317466 3300045051 Bacteria 1630
616 Ga0466958_0002786 3300045836 Bacteria 8888
617 Ga0466967_0147509 3300045976 Bacteria 2195
618 Ga0495610_0036772 3300046512 Bacteria 2499
619 Ga0495663_0000141 3300046525 Bacteria 29337
620 Ga0495652_0229147 3300046529 Bacteria 1391
621 Ga0495621_0000577 3300046539 Bacteria 9154
622 Ga0495621_0024228 3300046539 Bacteria 2026
623 Ga0495621_0071521 3300046539 Bacteria 1279
624 Ga0495670_0083029 3300046691 Bacteria 1634
625 Ga0495672_0031489 3300047320 Bacteria 3311
626 Ga0495680_0265660 3300047322 Bacteria 1213
627 Ga0496104_0088689 3300048907 Bacteria 2955
628 Ga0496104_0217274 3300048907 Bacteria 1824
629 Ga0496106_0000699 3300048909 Bacteria 24103
630 Ga0496106_0351967 3300048909 Eukaryota 1183
631 Ga0496108_0137876 3300048911 Bacteria 2100
632 Ga0496109_0000068 3300048912 Bacteria 110206
633 Ga0496113_0310197 3300048916 Bacteria 1264
634 Ga0501291_007196 3300049514 Unclassified 1502
635 Ga0501298_010622 3300049521 Unclassified 1587
636 Ga0501038_0007479 3300049574 Bacteria 10078
637 Ga0501041_0276930 3300049577 Unclassified 1056
638 Ga0501046_0270341 3300049580 Bacteria 1247
639 Ga0501075_0246789 3300049591 Unclassified 1361
640 Ga0501198_016832 3300049649 Unclassified 1133
641 Ga0501202_000926 3300049652 Bacteria 4515
642 Ga0501216_002105 3300049660 Bacteria 2791
643 Ga0501217_007572 3300049661 Unclassified 2331
644 Ga0501223_019820 3300049663 Bacteria 1320
645 Ga0501223_020264 3300049663 Unclassified 1304
646 Ga0501224_001637 3300049664 Unclassified 2999
647 Ga0501249_023683 3300049679 Unclassified 1349
648 Ga0501225_0003414 3300049705 Bacteria 4819
649 Ga0501225_0005625 3300049705 Unclassified 3673
650 Ga0501081_0313987 3300049743 Unclassified 1151
651 Ga0501272_002671 3300049769 Bacteria 1773
652 Ga0501273_005407 3300049770 Unclassified 1441
653 Ga0501204_003138 3300049850 Unclassified 1719
654 Ga0501212_003908 3300049851 Unclassified 1894
655 nmdc:mga05p37_100796_c1 3300050507 Unclassified 3557
656 nmdc:mga05p37_13047_c1 3300050507 Bacteria 9943
657 nmdc:mga05p37_1311_c1 3300050507 Bacteria 28942
658 nmdc:mga05p37_143270_c1 3300050507 Unclassified 2927
659 nmdc:mga05p37_149278_c1 3300050507 Bacteria 2860
660 nmdc:mga05p37_65024_c1 3300050507 Bacteria 4488
661 nmdc:mga05p37_79373_c1 3300050507 Bacteria 4041
662 nmdc:mga09592_118109_c1 3300050508 Bacteria 2276
663 nmdc:mga09592_131622_c1 3300050508 Bacteria 2152
664 nmdc:mga0qj67_265920_c1 3300050509 Bacteria 1391
665 nmdc:mga0qj67_330481_c1 3300050509 Bacteria 1234
666 nmdc:mga0qj67_353494_c1 3300050509 Bacteria 1188
667 nmdc:mga06r32_19052_c1 3300050510 Bacteria 6292
668 nmdc:mga06r32_213119_c1 3300050510 Bacteria 1919
669 nmdc:mga06r32_30395_c1 3300050510 Bacteria 5067
670 nmdc:mga06r32_99732_c1 3300050510 Bacteria 2849
671 nmdc:mga08y16_12546_c1 3300050511 Bacteria 8917
672 nmdc:mga08y16_172186_c1 3300050511 Bacteria 2249
673 nmdc:mga08y16_274777_c1 3300050511 Unclassified 1739
674 nmdc:mga08y16_304335_c1 3300050511 Bacteria 1643
675 nmdc:mga08y16_5499_c1 3300050511 Bacteria 13248
676 nmdc:mga08y16_8851_c1 3300050511 Bacteria 10566
677 nmdc:mga0n895_105790_c1 3300050512 Bacteria 2826
678 nmdc:mga0n895_145682_c1 3300050512 Unclassified 2398
679 nmdc:mga0n895_6791_c1 3300050512 Bacteria 9766
680 nmdc:mga0rr50_127700_c1 3300050513 Bacteria 2032
681 nmdc:mga0rr50_3567_c1 3300050513 Bacteria 8989
682 nmdc:mga0rr50_61526_c1 3300050513 Bacteria 2829
683 nmdc:mga08x19_165449_c1 3300050514 Bacteria 1504
684 nmdc:mga08x19_3501_c1 3300050514 Bacteria 9341
685 nmdc:mga08x19_63905_c1 3300050514 Bacteria 2389
686 nmdc:mga08x19_78771_c1 3300050514 Unclassified 2160
687 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
688 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
689 nmdc:mga0a205_135702_c1 3300050515 Bacteria 2361
690 nmdc:mga0a205_17483_c2 3300050515 Unclassified 3444
691 nmdc:mga0a205_183634_c1 3300050515 Bacteria 1985
692 nmdc:mga0a205_296833_c1 3300050515 Unclassified 1489
693 nmdc:mga0a205_383514_c1 3300050515 Bacteria 1270
694 nmdc:mga0a205_39448_c1 3300050515 Bacteria 4545
695 nmdc:mga0a205_89580_c1 3300050515 Bacteria 2974
696 Ga0495655_0001853 3300053083 Bacteria 3296
697 Ga0500641_0150771 3300053096 Bacteria 1004
698 Ga0501084_0319581 3300054114 Unclassified 1311
699 Ga0530510_0109749 3300061734 Bacteria 2020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0848427 Ga0436363_0848427_60_1073 242
2 3300005440 Ga0070705_100000011 Ga0070705_1000000118 273
3 3300046512 Ga0495610_0036772 Ga0495610_0036772_134_1096 274
4 3300026118 Ga0207675_100312992 Ga0207675_1003129921 282
5 3300005330 Ga0070690_100004956 Ga0070690_1000049565 284
6 3300005338 Ga0068868_100147137 Ga0068868_1001471372 284
7 3300005343 Ga0070687_100034513 Ga0070687_1000345132 284
8 3300005441 Ga0070700_100307860 Ga0070700_1003078601 284
9 3300005444 Ga0070694_100133875 Ga0070694_1001338752 284
10 3300005543 Ga0070672_100077995 Ga0070672_1000779952 284
11 3300005544 Ga0070686_100003241 Ga0070686_1000032413 284
12 3300005617 Ga0068859_100268515 Ga0068859_1002685151 284
13 3300005719 Ga0068861_100331902 Ga0068861_1003319022 284
14 3300005842 Ga0068858_100244599 Ga0068858_1002445992 284
15 3300006931 Ga0097620_100268509 Ga0097620_1002685091 284
16 3300013297 Ga0157378_10035238 Ga0157378_100352384 284
17 3300017792 Ga0163161_10070307 Ga0163161_100703073 284
18 3300025918 Ga0207662_10091757 Ga0207662_100917572 284
19 3300025933 Ga0207706_10137694 Ga0207706_101376942 284
20 3300025942 Ga0207689_10334182 Ga0207689_103341821 284
21 3300026118 Ga0207675_100475963 Ga0207675_1004759631 284
22 3300005293 Ga0065715_10003739 Ga0065715_100037392 285
23 3300005293 Ga0065715_10091106 Ga0065715_100911068 285
24 3300005340 Ga0070689_100002015 Ga0070689_10000201510 285
25 3300005340 Ga0070689_100286632 Ga0070689_1002866322 285
26 3300005364 Ga0070673_100143015 Ga0070673_1001430152 285
27 3300005438 Ga0070701_10180342 Ga0070701_101803421 285
28 3300005440 Ga0070705_100022640 Ga0070705_1000226404 285
29 3300005545 Ga0070695_100024536 Ga0070695_1000245362 285
30 3300005545 Ga0070695_100155756 Ga0070695_1001557561 285
