F476265

General Info

Members Datasets Scaffolds Average Seq Length
703 282 1406 182

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10670241|Ga0075365_106702411
Length 203
Sequence VAGIKSDRWIRQMALEHGMIEPFEDRQVREGVVSYGLSSYGYDIRVSDEFKIFTNINNTVIDPKSFDPRSFVDVKADVCIVPPNSFALAHTIEYFRIPRDILTICLGKSTYARCGIIVNVTPFEPEWEGTVTLEISNTTPLPAKIYANEGIAQVLFFQGDEPCEVSYADKKGKYLKQRVCSSASSGTKEPLYRRKEPATPWGA

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
193 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 1.99
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10670241 3300006038 Bacteria 733
2 JGI24751J29686_10023919 3300002459 Bacteria 1266
3 Ga0065704_10178713 3300005289 Bacteria 1249
4 Ga0065704_10348259 3300005289 Bacteria 813
5 Ga0065704_10368055 3300005289 Bacteria 789
6 Ga0065712_10011491 3300005290 Bacteria 2415
7 Ga0065712_10070887 3300005290 Bacteria 5627
8 Ga0065712_10089047 3300005290 Bacteria 2489
9 Ga0065712_10099667 3300005290 Bacteria 2084
10 Ga0065712_10173755 3300005290 Bacteria 1229
11 Ga0065712_10178324 3300005290 Bacteria 1206
12 Ga0065712_10224638 3300005290 Bacteria 1030
13 Ga0065712_10293429 3300005290 Bacteria 873
14 Ga0065712_10404645 3300005290 Bacteria 727
15 Ga0065712_10446080 3300005290 Bacteria 690
16 Ga0065715_10010997 3300005293 Bacteria 2509
17 Ga0065715_10012178 3300005293 Bacteria 2012
18 Ga0065715_10039862 3300005293 Bacteria 1643
19 Ga0065715_10098529 3300005293 Bacteria 3535
20 Ga0065715_10107521 3300005293 Bacteria 2767
21 Ga0065715_10150939 3300005293 Bacteria 1730
22 Ga0065715_10163689 3300005293 Bacteria 1605
23 Ga0065715_10212774 3300005293 Bacteria 1307
24 Ga0065715_10218123 3300005293 Bacteria 1284
25 Ga0065715_10307137 3300005293 Bacteria 1028
26 Ga0065715_10315097 3300005293 Bacteria 1013
27 Ga0065715_10572322 3300005293 Bacteria 726
28 Ga0065707_10046871 3300005295 Bacteria 993
29 Ga0065707_10085305 3300005295 Bacteria 6269
30 Ga0065707_10096051 3300005295 Bacteria 3308
31 Ga0065707_10147528 3300005295 Bacteria 1696
32 Ga0065707_10199108 3300005295 Bacteria 1320
33 Ga0065707_10269147 3300005295 Bacteria 1076
34 Ga0065707_10290350 3300005295 Bacteria 1026
35 Ga0065707_10365118 3300005295 Bacteria 898
36 Ga0065707_10431676 3300005295 Bacteria 819
37 Ga0065707_10448678 3300005295 Bacteria 803
38 Ga0070658_10283172 3300005327 Bacteria 1411
39 Ga0070676_10011008 3300005328 Bacteria 4914
40 Ga0070676_10060762 3300005328 Bacteria 2245
41 Ga0070676_10325239 3300005328 Bacteria 1050
42 Ga0070683_100586059 3300005329 Bacteria 1067
43 Ga0070683_101293952 3300005329 Bacteria 701
44 Ga0070670_100027351 3300005331 Bacteria 4906
45 Ga0070670_100052037 3300005331 Bacteria 3517
46 Ga0070670_100206868 3300005331 Bacteria 1706
47 Ga0070670_100535737 3300005331 Bacteria 1043
48 Ga0070677_10092566 3300005333 Bacteria 1318
49 Ga0068869_100041538 3300005334 Bacteria 3294
50 Ga0068869_100328723 3300005334 Bacteria 1242
51 Ga0068869_100925239 3300005334 Bacteria 756
52 Ga0070666_10187181 3300005335 Bacteria 1454
53 Ga0070680_101022028 3300005336 Bacteria 714