31 3300005617 Ga0068859_100025911 Ga0068859_1000259114 285
32 3300005617 Ga0068859_100060003 Ga0068859_1000600033 285
33 3300005617 Ga0068859_100081126 Ga0068859_1000811263 285
34 3300005618 Ga0068864_100360564 Ga0068864_1003605642 285
35 3300005841 Ga0068863_100038234 Ga0068863_1000382343 285
36 3300005841 Ga0068863_100202130 Ga0068863_1002021302 285
37 3300005985 Ga0081539_10003540 Ga0081539_100035401 285
38 3300006358 Ga0068871_100010860 Ga0068871_1000108604 285
39 3300006871 Ga0075434_100015289 Ga0075434_1000152892 285
40 3300006931 Ga0097620_100025911 Ga0097620_1000259114 285
41 3300006931 Ga0097620_100060005 Ga0097620_1000600053 285
42 3300006931 Ga0097620_100081129 Ga0097620_1000811293 285
43 3300009177 Ga0105248_10181845 Ga0105248_101818452 285
44 3300009177 Ga0105248_10243410 Ga0105248_102434102 285
45 3300009177 Ga0105248_10415580 Ga0105248_104155803 285
46 3300009551 Ga0105238_10014544 Ga0105238_100145444 285
47 3300013100 Ga0157373_10035143 Ga0157373_100351432 285
48 3300013308 Ga0157375_10244699 Ga0157375_102446992 285
49 3300025900 Ga0207710_10000808 Ga0207710_100008083 285
50 3300025904 Ga0207647_10055588 Ga0207647_100555882 285
51 3300025908 Ga0207643_10001384 Ga0207643_1000138414 285
52 3300025924 Ga0207694_10008843 Ga0207694_100088433 285
53 3300025936 Ga0207670_10000756 Ga0207670_100007566 285
54 3300025936 Ga0207670_10237301 Ga0207670_102373011 285
55 3300025941 Ga0207711_10092863 Ga0207711_100928631 285
56 3300025960 Ga0207651_10423580 Ga0207651_104235801 285
57 3300026035 Ga0207703_10106590 Ga0207703_101065902 285
58 3300026041 Ga0207639_10328729 Ga0207639_103287292 285
59 3300026095 Ga0207676_10003650 Ga0207676_100036508 285
60 3300026095 Ga0207676_10166525 Ga0207676_101665252 285
61 3300032004 Ga0307414_10292018 Ga0307414_102920181 285
62 3300035091 Ga0373951_0000704 Ga0373951_0000704_215_1075 285
63 3300035207 Ga0373942_0018891 Ga0373942_0018891_554_1414 285
64 3300038699 Ga0242422_04061 Ga0242422_04061_34_894 285
65 3300048911 Ga0496108_0137876 Ga0496108_0137876_22_879 285
66 3300050515 nmdc:mga0a205_89580_c1 nmdc:mga0a205_89580_c1_1250_2116 285
67 3300049521 Ga0501298_010622 Ga0501298_010622_74_943 286
68 3300049770 Ga0501273_005407 Ga0501273_005407_194_1063 286
69 3300049850 Ga0501204_003138 Ga0501204_003138_700_1569 286
70 3300011119 Ga0105246_10020812 Ga0105246_100208123 287
71 3300025923 Ga0207681_10085292 Ga0207681_100852923 287
72 3300026116 Ga0207674_10443566 Ga0207674_104435662 287
73 3300009176 Ga0105242_10077113 Ga0105242_100771132 288
74 3300061734 Ga0530510_0109749 Ga0530510_0109749_580_1575 288
75 3300005617 Ga0068859_100042357 Ga0068859_1000423572 292
76 3300006931 Ga0097620_100042356 Ga0097620_1000423562 292
77 3300009177 Ga0105248_10044241 Ga0105248_100442413 292
78 3300042015 Ga0439462_0038101 Ga0439462_0038101_150_1109 292
79 3300049649 Ga0501198_016832 Ga0501198_016832_193_1080 292
80 3300049769 Ga0501272_002671 Ga0501272_002671_527_1414 292
81 3300032002 Ga0307416_100150381 Ga0307416_1001503811 293
82 3300050510 nmdc:mga06r32_213119_c1 nmdc:mga06r32_213119_c1_19_981 294
83 3300005544 Ga0070686_100003645 Ga0070686_10000364510 295
84 3300005937 Ga0081455_10034672 Ga0081455_100346722 295
85 3300006852 Ga0075433_10202530 Ga0075433_102025301 295
86 3300006871 Ga0075434_100438326 Ga0075434_1004383261 295
87 3300007076 Ga0075435_100144084 Ga0075435_1001440842 295
88 3300009094 Ga0111539_10076926 Ga0111539_100769261 295
89 3300009147 Ga0114129_10326501 Ga0114129_103265011 295
90 3300009177 Ga0105248_10368877 Ga0105248_103688772 295
91 3300027907 Ga0207428_10020238 Ga0207428_100202383 295
92 3300050508 nmdc:mga09592_131622_c1 nmdc:mga09592_131622_c1_49_936 295
93 3300050510 nmdc:mga06r32_99732_c1 nmdc:mga06r32_99732_c1_1784_2677 295
94 3300050511 nmdc:mga08y16_5499_c1 nmdc:mga08y16_5499_c1_11682_12569 295
95 3300050513 nmdc:mga0rr50_127700_c1 nmdc:mga0rr50_127700_c1_333_1220 295
96 3300050515 nmdc:mga0a205_135702_c1 nmdc:mga0a205_135702_c1_582_1469 295
97 3300021358 Ga0213873_10006726 Ga0213873_100067261 297
98 3300039437 Ga0436365_0362873 Ga0436365_0362873_281_1294 297
99 3300039453 Ga0436362_0238646 Ga0436362_0238646_2191_3204 297
100 3300021377 Ga0213874_10027178 Ga0213874_100271782 298
101 3300039437 Ga0436365_0461431 Ga0436365_0461431_4318_5352 298
102 3300039437 Ga0436365_0922078 Ga0436365_0922078_879_1823 298
103 3300039438 Ga0436360_1202911 Ga0436360_1202911_2145_3158 298
104 3300039450 Ga0436363_1366655 Ga0436363_1366655_1035_2048 298
105 3300039450 Ga0436363_1555706 Ga0436363_1555706_213_1226 298
106 3300044684 Ga0466966_0145827 Ga0466966_0145827_101_1045 298
107 3300044693 Ga0466961_0010407 Ga0466961_0010407_3231_4262 298
108 3300044694 Ga0466963_0000529 Ga0466963_0000529_6008_6952 298
109 3300044694 Ga0466963_0001029 Ga0466963_0001029_12564_13595 298
110 3300044719 Ga0466971_0027874 Ga0466971_0027874_180_1211 298
111 3300044842 Ga0466957_0001729 Ga0466957_0001729_9233_10177 298
112 3300045049 Ga0466959_0004805 Ga0466959_0004805_3613_4557 298
113 3300045049 Ga0466959_0039345 Ga0466959_0039345_917_1948 298
114 3300045836 Ga0466958_0002786 Ga0466958_0002786_6727_7671 298
115 3300045976 Ga0466967_0147509 Ga0466967_0147509_435_1379 298
116 3300005295 Ga0065707_10094598 Ga0065707_100945983 302
117 3300005327 Ga0070658_10242258 Ga0070658_102422581 302
118 3300005330 Ga0070690_100361939 Ga0070690_1003619391 302
119 3300005331 Ga0070670_100222499 Ga0070670_1002224991 302
120 3300005336 Ga0070680_100034926 Ga0070680_1000349264 302
121 3300005459 Ga0068867_100099941 Ga0068867_1000999413 302
122 3300005564 Ga0070664_100312632 Ga0070664_1003126322 302
123 3300006844 Ga0075428_100074253 Ga0075428_1000742532 302
124 3300006846 Ga0075430_100017261 Ga0075430_1000172612 302
125 3300006846 Ga0075430_100044394 Ga0075430_1000443943 302
126 3300006846 Ga0075430_100275422 Ga0075430_1002754221 302
127 3300006846 Ga0075430_100430194 Ga0075430_1004301941 302
128 3300006847 Ga0075431_100207546 Ga0075431_1002075463 302
129 3300006871 Ga0075434_100031077 Ga0075434_1000310773 302
130 3300025933 Ga0207706_10127571 Ga0207706_101275711 302
131 3300025936 Ga0207670_10034615 Ga0207670_100346153 302
132 3300031731 Ga0307405_10205402 Ga0307405_102054022 302
133 3300031911 Ga0307412_10284482 Ga0307412_102844821 302
134 3300031995 Ga0307409_100056583 Ga0307409_1000565833 302
135 3300032126 Ga0307415_100085996 Ga0307415_1000859963 302
136 3300039438 Ga0436360_0905083 Ga0436360_0905083_2717_3664 302
137 3300044694 Ga0466963_0197063 Ga0466963_0197063_416_1384 302
138 3300046529 Ga0495652_0229147 Ga0495652_0229147_45_1094 302
139 3300050507 nmdc:mga05p37_79373_c1 nmdc:mga05p37_79373_c1_1105_2073 302
140 3300050509 nmdc:mga0qj67_265920_c1 nmdc:mga0qj67_265920_c1_110_1078 302
141 3300050509 nmdc:mga0qj67_353494_c1 nmdc:mga0qj67_353494_c1_164_1132 302
142 3300050510 nmdc:mga06r32_19052_c1 nmdc:mga06r32_19052_c1_5223_6191 302
143 3300050510 nmdc:mga06r32_30395_c1 nmdc:mga06r32_30395_c1_2591_3559 302
144 3300050512 nmdc:mga0n895_6791_c1 nmdc:mga0n895_6791_c1_4855_5823 302
145 3300004801 Ga0058860_12137405 Ga0058860_121374052 303
146 3300005356 Ga0070674_100140853 Ga0070674_1001408532 303
147 3300005438 Ga0070701_10170328 Ga0070701_101703282 303
148 3300005441 Ga0070700_100266430 Ga0070700_1002664301 303
149 3300005466 Ga0070685_10042711 Ga0070685_100427112 303
150 3300005617 Ga0068859_100032153 Ga0068859_1000321534 303
151 3300005719 Ga0068861_100192133 Ga0068861_1001921332 303
152 3300005985 Ga0081539_10011665 Ga0081539_100116652 303
153 3300006847 Ga0075431_100157924 Ga0075431_1001579242 303
154 3300006931 Ga0097620_100032153 Ga0097620_1000321532 303
155 3300009094 Ga0111539_10075324 Ga0111539_100753242 303
156 3300009101 Ga0105247_10024038 Ga0105247_100240382 303
157 3300009147 Ga0114129_10347258 Ga0114129_103472581 303
158 3300009553 Ga0105249_10141454 Ga0105249_101414542 303
159 3300013297 Ga0157378_10127396 Ga0157378_101273961 303
160 3300013306 Ga0163162_10093097 Ga0163162_100930972 303
161 3300013308 Ga0157375_10034724 Ga0157375_100347244 303
162 3300014326 Ga0157380_10101260 Ga0157380_101012601 303
163 3300025900 Ga0207710_10058100 Ga0207710_100581001 303
164 3300025961 Ga0207712_10075341 Ga0207712_100753412 303
165 3300026035 Ga0207703_10274780 Ga0207703_102747801 303
166 3300026118 Ga0207675_100045493 Ga0207675_1000454932 303
167 3300028380 Ga0268265_10151949 Ga0268265_101519492 303
168 3300050511 nmdc:mga08y16_12546_c1 nmdc:mga08y16_12546_c1_1420_2334 303
169 3300005445 Ga0070708_100396565 Ga0070708_1003965651 305
170 3300005289 Ga0065704_10014094 Ga0065704_100140942 306
171 3300005467 Ga0070706_100006976 Ga0070706_1000069766 306
172 3300005536 Ga0070697_100000815 Ga0070697_10000081520 306
173 3300005536 Ga0070697_100002202 Ga0070697_1000022028 306
174 3300013308 Ga0157375_10001282 Ga0157375_100012826 306
175 3300014325 Ga0163163_10218947 Ga0163163_102189472 306
176 3300025910 Ga0207684_10007834 Ga0207684_100078346 306
177 3300026116 Ga0207674_10151902 Ga0207674_101519022 306
178 3300047320 Ga0495672_0031489 Ga0495672_0031489_832_1752 306
179 2162886007 SwRhRL2b_contig_1337615 SwRhRL2b_0471.00004490 307
180 3300002074 JGI24748J21848_1000004 JGI24748J21848_1000004226 307
181 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001696 307
182 3300002459 JGI24751J29686_10000003 JGI24751J29686_1000000345 307
183 3300003203 JGI25406J46586_10003375 JGI25406J46586_100033756 307
184 3300003203 JGI25406J46586_10029515 JGI25406J46586_100295151 307
185 3300005288 Ga0065714_10064425 Ga0065714_10064425106 307
186 3300005289 Ga0065704_10100121 Ga0065704_101001212 307
187 3300005290 Ga0065712_10006311 Ga0065712_100063111 307
188 3300005290 Ga0065712_10067727 Ga0065712_10067727106 307
189 3300005293 Ga0065715_10090321 Ga0065715_100903213 307
190 3300005293 Ga0065715_10250985 Ga0065715_102509851 307
191 3300005295 Ga0065707_10088064 Ga0065707_100880642 307
192 3300005328 Ga0070676_10090647 Ga0070676_100906472 307
193 3300005328 Ga0070676_10127539 Ga0070676_101275392 307
194 3300005330 Ga0070690_100063346 Ga0070690_1000633463 307
195 3300005331 Ga0070670_100000223 Ga0070670_1000002239 307
196 3300005331 Ga0070670_100000832 Ga0070670_1000008324 307
197 3300005331 Ga0070670_100349392 Ga0070670_1003493922 307
198 3300005331 Ga0070670_100354032 Ga0070670_1003540321 307
199 3300005333 Ga0070677_10054187 Ga0070677_100541872 307
200 3300005334 Ga0068869_100015163 Ga0068869_1000151632 307
201 3300005334 Ga0068869_100079568 Ga0068869_1000795682 307
202 3300005334 Ga0068869_100083377 Ga0068869_1000833773 307
203 3300005334 Ga0068869_100131371 Ga0068869_1001313711 307
204 3300005334 Ga0068869_100167619 Ga0068869_1001676191 307
205 3300005334 Ga0068869_100246292 Ga0068869_1002462922 307
206 3300005336 Ga0070680_100002231 Ga0070680_1000022315 307
207 3300005336 Ga0070680_100028397 Ga0070680_1000283972 307
208 3300005336 Ga0070680_100103572 Ga0070680_1001035722 307
209 3300005337 Ga0070682_100000210 Ga0070682_10000021013 307
210 3300005337 Ga0070682_100001346 Ga0070682_10000134616 307
211 3300005337 Ga0070682_100028470 Ga0070682_1000284703 307
212 3300005338 Ga0068868_100010333 Ga0068868_1000103332 307
213 3300005338 Ga0068868_100046778 Ga0068868_1000467782 307
214 3300005338 Ga0068868_100078827 Ga0068868_1000788272 307
215 3300005339 Ga0070660_100066988 Ga0070660_1000669883 307
216 3300005340 Ga0070689_100069366 Ga0070689_1000693664 307
217 3300005340 Ga0070689_100083569 Ga0070689_1000835692 307
218 3300005341 Ga0070691_10105214 Ga0070691_101052142 307
219 3300005343 Ga0070687_100003618 Ga0070687_1000036184 307
220 3300005343 Ga0070687_100087191 Ga0070687_1000871912 307
221 3300005343 Ga0070687_100098454 Ga0070687_1000984542 307
222 3300005345 Ga0070692_10064465 Ga0070692_100644653 307
223 3300005345 Ga0070692_10075891 Ga0070692_100758912 307
224 3300005347 Ga0070668_100008204 Ga0070668_1000082044 307
225 3300005353 Ga0070669_100002272 Ga0070669_1000022724 307
226 3300005353 Ga0070669_100027227 Ga0070669_1000272272 307
227 3300005354 Ga0070675_100088570 Ga0070675_1000885701 307
228 3300005355 Ga0070671_100002475 Ga0070671_1000024758 307
229 3300005355 Ga0070671_100131427 Ga0070671_1001314272 307
230 3300005356 Ga0070674_100054321 Ga0070674_1000543214 307