54 Ga0070682_100216755 3300005337 Bacteria 1360
55 Ga0068868_100086718 3300005338 Bacteria 2517
56 Ga0068868_100256290 3300005338 Bacteria 1474
57 Ga0068868_100516727 3300005338 Bacteria 1048
58 Ga0068868_101415811 3300005338 Bacteria 649
59 Ga0070660_100018917 3300005339 Bacteria 5042
60 Ga0070660_100190580 3300005339 Bacteria 1661
61 Ga0070689_100050511 3300005340 Bacteria 3213
62 Ga0070689_100137239 3300005340 Bacteria 1965
63 Ga0070689_100283073 3300005340 Bacteria 1376
64 Ga0070689_100984273 3300005340 Bacteria 750
65 Ga0070687_100041858 3300005343 Bacteria 2318
66 Ga0070661_100105659 3300005344 Bacteria 2099
67 Ga0070661_100610454 3300005344 Bacteria 883
68 Ga0070661_100653202 3300005344 Bacteria 854
69 Ga0070692_10462033 3300005345 Bacteria 815
70 Ga0070668_100022182 3300005347 Bacteria 4800
71 Ga0070668_100161101 3300005347 Bacteria 1821
72 Ga0070669_100320265 3300005353 Bacteria 1252
73 Ga0070675_100209320 3300005354 Bacteria 1695
74 Ga0070675_100307494 3300005354 Bacteria 1398
75 Ga0070675_100353231 3300005354 Bacteria 1304
76 Ga0070671_100093758 3300005355 Bacteria 2516
77 Ga0070671_101282593 3300005355 Bacteria 646
78 Ga0070674_100014528 3300005356 Bacteria 4896
79 Ga0070674_100023422 3300005356 Bacteria 3997
80 Ga0070674_100086162 3300005356 Bacteria 2256
81 Ga0070674_100086490 3300005356 Bacteria 2252
82 Ga0070674_100088683 3300005356 Bacteria 2227
83 Ga0070674_100094063 3300005356 Bacteria 2170
84 Ga0070673_100035863 3300005364 Bacteria 3765
85 Ga0070673_100342727 3300005364 Bacteria 1325
86 Ga0070673_100448272 3300005364 Bacteria 1161
87 Ga0070688_100030223 3300005365 Bacteria 3250
88 Ga0070688_100056716 3300005365 Bacteria 2460
89 Ga0070659_100379825 3300005366 Bacteria 1190
90 Ga0070667_100044527 3300005367 Bacteria 3728
91 Ga0070667_100599548 3300005367 Bacteria 1015
92 Ga0070713_100003643 3300005436 Bacteria 10193
93 Ga0070701_10016432 3300005438 Bacteria 3441
94 Ga0070701_10030874 3300005438 Bacteria 2654
95 Ga0070701_10251637 3300005438 Bacteria 1067
96 Ga0070705_100038938 3300005440 Bacteria 2694
97 Ga0070705_100521766 3300005440 Bacteria 905
98 Ga0070700_100269846 3300005441 Bacteria 1229
99 Ga0070700_100586152 3300005441 Bacteria 871
100 Ga0070694_100008007 3300005444 Bacteria 6458
101 Ga0070694_100017695 3300005444 Bacteria 4505
102 Ga0070694_100159265 3300005444 Bacteria 1655
103 Ga0070663_100149336 3300005455 Bacteria 1791
104 Ga0070678_100009162 3300005456 Bacteria 5979
105 Ga0070678_100538847 3300005456 Bacteria 1035
106 Ga0070662_100470786 3300005457 Bacteria 1045
107 Ga0068867_100012999 3300005459 Bacteria 5891
108 Ga0068867_100231275 3300005459 Bacteria 1494
109 Ga0068867_100610155 3300005459 Bacteria 953
110 Ga0068867_100641272 3300005459 Bacteria 931
111 Ga0070685_10217255 3300005466 Bacteria 1251
112 Ga0070707_100016942 3300005468 Bacteria 6845
113 Ga0070707_100243323 3300005468 Bacteria 1751
114 Ga0070707_100547414 3300005468 Bacteria 1119
115 Ga0070707_100646551 3300005468 Bacteria 1020
116 Ga0070707_101027263 3300005468 Bacteria 790
117 Ga0070698_100018978 3300005471 Bacteria 7233