231 3300005356 Ga0070674_100058068 Ga0070674_1000580681 307
232 3300005364 Ga0070673_100078240 Ga0070673_1000782401 307
233 3300005366 Ga0070659_100002515 Ga0070659_10000251512 307
234 3300005406 Ga0070703_10002983 Ga0070703_100029833 307
235 3300005406 Ga0070703_10038684 Ga0070703_100386843 307
236 3300005434 Ga0070709_10000172 Ga0070709_100001727 307
237 3300005436 Ga0070713_100139028 Ga0070713_1001390282 307
238 3300005437 Ga0070710_10088387 Ga0070710_100883872 307
239 3300005438 Ga0070701_10127615 Ga0070701_101276151 307
240 3300005439 Ga0070711_100000001 Ga0070711_10000000186 307
241 3300005440 Ga0070705_100003338 Ga0070705_1000033384 307
242 3300005441 Ga0070700_100011138 Ga0070700_1000111382 307
243 3300005441 Ga0070700_100148489 Ga0070700_1001484892 307
244 3300005441 Ga0070700_100230644 Ga0070700_1002306441 307
245 3300005444 Ga0070694_100007445 Ga0070694_1000074459 307
246 3300005444 Ga0070694_100088175 Ga0070694_1000881752 307
247 3300005445 Ga0070708_100000042 Ga0070708_10000004224 307
248 3300005445 Ga0070708_100050004 Ga0070708_1000500044 307
249 3300005445 Ga0070708_100177779 Ga0070708_1001777792 307
250 3300005445 Ga0070708_100203521 Ga0070708_1002035211 307
251 3300005445 Ga0070708_100378567 Ga0070708_1003785671 307
252 3300005456 Ga0070678_100106033 Ga0070678_1001060332 307
253 3300005456 Ga0070678_100307244 Ga0070678_1003072442 307
254 3300005457 Ga0070662_100212879 Ga0070662_1002128792 307
255 3300005457 Ga0070662_100276793 Ga0070662_1002767931 307
256 3300005458 Ga0070681_10000053 Ga0070681_1000005351 307
257 3300005458 Ga0070681_10135803 Ga0070681_101358032 307
258 3300005467 Ga0070706_100000053 Ga0070706_100000053117 307
259 3300005467 Ga0070706_100003837 Ga0070706_1000038378 307
260 3300005467 Ga0070706_100007447 Ga0070706_10000744713 307
261 3300005467 Ga0070706_100036769 Ga0070706_1000367692 307
262 3300005467 Ga0070706_100047089 Ga0070706_1000470892 307
263 3300005467 Ga0070706_100159707 Ga0070706_1001597072 307
264 3300005468 Ga0070707_100000054 Ga0070707_10000005417 307
265 3300005468 Ga0070707_100000077 Ga0070707_10000007721 307
266 3300005468 Ga0070707_100108527 Ga0070707_1001085272 307
267 3300005468 Ga0070707_100191962 Ga0070707_1001919622 307
268 3300005468 Ga0070707_100192345 Ga0070707_1001923452 307
269 3300005468 Ga0070707_100197538 Ga0070707_1001975382 307
270 3300005471 Ga0070698_100000593 Ga0070698_1000005937 307
271 3300005471 Ga0070698_100015537 Ga0070698_1000155374 307
272 3300005471 Ga0070698_100065940 Ga0070698_1000659402 307
273 3300005471 Ga0070698_100074043 Ga0070698_1000740431 307
274 3300005471 Ga0070698_100193382 Ga0070698_1001933822 307
275 3300005471 Ga0070698_100213709 Ga0070698_1002137092 307
276 3300005518 Ga0070699_100000013 Ga0070699_100000013174 307
277 3300005518 Ga0070699_100003703 Ga0070699_1000037037 307
278 3300005518 Ga0070699_100009019 Ga0070699_1000090195 307
279 3300005518 Ga0070699_100018502 Ga0070699_1000185029 307
280 3300005518 Ga0070699_100021527 Ga0070699_1000215277 307
281 3300005518 Ga0070699_100065528 Ga0070699_1000655282 307
282 3300005518 Ga0070699_100126910 Ga0070699_1001269102 307
283 3300005518 Ga0070699_100407477 Ga0070699_1004074771 307
284 3300005530 Ga0070679_100000030 Ga0070679_10000003076 307
285 3300005536 Ga0070697_100011445 Ga0070697_1000114458 307
286 3300005536 Ga0070697_100064289 Ga0070697_1000642893 307
287 3300005536 Ga0070697_100146251 Ga0070697_1001462511 307
288 3300005536 Ga0070697_100307415 Ga0070697_1003074151 307
289 3300005539 Ga0068853_100031052 Ga0068853_1000310523 307
290 3300005543 Ga0070672_100039328 Ga0070672_1000393283 307
291 3300005544 Ga0070686_100040199 Ga0070686_1000401992 307
292 3300005544 Ga0070686_100059983 Ga0070686_1000599832 307
293 3300005544 Ga0070686_100104425 Ga0070686_1001044253 307
294 3300005545 Ga0070695_100265798 Ga0070695_1002657981 307
295 3300005546 Ga0070696_100000142 Ga0070696_10000014222 307
296 3300005546 Ga0070696_100016605 Ga0070696_1000166056 307
297 3300005546 Ga0070696_100029196 Ga0070696_1000291963 307
298 3300005546 Ga0070696_100060099 Ga0070696_1000600992 307
299 3300005546 Ga0070696_100128008 Ga0070696_1001280082 307
300 3300005547 Ga0070693_100001963 Ga0070693_1000019637 307
301 3300005547 Ga0070693_100011793 Ga0070693_1000117936 307
302 3300005547 Ga0070693_100019543 Ga0070693_1000195433 307
303 3300005547 Ga0070693_100020774 Ga0070693_1000207743 307
304 3300005547 Ga0070693_100076970 Ga0070693_1000769702 307
305 3300005547 Ga0070693_100134441 Ga0070693_1001344412 307
306 3300005549 Ga0070704_100199048 Ga0070704_1001990481 307
307 3300005564 Ga0070664_100000993 Ga0070664_10000099310 307
308 3300005577 Ga0068857_100000975 Ga0068857_10000097522 307
309 3300005577 Ga0068857_100190378 Ga0068857_1001903782 307
310 3300005577 Ga0068857_100204409 Ga0068857_1002044092 307
311 3300005577 Ga0068857_100228896 Ga0068857_1002288962 307
312 3300005578 Ga0068854_100064865 Ga0068854_1000648652 307
313 3300005578 Ga0068854_100148373 Ga0068854_1001483732 307
314 3300005578 Ga0068854_100203136 Ga0068854_1002031361 307
315 3300005614 Ga0068856_100020464 Ga0068856_1000204641 307
316 3300005615 Ga0070702_100091268 Ga0070702_1000912682 307
317 3300005615 Ga0070702_100141079 Ga0070702_1001410792 307
318 3300005615 Ga0070702_100209884 Ga0070702_1002098842 307
319 3300005616 Ga0068852_100160271 Ga0068852_1001602712 307
320 3300005617 Ga0068859_100007068 Ga0068859_1000070687 307
321 3300005617 Ga0068859_100012132 Ga0068859_1000121324 307
322 3300005617 Ga0068859_100012145 Ga0068859_10001214512 307
323 3300005617 Ga0068859_100329059 Ga0068859_1003290592 307
324 3300005618 Ga0068864_100010943 Ga0068864_1000109432 307
325 3300005618 Ga0068864_100127453 Ga0068864_1001274532 307
326 3300005618 Ga0068864_100344366 Ga0068864_1003443661 307
327 3300005618 Ga0068864_100647532 Ga0068864_1006475321 307
328 3300005718 Ga0068866_10023361 Ga0068866_100233612 307
329 3300005719 Ga0068861_100045022 Ga0068861_1000450225 307
330 3300005719 Ga0068861_100123195 Ga0068861_1001231952 307
331 3300005719 Ga0068861_100146057 Ga0068861_1001460572 307
332 3300005719 Ga0068861_100155583 Ga0068861_1001555832 307
333 3300005719 Ga0068861_100224486 Ga0068861_1002244861 307
334 3300005834 Ga0068851_10001956 Ga0068851_100019565 307
335 3300005834 Ga0068851_10093969 Ga0068851_100939692 307
336 3300005840 Ga0068870_10137998 Ga0068870_101379981 307
337 3300005840 Ga0068870_10226527 Ga0068870_102265272 307
338 3300005841 Ga0068863_100029077 Ga0068863_1000290775 307
339 3300005841 Ga0068863_100327197 Ga0068863_1003271971 307
340 3300005841 Ga0068863_100331448 Ga0068863_1003314482 307
341 3300005842 Ga0068858_100000005 Ga0068858_10000000543 307
342 3300005842 Ga0068858_100015618 Ga0068858_1000156182 307
343 3300005842 Ga0068858_100018142 Ga0068858_1000181425 307
344 3300005842 Ga0068858_100018604 Ga0068858_1000186042 307
345 3300005842 Ga0068858_100127881 Ga0068858_1001278811 307
346 3300005842 Ga0068858_100211798 Ga0068858_1002117982 307
347 3300005843 Ga0068860_100062022 Ga0068860_1000620222 307
348 3300005843 Ga0068860_100068444 Ga0068860_1000684442 307
349 3300005843 Ga0068860_100120344 Ga0068860_1001203442 307
350 3300005843 Ga0068860_100129295 Ga0068860_1001292954 307
351 3300005844 Ga0068862_100022410 Ga0068862_1000224103 307
352 3300005844 Ga0068862_100056733 Ga0068862_1000567331 307
353 3300005844 Ga0068862_100060739 Ga0068862_1000607392 307
354 3300005844 Ga0068862_100075997 Ga0068862_1000759973 307
355 3300005844 Ga0068862_100197680 Ga0068862_1001976801 307
356 3300005937 Ga0081455_10035005 Ga0081455_100350051 307
357 3300005985 Ga0081539_10000063 Ga0081539_10000063151 307
358 3300005985 Ga0081539_10000481 Ga0081539_1000048169 307
359 3300005985 Ga0081539_10000505 Ga0081539_100005055 307
360 3300005985 Ga0081539_10001527 Ga0081539_1000152727 307
361 3300006163 Ga0070715_10000024 Ga0070715_1000002486 307
362 3300006173 Ga0070716_100000001 Ga0070716_100000001308 307
363 3300006173 Ga0070716_100022229 Ga0070716_1000222293 307
364 3300006173 Ga0070716_100030114 Ga0070716_1000301144 307
365 3300006173 Ga0070716_100031763 Ga0070716_1000317632 307
366 3300006237 Ga0097621_100007343 Ga0097621_1000073433 307
367 3300006237 Ga0097621_100017050 Ga0097621_1000170506 307
368 3300006358 Ga0068871_100044081 Ga0068871_1000440812 307
369 3300006358 Ga0068871_100090330 Ga0068871_1000903302 307
370 3300006358 Ga0068871_100246900 Ga0068871_1002469002 307
371 3300006358 Ga0068871_100412566 Ga0068871_1004125662 307
372 3300006844 Ga0075428_100014706 Ga0075428_1000147066 307
373 3300006846 Ga0075430_100021301 Ga0075430_1000213012 307
374 3300006847 Ga0075431_100061591 Ga0075431_1000615914 307
375 3300006847 Ga0075431_100463409 Ga0075431_1004634092 307
376 3300006852 Ga0075433_10016589 Ga0075433_100165893 307
377 3300006852 Ga0075433_10113416 Ga0075433_101134162 307
378 3300006852 Ga0075433_10126172 Ga0075433_101261722 307
379 3300006852 Ga0075433_10448625 Ga0075433_104486251 307
380 3300006871 Ga0075434_100046071 Ga0075434_1000460712 307
381 3300006871 Ga0075434_100068328 Ga0075434_1000683284 307
382 3300006871 Ga0075434_100097509 Ga0075434_1000975093 307
383 3300006871 Ga0075434_100263547 Ga0075434_1002635472 307
384 3300006914 Ga0075436_100000002 Ga0075436_10000000220 307
385 3300006914 Ga0075436_100001803 Ga0075436_10000180315 307
386 3300006914 Ga0075436_100005634 Ga0075436_1000056348 307
387 3300006914 Ga0075436_100130482 Ga0075436_1001304822 307
388 3300006931 Ga0097620_100007068 Ga0097620_1000070687 307
389 3300006931 Ga0097620_100012131 Ga0097620_1000121314 307
390 3300006931 Ga0097620_100012145 Ga0097620_10001214512 307
391 3300006931 Ga0097620_100329059 Ga0097620_1003290592 307
392 3300007076 Ga0075435_100000689 Ga0075435_1000006897 307
393 3300007076 Ga0075435_100043657 Ga0075435_1000436575 307
394 3300007076 Ga0075435_100368076 Ga0075435_1003680762 307
395 3300007265 Ga0099794_10016619 Ga0099794_100166192 307
396 3300009094 Ga0111539_10002073 Ga0111539_100020736 307
397 3300009094 Ga0111539_10021012 Ga0111539_100210125 307
398 3300009094 Ga0111539_10043272 Ga0111539_100432722 307
399 3300009094 Ga0111539_10468096 Ga0111539_104680961 307
400 3300009101 Ga0105247_10000002 Ga0105247_10000002302 307
401 3300009101 Ga0105247_10010710 Ga0105247_100107104 307
402 3300009147 Ga0114129_10001970 Ga0114129_1000197022 307
403 3300009147 Ga0114129_10026989 Ga0114129_100269899 307
404 3300009147 Ga0114129_10029655 Ga0114129_1002965510 307
405 3300009147 Ga0114129_10037669 Ga0114129_100376692 307
406 3300009147 Ga0114129_10103290 Ga0114129_101032903 307
407 3300009147 Ga0114129_10142560 Ga0114129_101425603 307
408 3300009147 Ga0114129_10236022 Ga0114129_102360222 307
409 3300009147 Ga0114129_10252410 Ga0114129_102524102 307
410 3300009147 Ga0114129_10285625 Ga0114129_102856252 307
411 3300009147 Ga0114129_10341933 Ga0114129_103419332 307
412 3300009147 Ga0114129_10366736 Ga0114129_103667362 307
413 3300009147 Ga0114129_10496983 Ga0114129_104969832 307
414 3300009147 Ga0114129_10823858 Ga0114129_108238582 307
415 3300009148 Ga0105243_10000037 Ga0105243_1000003774 307
416 3300009148 Ga0105243_10001856 Ga0105243_100018563 307
417 3300009148 Ga0105243_10002586 Ga0105243_100025866 307
418 3300009148 Ga0105243_10178955 Ga0105243_101789552 307
419 3300009174 Ga0105241_10026459 Ga0105241_100264595 307
420 3300009174 Ga0105241_10055416 Ga0105241_100554161 307
421 3300009174 Ga0105241_10070579 Ga0105241_100705792 307
422 3300009174 Ga0105241_10109508 Ga0105241_101095081 307
423 3300009174 Ga0105241_10274335 Ga0105241_102743352 307
424 3300009174 Ga0105241_10299486 Ga0105241_102994862 307
425 3300009174 Ga0105241_10400550 Ga0105241_104005501 307
426 3300009176 Ga0105242_10000276 Ga0105242_1000027630 307
427 3300009176 Ga0105242_10002534 Ga0105242_100025342 307
428 3300009176 Ga0105242_10042712 Ga0105242_100427122 307
429 3300009176 Ga0105242_10597151 Ga0105242_105971511 307
430 3300009177 Ga0105248_10001987 Ga0105248_100019876 307
431 3300009177 Ga0105248_10114735 Ga0105248_101147354 307
432 3300009177 Ga0105248_10209409 Ga0105248_102094092 307
433 3300009545 Ga0105237_10000521 Ga0105237_1000052128 307
434 3300009553 Ga0105249_10000201 Ga0105249_1000020146 307