118 Ga0070698_100051643 3300005471 Bacteria 4187
119 Ga0070698_100162917 3300005471 Bacteria 2174
120 Ga0070699_100066431 3300005518 Bacteria 3131
121 Ga0070699_100290144 3300005518 Bacteria 1467
122 Ga0070679_100016517 3300005530 Bacteria 7125
123 Ga0070679_100247685 3300005530 Bacteria 1738
124 Ga0070684_100081768 3300005535 Bacteria 2859
125 Ga0070684_100156461 3300005535 Bacteria 2067
126 Ga0070684_100828251 3300005535 Bacteria 866
127 Ga0070697_100247904 3300005536 Bacteria 1523
128 Ga0070672_100002598 3300005543 Bacteria 11535
129 Ga0070672_100163736 3300005543 Bacteria 1847
130 Ga0070672_100177872 3300005543 Bacteria 1772
131 Ga0070672_100218803 3300005543 Bacteria 1597
132 Ga0070672_100861980 3300005543 Bacteria 799
133 Ga0070695_100006738 3300005545 Bacteria 6799
134 Ga0070695_100086402 3300005545 Bacteria 2084
135 Ga0070695_100258357 3300005545 Bacteria 1271
136 Ga0070695_100345885 3300005545 Bacteria 1113
137 Ga0070695_100976571 3300005545 Bacteria 688
138 Ga0070696_100161162 3300005546 Bacteria 1653
139 Ga0070696_100218888 3300005546 Bacteria 1428
140 Ga0070696_100264358 3300005546 Bacteria 1306
141 Ga0070696_100375508 3300005546 Bacteria 1107
142 Ga0070696_100465577 3300005546 Bacteria 1000
143 Ga0070693_100193863 3300005547 Bacteria 1316
144 Ga0070665_100102380 3300005548 Bacteria 2867
145 Ga0070704_100055278 3300005549 Bacteria 2813
146 Ga0070704_100139858 3300005549 Bacteria 1888
147 Ga0070704_100196367 3300005549 Bacteria 1626
148 Ga0070704_100397835 3300005549 Bacteria 1175
149 Ga0070704_100985659 3300005549 Bacteria 762
150 Ga0068855_100088631 3300005563 Bacteria 3574
151 Ga0070664_100088878 3300005564 Bacteria 2672
152 Ga0070664_100285462 3300005564 Bacteria 1489
153 Ga0070664_100428233 3300005564 Bacteria 1213
154 Ga0068857_100850730 3300005577 Bacteria 873
155 Ga0068854_100037831 3300005578 Bacteria 3389
156 Ga0068854_100556684 3300005578 Bacteria 973
157 Ga0070702_100041699 3300005615 Bacteria 2576
158 Ga0068852_100083669 3300005616 Bacteria 2838
159 Ga0068852_100313360 3300005616 Bacteria 1522
160 Ga0068859_100053081 3300005617 Bacteria 4076
161 Ga0068859_100319117 3300005617 Bacteria 1647
162 Ga0068859_100326709 3300005617 Bacteria 1628
163 Ga0068859_100447581 3300005617 Bacteria 1388
164 Ga0068864_100010173 3300005618 Bacteria 7766
165 Ga0068864_100324080 3300005618 Bacteria 1447
166 Ga0068864_100566188 3300005618 Bacteria 1100
167 Ga0068864_100580745 3300005618 Bacteria 1086
168 Ga0068866_10076011 3300005718 Bacteria 1790
169 Ga0068861_100010150 3300005719 Bacteria 6531
170 Ga0068863_100456389 3300005841 Bacteria 1255
171 Ga0068863_100672552 3300005841 Bacteria 1028
172 Ga0068858_100006437 3300005842 Bacteria 11436
173 Ga0068858_100153792 3300005842 Bacteria 2164
174 Ga0068858_100496473 3300005842 Bacteria 1179
175 Ga0068858_100534384 3300005842 Bacteria 1134
176 Ga0068858_100707482 3300005842 Bacteria 980
177 Ga0068860_100025065 3300005843 Bacteria 5757
178 Ga0068860_100120521 3300005843 Bacteria 2512
179 Ga0068862_100120841 3300005844 Bacteria 2309