435 3300009553 Ga0105249_10003117 Ga0105249_100031174 307
436 3300009553 Ga0105249_10033991 Ga0105249_100339915 307
437 3300010375 Ga0105239_10025216 Ga0105239_100252162 307
438 3300010375 Ga0105239_10163707 Ga0105239_101637072 307
439 3300010375 Ga0105239_10169569 Ga0105239_101695692 307
440 3300010375 Ga0105239_10171201 Ga0105239_101712012 307
441 3300011119 Ga0105246_10055773 Ga0105246_100557732 307
442 3300013100 Ga0157373_10027431 Ga0157373_100274313 307
443 3300013296 Ga0157374_10061420 Ga0157374_100614205 307
444 3300013296 Ga0157374_10151739 Ga0157374_101517393 307
445 3300013297 Ga0157378_10000003 Ga0157378_10000003102 307
446 3300013297 Ga0157378_10003542 Ga0157378_100035428 307
447 3300013297 Ga0157378_10006907 Ga0157378_100069078 307
448 3300013297 Ga0157378_10033382 Ga0157378_100333823 307
449 3300013297 Ga0157378_10079059 Ga0157378_100790594 307
450 3300013297 Ga0157378_10116680 Ga0157378_101166802 307
451 3300013297 Ga0157378_10138281 Ga0157378_101382812 307
452 3300013297 Ga0157378_10208081 Ga0157378_102080812 307
453 3300013306 Ga0163162_10000128 Ga0163162_1000012846 307
454 3300013306 Ga0163162_10003297 Ga0163162_100032975 307
455 3300013306 Ga0163162_10008501 Ga0163162_100085017 307
456 3300013306 Ga0163162_10034610 Ga0163162_100346106 307
457 3300013306 Ga0163162_10051702 Ga0163162_100517022 307
458 3300013306 Ga0163162_10183957 Ga0163162_101839571 307
459 3300013306 Ga0163162_10759394 Ga0163162_107593941 307
460 3300013307 Ga0157372_10034510 Ga0157372_100345103 307
461 3300013307 Ga0157372_10406380 Ga0157372_104063802 307
462 3300013307 Ga0157372_10454346 Ga0157372_104543461 307
463 3300013308 Ga0157375_10004533 Ga0157375_100045339 307
464 3300013308 Ga0157375_10526137 Ga0157375_105261371 307
465 3300013308 Ga0157375_10567054 Ga0157375_105670541 307
466 3300014325 Ga0163163_10002306 Ga0163163_100023068 307
467 3300014325 Ga0163163_10023389 Ga0163163_100233896 307
468 3300014325 Ga0163163_10026850 Ga0163163_100268508 307
469 3300014325 Ga0163163_10046151 Ga0163163_100461515 307
470 3300014325 Ga0163163_10056787 Ga0163163_100567872 307
471 3300014325 Ga0163163_10066321 Ga0163163_100663213 307
472 3300014326 Ga0157380_10046187 Ga0157380_100461872 307
473 3300014326 Ga0157380_10086540 Ga0157380_100865402 307
474 3300014745 Ga0157377_10013264 Ga0157377_100132641 307
475 3300014745 Ga0157377_10051554 Ga0157377_100515542 307
476 3300014968 Ga0157379_10167026 Ga0157379_101670262 307
477 3300014968 Ga0157379_10175535 Ga0157379_101755352 307
478 3300014968 Ga0157379_10579716 Ga0157379_105797161 307
479 3300017792 Ga0163161_10014806 Ga0163161_100148063 307
480 3300017792 Ga0163161_10031371 Ga0163161_100313712 307
481 3300021384 Ga0213876_10000068 Ga0213876_1000006855 307
482 3300021384 Ga0213876_10000094 Ga0213876_1000009423 307
483 3300025223 Ga0207672_1000084 Ga0207672_100008411 307
484 3300025321 Ga0207656_10003148 Ga0207656_100031483 307
485 3300025885 Ga0207653_10000133 Ga0207653_1000013352 307
486 3300025885 Ga0207653_10001368 Ga0207653_100013685 307
487 3300025899 Ga0207642_10039445 Ga0207642_100394451 307
488 3300025900 Ga0207710_10000002 Ga0207710_10000002301 307
489 3300025901 Ga0207688_10069484 Ga0207688_100694842 307
490 3300025901 Ga0207688_10098098 Ga0207688_100980982 307
491 3300025904 Ga0207647_10008624 Ga0207647_100086246 307
492 3300025905 Ga0207685_10000018 Ga0207685_1000001882 307
493 3300025906 Ga0207699_10000135 Ga0207699_1000013525 307
494 3300025907 Ga0207645_10020581 Ga0207645_100205813 307
495 3300025907 Ga0207645_10105724 Ga0207645_101057242 307
496 3300025908 Ga0207643_10005878 Ga0207643_100058789 307
497 3300025910 Ga0207684_10000053 Ga0207684_1000005383 307
498 3300025910 Ga0207684_10000075 Ga0207684_1000007579 307
499 3300025910 Ga0207684_10000175 Ga0207684_1000017581 307
500 3300025910 Ga0207684_10044488 Ga0207684_100444882 307
501 3300025910 Ga0207684_10276287 Ga0207684_102762871 307
502 3300025910 Ga0207684_10287968 Ga0207684_102879681 307
503 3300025910 Ga0207684_10460033 Ga0207684_104600331 307
504 3300025911 Ga0207654_10053857 Ga0207654_100538572 307
505 3300025911 Ga0207654_10300874 Ga0207654_103008741 307
506 3300025912 Ga0207707_10000063 Ga0207707_1000006374 307
507 3300025912 Ga0207707_10143343 Ga0207707_101433432 307
508 3300025912 Ga0207707_10358457 Ga0207707_103584571 307
509 3300025913 Ga0207695_10063425 Ga0207695_100634251 307
510 3300025914 Ga0207671_10002243 Ga0207671_1000224316 307
511 3300025916 Ga0207663_10000001 Ga0207663_1000000141 307
512 3300025917 Ga0207660_10004704 Ga0207660_100047046 307
513 3300025917 Ga0207660_10021218 Ga0207660_100212185 307
514 3300025917 Ga0207660_10060362 Ga0207660_100603622 307
515 3300025917 Ga0207660_10257537 Ga0207660_102575372 307
516 3300025918 Ga0207662_10007338 Ga0207662_100073383 307
517 3300025919 Ga0207657_10074317 Ga0207657_100743173 307
518 3300025921 Ga0207652_10000091 Ga0207652_1000009128 307
519 3300025922 Ga0207646_10000076 Ga0207646_1000007691 307
520 3300025922 Ga0207646_10000900 Ga0207646_1000090016 307
521 3300025922 Ga0207646_10010198 Ga0207646_100101983 307
522 3300025922 Ga0207646_10025394 Ga0207646_100253946 307
523 3300025922 Ga0207646_10159084 Ga0207646_101590842 307
524 3300025922 Ga0207646_10163184 Ga0207646_101631841 307
525 3300025923 Ga0207681_10000966 Ga0207681_1000096615 307
526 3300025923 Ga0207681_10010828 Ga0207681_100108284 307
527 3300025925 Ga0207650_10000007 Ga0207650_10000007288 307
528 3300025925 Ga0207650_10005207 Ga0207650_100052073 307
529 3300025925 Ga0207650_10105768 Ga0207650_101057682 307
530 3300025925 Ga0207650_10107413 Ga0207650_101074132 307
531 3300025928 Ga0207700_10138581 Ga0207700_101385812 307
532 3300025931 Ga0207644_10000636 Ga0207644_1000063621 307
533 3300025933 Ga0207706_10133299 Ga0207706_101332991 307
534 3300025934 Ga0207686_10000003 Ga0207686_10000003262 307
535 3300025934 Ga0207686_10000127 Ga0207686_1000012748 307
536 3300025934 Ga0207686_10001296 Ga0207686_1000129614 307
537 3300025935 Ga0207709_10000017 Ga0207709_10000017321 307
538 3300025935 Ga0207709_10001732 Ga0207709_100017326 307