180 Ga0068862_100165510 3300005844 Bacteria 1976
181 Ga0081455_10086861 3300005937 Bacteria 2547
182 Ga0070717_10031295 3300006028 Bacteria 4279
183 Ga0075365_10080806 3300006038 Bacteria 2201
184 Ga0075363_100000184 3300006048 Bacteria 16571
185 Ga0075364_10000216 3300006051 Bacteria 27251
186 Ga0075364_10063064 3300006051 Bacteria 2433
187 Ga0075364_10075516 3300006051 Bacteria 2224
188 Ga0070715_10396564 3300006163 Bacteria 766
189 Ga0075367_10026515 3300006178 Bacteria 3287
190 Ga0075367_10048517 3300006178 Bacteria 2502
191 Ga0075366_10025419 3300006195 Bacteria 3459
192 Ga0075366_10091578 3300006195 Bacteria 1821
193 Ga0075366_10185417 3300006195 Bacteria 1264
194 Ga0097621_100145958 3300006237 Bacteria 2026
195 Ga0075370_10001078 3300006353 Bacteria 11348
196 Ga0075370_10004898 3300006353 Bacteria 6574
197 Ga0068871_100125192 3300006358 Bacteria 2175
198 Ga0068871_100289913 3300006358 Bacteria 1434
199 Ga0068871_100837714 3300006358 Bacteria 850
200 Ga0068871_101580144 3300006358 Bacteria 621
201 Ga0075428_100000108 3300006844 Bacteria 70319
202 Ga0075428_100050041 3300006844 Bacteria 4583
203 Ga0075428_100081295 3300006844 Bacteria 3536
204 Ga0075428_100649919 3300006844 Bacteria 1125
205 Ga0075431_100014832 3300006847 Bacteria 7889
206 Ga0075431_100046036 3300006847 Bacteria 4497
207 Ga0075431_100133204 3300006847 Bacteria 2563
208 Ga0075431_100164766 3300006847 Bacteria 2279
209 Ga0075433_10048617 3300006852 Bacteria 3689
210 Ga0075433_10136726 3300006852 Bacteria 2178
211 Ga0075433_10169331 3300006852 Bacteria 1944
212 Ga0075433_10186696 3300006852 Bacteria 1844
213 Ga0075433_10193776 3300006852 Bacteria 1808
214 Ga0075433_10399007 3300006852 Bacteria 1213
215 Ga0075433_10414739 3300006852 Bacteria 1188
216 Ga0075434_100006295 3300006871 Bacteria 10878
217 Ga0075434_100125622 3300006871 Bacteria 2582
218 Ga0075434_100190218 3300006871 Bacteria 2073
219 Ga0075434_100279545 3300006871 Bacteria 1689
220 Ga0075434_100621054 3300006871 Bacteria 1100
221 Ga0075434_100878792 3300006871 Bacteria 911
222 Ga0075429_100113290 3300006880 Bacteria 2371
223 Ga0068865_100253477 3300006881 Bacteria 1390
224 Ga0068865_100410102 3300006881 Bacteria 1112
225 Ga0075436_100046415 3300006914 Bacteria 2995
226 Ga0075436_100088335 3300006914 Bacteria 2153
227 Ga0075436_100139869 3300006914 Bacteria 1701
228 Ga0097620_100053081 3300006931 Bacteria 4076
229 Ga0097620_100319127 3300006931 Bacteria 1647
230 Ga0097620_100326749 3300006931 Bacteria 1628
231 Ga0097620_100447583 3300006931 Bacteria 1388
232 Ga0075435_100006980 3300007076 Bacteria 8018
233 Ga0075435_100009659 3300007076 Bacteria 7004
234 Ga0075435_100457038 3300007076 Bacteria 1101
235 Ga0075435_100544531 3300007076 Bacteria 1005
236 Ga0099795_10277225 3300007788 Bacteria 731
237 Ga0105251_10394954 3300009011 Bacteria 635
238 Ga0105244_10376414 3300009036 Bacteria 654
239 Ga0105240_10094372 3300009093 Bacteria 3650
240 Ga0111539_10000001 3300009094 Bacteria 1035431
241 Ga0111539_10002263 3300009094 Bacteria 25652
242 Ga0111539_10022709 3300009094 Bacteria 7706
243 Ga0111539_10028916 3300009094 Bacteria 6758
244 Ga0111539_10032649 3300009094 Bacteria 6321
245 Ga0111539_10147557 3300009094 Bacteria 2754
246 Ga0111539_10378748 3300009094 Bacteria 1647
247 Ga0111539_10590656 3300009094 Bacteria 1293
248 Ga0111539_10962548 3300009094 Bacteria 992
249 Ga0105245_10074485 3300009098 Bacteria 3089
250 Ga0105247_10056455 3300009101 Bacteria 2425
251 Ga0105247_10140003 3300009101 Bacteria 1584
252 Ga0114129_10000174 3300009147 Bacteria 70648
253 Ga0114129_10023013 3300009147 Bacteria 8841
254 Ga0114129_10068327 3300009147 Bacteria 4955
255 Ga0114129_10256497 3300009147 Bacteria 2346
256 Ga0114129_10749334 3300009147 Bacteria 1250
257 Ga0105243_10062383 3300009148 Bacteria 2984
258 Ga0105243_10227763 3300009148 Bacteria 1652
259 Ga0105243_10964766 3300009148 Bacteria 853
260 Ga0105248_10020179 3300009177 Bacteria 7383
261 Ga0105248_10078331 3300009177 Bacteria 3715
262 Ga0105248_10175058 3300009177 Bacteria 2419
263 Ga0105248_10184460 3300009177 Bacteria 2351
264 Ga0105248_10444226 3300009177 Bacteria 1461
265 Ga0105248_10624040 3300009177 Bacteria 1216
266 Ga0105249_10069913 3300009553 Bacteria 3241
267 Ga0105249_10134901 3300009553 Bacteria 2361
268 Ga0105249_10441537 3300009553 Bacteria 1339
269 Ga0105249_10802809 3300009553 Bacteria 1005
270 Ga0105249_10899031 3300009553 Bacteria 952
271 Ga0105249_11466012 3300009553 Bacteria 755
272 Ga0105239_10984595 3300010375 Bacteria 969
273 Ga0157343_1019654 3300012488 Bacteria 601
274 Ga0157373_11113291 3300013100 Bacteria 593
275 Ga0157370_10348531 3300013104 Bacteria 1365
276 Ga0157369_10847820 3300013105 Bacteria 938
277 Ga0157374_10226196 3300013296 Bacteria 1837
278 Ga0157374_10591186 3300013296 Bacteria 1119
279 Ga0163162_10068321 3300013306 Bacteria 3605
280 Ga0157372_10690490 3300013307 Bacteria 1188
281 Ga0157375_10522200 3300013308 Bacteria 1350
282 Ga0157375_11135211 3300013308 Bacteria 915
283 Ga0163163_10044160 3300014325 Bacteria 4371
284 Ga0163163_10379000 3300014325 Bacteria 1472
285 Ga0157380_10120703 3300014326 Bacteria 2220
286 Ga0157380_10379721 3300014326 Bacteria 1333
287 Ga0157380_10395136 3300014326 Bacteria 1310
288 Ga0157380_10407060 3300014326 Bacteria 1293
289 Ga0157379_10035068 3300014968 Bacteria 4472
290 Ga0157379_10232534 3300014968 Bacteria 1671
291 Ga0157376_10036646 3300014969 Bacteria 3975
292 Ga0157376_10223213 3300014969 Bacteria 1746
293 Ga0207697_10002088 3300025315 Bacteria 10513
294 Ga0207656_10108215 3300025321 Bacteria 1282
295 Ga0207682_10037726 3300025893 Bacteria 1959
296 Ga0207642_10325313 3300025899 Bacteria 899
297 Ga0207710_10054032 3300025900 Bacteria 1808
298 Ga0207710_10128898 3300025900 Bacteria 1214
299 Ga0207680_10123921 3300025903 Bacteria 1694
300 Ga0207680_10363512 3300025903 Bacteria 1018
301 Ga0207645_10027068 3300025907 Bacteria 3705
302 Ga0207645_10217065 3300025907 Bacteria 1260
303 Ga0207643_10166632 3300025908 Bacteria 1328
304 Ga0207643_10355552 3300025908 Bacteria 920
305 Ga0207684_10307023 3300025910 Bacteria 1368
306 Ga0207654_10246171 3300025911 Bacteria 1197