539 3300025935 Ga0207709_10012319 Ga0207709_100123193 307
540 3300025935 Ga0207709_10211324 Ga0207709_102113241 307
541 3300025935 Ga0207709_10325175 Ga0207709_103251751 307
542 3300025936 Ga0207670_10065483 Ga0207670_100654832 307
543 3300025937 Ga0207669_10181883 Ga0207669_101818831 307
544 3300025938 Ga0207704_10064467 Ga0207704_100644671 307
545 3300025939 Ga0207665_10000002 Ga0207665_10000002180 307
546 3300025939 Ga0207665_10023684 Ga0207665_100236843 307
547 3300025939 Ga0207665_10040686 Ga0207665_100406864 307
548 3300025939 Ga0207665_10043262 Ga0207665_100432622 307
549 3300025939 Ga0207665_10125245 Ga0207665_101252452 307
550 3300025940 Ga0207691_10008051 Ga0207691_100080512 307
551 3300025940 Ga0207691_10072423 Ga0207691_100724231 307
552 3300025941 Ga0207711_10051152 Ga0207711_100511522 307
553 3300025941 Ga0207711_10139558 Ga0207711_101395583 307
554 3300025942 Ga0207689_10004147 Ga0207689_1000414711 307
555 3300025942 Ga0207689_10015886 Ga0207689_100158862 307
556 3300025942 Ga0207689_10197730 Ga0207689_101977301 307
557 3300025942 Ga0207689_10248533 Ga0207689_102485332 307
558 3300025942 Ga0207689_10258583 Ga0207689_102585831 307
559 3300025945 Ga0207679_10070831 Ga0207679_100708312 307
560 3300025945 Ga0207679_10199279 Ga0207679_101992792 307
561 3300025960 Ga0207651_10056474 Ga0207651_100564742 307
562 3300025961 Ga0207712_10000259 Ga0207712_1000025915 307
563 3300025961 Ga0207712_10014084 Ga0207712_100140846 307
564 3300025961 Ga0207712_10050006 Ga0207712_100500062 307
565 3300025972 Ga0207668_10002115 Ga0207668_1000211512 307
566 3300026023 Ga0207677_10070868 Ga0207677_100708682 307
567 3300026023 Ga0207677_10142628 Ga0207677_101426282 307
568 3300026035 Ga0207703_10000158 Ga0207703_1000015840 307
569 3300026035 Ga0207703_10033181 Ga0207703_100331813 307
570 3300026035 Ga0207703_10115494 Ga0207703_101154942 307
571 3300026035 Ga0207703_10139092 Ga0207703_101390921 307
572 3300026035 Ga0207703_10140058 Ga0207703_101400582 307
573 3300026035 Ga0207703_10195785 Ga0207703_101957852 307
574 3300026035 Ga0207703_10269747 Ga0207703_102697471 307
575 3300026035 Ga0207703_10294039 Ga0207703_102940392 307
576 3300026075 Ga0207708_10001411 Ga0207708_100014117 307
577 3300026075 Ga0207708_10024047 Ga0207708_100240477 307
578 3300026075 Ga0207708_10069370 Ga0207708_100693702 307
579 3300026075 Ga0207708_10110412 Ga0207708_101104122 307
580 3300026078 Ga0207702_10041969 Ga0207702_100419691 307
581 3300026088 Ga0207641_10509349 Ga0207641_105093492 307
582 3300026089 Ga0207648_10440568 Ga0207648_104405681 307
583 3300026089 Ga0207648_10534254 Ga0207648_105342541 307
584 3300026095 Ga0207676_10060804 Ga0207676_100608043 307
585 3300026095 Ga0207676_10164944 Ga0207676_101649442 307
586 3300026095 Ga0207676_10271609 Ga0207676_102716091 307
587 3300026116 Ga0207674_10000058 Ga0207674_10000058100 307
588 3300026116 Ga0207674_10041265 Ga0207674_100412651 307
589 3300026116 Ga0207674_10216492 Ga0207674_102164921 307
590 3300026116 Ga0207674_10247125 Ga0207674_102471252 307
591 3300026118 Ga0207675_100018476 Ga0207675_1000184765 307
592 3300026118 Ga0207675_100019567 Ga0207675_1000195676 307
593 3300026118 Ga0207675_100026731 Ga0207675_1000267311 307
594 3300026118 Ga0207675_100063633 Ga0207675_1000636332 307
595 3300026118 Ga0207675_100101016 Ga0207675_1001010163 307
596 3300026118 Ga0207675_100156763 Ga0207675_1001567632 307
597 3300026121 Ga0207683_10056980 Ga0207683_100569802 307
598 3300026121 Ga0207683_10149236 Ga0207683_101492362 307
599 3300026142 Ga0207698_10090003 Ga0207698_100900034 307
600 3300026142 Ga0207698_10136274 Ga0207698_101362741 307
601 3300027907 Ga0207428_10007052 Ga0207428_100070523 307
602 3300027907 Ga0207428_10030203 Ga0207428_100302032 307
603 3300027907 Ga0207428_10068043 Ga0207428_100680432 307
604 3300028380 Ga0268265_10043384 Ga0268265_100433843 307
605 3300028381 Ga0268264_10009644 Ga0268264_100096449 307
606 3300028381 Ga0268264_10054523 Ga0268264_100545231 307
607 3300028381 Ga0268264_10382992 Ga0268264_103829921 307
608 3300031548 Ga0307408_100087903 Ga0307408_1000879031 307
609 3300031548 Ga0307408_100268235 Ga0307408_1002682351 307
610 3300031731 Ga0307405_10009530 Ga0307405_100095307 307
611 3300031731 Ga0307405_10051723 Ga0307405_100517232 307
612 3300031733 Ga0316577_10014294 Ga0316577_100142943 307
613 3300031733 Ga0316577_10070805 Ga0316577_100708053 307
614 3300031852 Ga0307410_10006757 Ga0307410_100067571 307
615 3300031852 Ga0307410_10079440 Ga0307410_100794402 307
616 3300031901 Ga0307406_10001697 Ga0307406_100016974 307
617 3300031903 Ga0307407_10018518 Ga0307407_100185183 307
618 3300031911 Ga0307412_10008182 Ga0307412_100081822 307
619 3300031911 Ga0307412_10010460 Ga0307412_100104602 307
620 3300031995 Ga0307409_100038578 Ga0307409_1000385782 307
621 3300032002 Ga0307416_100012028 Ga0307416_1000120284 307
622 3300032002 Ga0307416_100244694 Ga0307416_1002446941 307
623 3300032002 Ga0307416_100456675 Ga0307416_1004566751 307
624 3300032004 Ga0307414_10003043 Ga0307414_100030432 307
625 3300032126 Ga0307415_100044997 Ga0307415_1000449972 307
626 3300036712 Ga0316584_0222976 Ga0316584_0222976_153_1118 307
627 3300037418 Ga0395900_0072279 Ga0395900_0072279_1182_2144 307
628 3300037471 Ga0395905_0003272 Ga0395905_0003272_3757_4713 307
629 3300037471 Ga0395905_0118981 Ga0395905_0118981_1331_2290 307
630 3300037588 Ga0316581_0040790 Ga0316581_0040790_105_1082 307
631 3300038443 Ga0395901_0223438 Ga0395901_0223438_887_1846 307
632 3300038443 Ga0395901_0492305 Ga0395901_0492305_235_1203 307
633 3300039437 Ga0436365_0289912 Ga0436365_0289912_277922_278878 307
634 3300039437 Ga0436365_0762848 Ga0436365_0762848_492_1448 307
635 3300039437 Ga0436365_1855834 Ga0436365_1855834_66815_67771 307
636 3300042876 Ga0451577_0244069 Ga0451577_0244069_272_1234 307
637 3300044673 Ga0453683_0035457 Ga0453683_0035457_128_1090 307
638 3300044712 Ga0453684_0106606 Ga0453684_0106606_1835_2797 307
639 3300044712 Ga0453684_0514922 Ga0453684_0514922_170_1123 307
640 3300045051 Ga0451576_0009797 Ga0451576_0009797_7919_8881 307