307 Ga0207695_10072016 3300025913 Bacteria 3528
308 Ga0207660_10213304 3300025917 Bacteria 1512
309 Ga0207662_10069768 3300025918 Bacteria 2124
310 Ga0207662_10312170 3300025918 Bacteria 1048
311 Ga0207657_10066571 3300025919 Bacteria 3066
312 Ga0207652_10002486 3300025921 Bacteria 15519
313 Ga0207652_10040793 3300025921 Bacteria 3943
314 Ga0207652_10207430 3300025921 Bacteria 1764
315 Ga0207646_10032977 3300025922 Bacteria 4685
316 Ga0207646_10049267 3300025922 Bacteria 3774
317 Ga0207646_10140996 3300025922 Bacteria 2171
318 Ga0207646_10818939 3300025922 Bacteria 829
319 Ga0207681_10075708 3300025923 Bacteria 2361
320 Ga0207681_10747432 3300025923 Bacteria 815
321 Ga0207650_10417775 3300025925 Bacteria 1112
322 Ga0207650_10522149 3300025925 Bacteria 994
323 Ga0207650_10732580 3300025925 Bacteria 836
324 Ga0207650_11393106 3300025925 Bacteria 596
325 Ga0207659_10202719 3300025926 Bacteria 1585
326 Ga0207659_10236161 3300025926 Bacteria 1477
327 Ga0207659_10445095 3300025926 Bacteria 1090
328 Ga0207659_10675635 3300025926 Bacteria 883
329 Ga0207659_11122182 3300025926 Bacteria 676
330 Ga0207700_10024321 3300025928 Bacteria 4191
331 Ga0207644_10099738 3300025931 Bacteria 2180
332 Ga0207644_11210992 3300025931 Bacteria 635
333 Ga0207690_10057603 3300025932 Bacteria 2625
334 Ga0207690_10208924 3300025932 Bacteria 1487
335 Ga0207686_10003681 3300025934 Bacteria 8215
336 Ga0207709_10004342 3300025935 Bacteria 8205
337 Ga0207670_10303832 3300025936 Bacteria 1250
338 Ga0207670_10329178 3300025936 Bacteria 1204
339 Ga0207669_10019186 3300025937 Bacteria 3554
340 Ga0207669_10035699 3300025937 Bacteria 2832
341 Ga0207669_10039512 3300025937 Bacteria 2728
342 Ga0207669_10061165 3300025937 Bacteria 2313
343 Ga0207669_10246259 3300025937 Bacteria 1328
344 Ga0207669_10977338 3300025937 Bacteria 710
345 Ga0207704_10367735 3300025938 Bacteria 1125
346 Ga0207665_10269420 3300025939 Bacteria 1264
347 Ga0207691_10013925 3300025940 Bacteria 7673
348 Ga0207691_10214776 3300025940 Bacteria 1670
349 Ga0207691_10217480 3300025940 Bacteria 1658
350 Ga0207691_10562844 3300025940 Bacteria 966
351 Ga0207711_10012271 3300025941 Bacteria 7124
352 Ga0207711_10070774 3300025941 Bacteria 3025
353 Ga0207711_10211872 3300025941 Bacteria 1770
354 Ga0207711_10374969 3300025941 Bacteria 1320
355 Ga0207711_10396217 3300025941 Bacteria 1282
356 Ga0207711_10402248 3300025941 Bacteria 1272
357 Ga0207711_10754183 3300025941 Bacteria 907
358 Ga0207689_10078486 3300025942 Bacteria 2713
359 Ga0207689_10317453 3300025942 Bacteria 1293
360 Ga0207661_10401470 3300025944 Bacteria 1243
361 Ga0207679_10133289 3300025945 Bacteria 1996
362 Ga0207679_10382299 3300025945 Bacteria 1234
363 Ga0207679_10533780 3300025945 Bacteria 1051
364 Ga0207667_11246325 3300025949 Bacteria 722
365 Ga0207651_10005977 3300025960 Bacteria 6307
366 Ga0207651_10045441 3300025960 Bacteria 2946
367 Ga0207651_10352574 3300025960 Bacteria 1239
368 Ga0207651_10441198 3300025960 Bacteria 1115
369 Ga0207712_10080155 3300025961 Bacteria 2374
370 Ga0207712_10107400 3300025961 Bacteria 2087
371 Ga0207712_10171282 3300025961 Bacteria 1697
372 Ga0207712_10189580 3300025961 Bacteria 1622
373 Ga0207712_10506077 3300025961 Bacteria 1033
374 Ga0207668_10019227 3300025972 Bacteria 4313
375 Ga0207668_10105912 3300025972 Bacteria 2100
376 Ga0207668_10356365 3300025972 Bacteria 1225
377 Ga0207668_10432301 3300025972 Bacteria 1120
378 Ga0207640_10093769 3300025981 Bacteria 2086
379 Ga0207640_10340039 3300025981 Bacteria 1202
380 Ga0207677_10255847 3300026023 Bacteria 1425
381 Ga0207677_10366528 3300026023 Bacteria 1212
382 Ga0207677_10496484 3300026023 Bacteria 1054
383 Ga0207703_10016106 3300026035 Bacteria 5829
384 Ga0207703_11237577 3300026035 Bacteria 718
385 Ga0207678_10122882 3300026067 Bacteria 2215
386 Ga0207678_10131956 3300026067 Bacteria 2131
387 Ga0207708_10004690 3300026075 Bacteria 10054
388 Ga0207708_10004696 3300026075 Bacteria 10049
389 Ga0207708_10287032 3300026075 Bacteria 1335
390 Ga0207702_10569383 3300026078 Bacteria 1109
391 Ga0207641_10081749 3300026088 Bacteria 2806
392 Ga0207641_10487931 3300026088 Bacteria 1195
393 Ga0207648_10018612 3300026089 Bacteria 6284
394 Ga0207648_10123098 3300026089 Bacteria 2281
395 Ga0207648_10243869 3300026089 Bacteria 1600
396 Ga0207648_10348227 3300026089 Bacteria 1335
397 Ga0207648_10378542 3300026089 Bacteria 1280
398 Ga0207676_10015116 3300026095 Bacteria 5566
399 Ga0207676_10073193 3300026095 Bacteria 2757
400 Ga0207676_10133403 3300026095 Bacteria 2115
401 Ga0207676_10632358 3300026095 Bacteria 1031
402 Ga0207674_10829493 3300026116 Bacteria 892
403 Ga0207675_100022777 3300026118 Bacteria 5829
404 Ga0207675_100202763 3300026118 Bacteria 1905
405 Ga0207675_100486179 3300026118 Bacteria 1227
406 Ga0207675_100600587 3300026118 Bacteria 1103
407 Ga0207675_101281764 3300026118 Bacteria 753
408 Ga0207683_10040591 3300026121 Bacteria 4061
409 Ga0207683_10071425 3300026121 Bacteria 3069
410 Ga0207683_10079795 3300026121 Bacteria 2902
411 Ga0207683_10175937 3300026121 Bacteria 1939
412 Ga0207683_10417429 3300026121 Bacteria 1236
413 Ga0207698_10115669 3300026142 Bacteria 2259
414 Ga0207698_10521999 3300026142 Bacteria 1159
415 Ga0209970_1024055 3300027614 Bacteria 1039
416 Ga0207428_10000002 3300027907 Bacteria 854851
417 Ga0207428_10010923 3300027907 Bacteria 8082
418 Ga0207428_10013278 3300027907 Bacteria 7200
419 Ga0207428_10019371 3300027907 Bacteria 5803
420 Ga0207428_10249205 3300027907 Bacteria 1325
421 Ga0268265_10137479 3300028380 Bacteria 2040
422 Ga0268265_10143894 3300028380 Bacteria 2000
423 Ga0268264_10155032 3300028381 Bacteria 2058
424 Ga0268264_10243190 3300028381 Bacteria 1668
425 Ga0268264_11078001 3300028381 Bacteria 811
426 Ga0316576_10194201 3300031727 Bacteria 1530
427 Ga0316578_10036414 3300031728 Bacteria 2832
428 Ga0307405_10326121 3300031731 Bacteria 1175
429 Ga0307405_10443008 3300031731 Bacteria 1028
430 Ga0307406_10512248 3300031901 Bacteria 975
431 Ga0307412_10149661 3300031911 Bacteria 1721
432 Ga0307412_10153208 3300031911 Bacteria 1704
433 Ga0307409_100211943 3300031995 Bacteria 1742
434 Ga0307416_100075637 3300032002 Bacteria 2819