641 3300045051 Ga0451576_0317466 Ga0451576_0317466_55_1023 307
642 3300046525 Ga0495663_0000141 Ga0495663_0000141_24046_25008 307
643 3300046539 Ga0495621_0000577 Ga0495621_0000577_7665_8627 307
644 3300046539 Ga0495621_0024228 Ga0495621_0024228_12_989 307
645 3300046539 Ga0495621_0071521 Ga0495621_0071521_101_1063 307
646 3300046691 Ga0495670_0083029 Ga0495670_0083029_355_1317 307
647 3300047322 Ga0495680_0265660 Ga0495680_0265660_44_1006 307
648 3300048907 Ga0496104_0088689 Ga0496104_0088689_80_1042 307
649 3300048907 Ga0496104_0217274 Ga0496104_0217274_626_1585 307
650 3300048909 Ga0496106_0000699 Ga0496106_0000699_2996_3958 307
651 3300048909 Ga0496106_0351967 Ga0496106_0351967_100_1062 307
652 3300048912 Ga0496109_0000068 Ga0496109_0000068_40043_40966 307
653 3300048916 Ga0496113_0310197 Ga0496113_0310197_133_1095 307
654 3300049514 Ga0501291_007196 Ga0501291_007196_432_1391 307
655 3300049574 Ga0501038_0007479 Ga0501038_0007479_3086_4045 307
656 3300049577 Ga0501041_0276930 Ga0501041_0276930_50_979 307
657 3300049580 Ga0501046_0270341 Ga0501046_0270341_167_1090 307
658 3300049591 Ga0501075_0246789 Ga0501075_0246789_152_1081 307
659 3300049652 Ga0501202_000926 Ga0501202_000926_551_1483 307
660 3300049660 Ga0501216_002105 Ga0501216_002105_150_1109 307
661 3300049661 Ga0501217_007572 Ga0501217_007572_115_1074 307
662 3300049663 Ga0501223_019820 Ga0501223_019820_298_1260 307
663 3300049663 Ga0501223_020264 Ga0501223_020264_241_1200 307
664 3300049664 Ga0501224_001637 Ga0501224_001637_911_1843 307
665 3300049679 Ga0501249_023683 Ga0501249_023683_166_1125 307
666 3300049705 Ga0501225_0003414 Ga0501225_0003414_730_1689 307
667 3300049705 Ga0501225_0005625 Ga0501225_0005625_979_1911 307
668 3300049743 Ga0501081_0313987 Ga0501081_0313987_140_1069 307
669 3300049851 Ga0501212_003908 Ga0501212_003908_815_1801 307
670 3300050507 nmdc:mga05p37_100796_c1 nmdc:mga05p37_100796_c1_1810_2769 307
671 3300050507 nmdc:mga05p37_13047_c1 nmdc:mga05p37_13047_c1_7207_8166 307
672 3300050507 nmdc:mga05p37_1311_c1 nmdc:mga05p37_1311_c1_17885_18847 307
673 3300050507 nmdc:mga05p37_143270_c1 nmdc:mga05p37_143270_c1_808_1767 307
674 3300050507 nmdc:mga05p37_149278_c1 nmdc:mga05p37_149278_c1_974_1933 307
675 3300050507 nmdc:mga05p37_65024_c1 nmdc:mga05p37_65024_c1_654_1649 307
676 3300050508 nmdc:mga09592_118109_c1 nmdc:mga09592_118109_c1_328_1308 307
677 3300050509 nmdc:mga0qj67_330481_c1 nmdc:mga0qj67_330481_c1_43_1023 307
678 3300050511 nmdc:mga08y16_172186_c1 nmdc:mga08y16_172186_c1_381_1310 307
679 3300050511 nmdc:mga08y16_274777_c1 nmdc:mga08y16_274777_c1_755_1678 307
680 3300050511 nmdc:mga08y16_304335_c1 nmdc:mga08y16_304335_c1_252_1175 307
681 3300050511 nmdc:mga08y16_8851_c1 nmdc:mga08y16_8851_c1_7013_7981 307
682 3300050512 nmdc:mga0n895_105790_c1 nmdc:mga0n895_105790_c1_10_933 307
683 3300050512 nmdc:mga0n895_145682_c1 nmdc:mga0n895_145682_c1_547_1509 307
684 3300050513 nmdc:mga0rr50_3567_c1 nmdc:mga0rr50_3567_c1_4242_5204 307
685 3300050513 nmdc:mga0rr50_61526_c1 nmdc:mga0rr50_61526_c1_1747_2709 307
686 3300050514 nmdc:mga08x19_165449_c1 nmdc:mga08x19_165449_c1_255_1193 307
687 3300050514 nmdc:mga08x19_3501_c1 nmdc:mga08x19_3501_c1_5176_6171 307
688 3300050514 nmdc:mga08x19_63905_c1 nmdc:mga08x19_63905_c1_1111_2073 307
689 3300050514 nmdc:mga08x19_78771_c1 nmdc:mga08x19_78771_c1_20_982 307
690 3300050514 nmdc:mga08x19_7_c1 nmdc:mga08x19_7_c1_317272_318234 307
691 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_390264_391226 307
692 3300050515 nmdc:mga0a205_17483_c2 nmdc:mga0a205_17483_c2_1237_2199 307
693 3300050515 nmdc:mga0a205_183634_c1 nmdc:mga0a205_183634_c1_743_1705 307
694 3300050515 nmdc:mga0a205_296833_c1 nmdc:mga0a205_296833_c1_21_989 307
695 3300050515 nmdc:mga0a205_383514_c1 nmdc:mga0a205_383514_c1_155_1117 307
696 3300050515 nmdc:mga0a205_39448_c1 nmdc:mga0a205_39448_c1_382_1344 307
697 3300053083 Ga0495655_0001853 Ga0495655_0001853_231_1193 307
698 3300053096 Ga0500641_0150771 Ga0500641_0150771_41_964 307
699 3300054114 Ga0501084_0319581 Ga0501084_0319581_125_1054 307
700 iso_pu_bacteria 2523533628 2524003480 307
701 iso_pu_bacteria 2857460504 2857460840 307
702 iso_pu_bacteria 2857465823 2857471170 307
703 iso_pu_bacteria 2857591370 2857595505 307
704 iso_pu_bacteria 2898907183 2898907868 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

56

164

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

176

355

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.947 9 307
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9464 10 307
2yye-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.9459 9 307
2zau-assembly1.cif.gz_C-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9455 11 307
2zod-assembly1.cif.gz_B crystal structure of selenophosphate synthetase from aquifex aeolicus 0.9444 12 305
ID Description Score Start End Superfamily
2yyeA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9556 9 115 3.30.1330.10
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9514 3 121 3.30.1330.10
3u0oB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9492 3 117 3.30.1330.10
2zauB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9285 10 115 3.30.1330.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9248 124 307 3.90.650.10
ID Description Score Start End GO Terms
AF-A0A7W1BZZ3-F1-model_v4 Selenide, water dikinase SelD (EC 2.7.9.3) 0.9886 1 219 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A7C3HQ18-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9829 3 226 GO:0005524
GO:0016226
GO:0016301
GO:0031071
GO:0046872
GO:0051536
AF-A0A7C3F926-F1-model_v4 Selenide, water dikinase SelD (EC 2.7.9.3) 0.9806 33 307 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A660VM40-F1-model_v4 Selenide, water dikinase SelD (EC 2.7.9.3) 0.9799 1 307 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A7V6JV69-F1-model_v4 Selenide, water dikinase (EC 2.7.9.3) (Selenium donor protein) (Selenophosphate synthase) 0.9793 3 307 GO:0000287
GO:0004756
GO:0005524
GO:0005737
GO:0016260

Feature Viewer

pLDDT pTM Quality
96.27 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map