435 Ga0307416_100090161 3300032002 Bacteria 2628
436 Ga0307416_100115167 3300032002 Bacteria 2380
437 Ga0307416_101657878 3300032002 Bacteria 744
438 Ga0307415_100501150 3300032126 Bacteria 1062
439 Ga0373928_0044116 3300035084 Bacteria 1034
440 Ga0373951_0120050 3300035091 Bacteria 715
441 Ga0373923_0108483 3300035111 Bacteria 1231
442 Ga0373923_0265822 3300035111 Bacteria 806
443 Ga0373941_0137875 3300035115 Bacteria 885
444 Ga0373945_0025460 3300035116 Bacteria 2055
445 Ga0373943_0093978 3300035170 Bacteria 1557
446 Ga0373955_0005801 3300035172 Bacteria 5575
447 Ga0373955_0085036 3300035172 Bacteria 1795
448 Ga0373955_0470331 3300035172 Bacteria 767
449 Ga0373931_0067500 3300035691 Bacteria 1944
450 Ga0373935_0518491 3300035692 Bacteria 867
451 Ga0373933_0468325 3300035724 Bacteria 825
452 Ga0373947_0117913 3300035725 Bacteria 1684
453 Ga0373937_0001949 3300036401 Bacteria 17281
454 Ga0373937_0198015 3300036401 Bacteria 1888
455 Ga0373937_0239172 3300036401 Bacteria 1711
456 Ga0373937_0480442 3300036401 Bacteria 1180
457 Ga0373937_0745859 3300036401 Bacteria 926
458 Ga0316584_1012660 3300036712 Bacteria 554
459 Ga0373925_0003799 3300037068 Bacteria 11608
460 Ga0373925_1086088 3300037068 Bacteria 658
461 Ga0395905_0149340 3300037471 Bacteria 2199
462 Ga0395905_0576373 3300037471 Bacteria 1027
463 Ga0436365_0324434 3300039437 Bacteria 2803
464 Ga0451837_0778326 3300041494 Bacteria 1074
465 Ga0439431_0090865 3300041997 Bacteria 832
466 Ga0439449_0034651 3300042007 Bacteria 1880
467 Ga0439457_052102 3300042014 Bacteria 920
468 Ga0450920_035940 3300042122 Bacteria 982
469 Ga0439435_0110468 3300042436 Bacteria 853
470 Ga0466963_0177260 3300044694 Bacteria 1488
471 Ga0453684_0000298 3300044712 Bacteria 209777
472 Ga0453684_0035315 3300044712 Bacteria 6913
473 Ga0451576_0000033 3300045051 Bacteria 393131
474 Ga0466967_0374398 3300045976 Bacteria 1382
475 Ga0466967_0628099 3300045976 Bacteria 1061
476 Ga0495592_0356755 3300046454 Bacteria 936
477 Ga0495582_0074303 3300046473 Bacteria 1882
478 Ga0495582_0107079 3300046473 Bacteria 1569
479 Ga0495639_0110168 3300046475 Bacteria 1306
480 Ga0495662_0189731 3300046476 Bacteria 1013
481 Ga0495664_0076457 3300046477 Bacteria 2004
482 Ga0495664_0409115 3300046477 Bacteria 814
483 Ga0495664_0703604 3300046477 Bacteria 597
484 Ga0495618_0244313 3300046514 Bacteria 1128
485 Ga0495628_0301919 3300046516 Bacteria 1185
486 Ga0495628_0315931 3300046516 Bacteria 1153
487 Ga0495630_0156520 3300046517 Bacteria 1734
488 Ga0495666_0161990 3300046526 Bacteria 1037
489 Ga0495586_0509379 3300046535 Bacteria 694
490 Ga0495645_0001445 3300046543 Bacteria 16045
491 Ga0495645_0168718 3300046543 Bacteria 1508
492 Ga0495667_0503215 3300046559 Bacteria 759
493 Ga0495634_0105388 3300046642 Bacteria 1818
494 Ga0495635_0262133 3300046663 Bacteria 1164
495 Ga0495599_0077052 3300046678 Bacteria 2082
496 Ga0495599_0495384 3300046678 Bacteria 720
497 Ga0495658_0120054 3300046683 Bacteria 1589
498 Ga0495658_0124421 3300046683 Bacteria 1563
499 Ga0495658_0224997 3300046683 Bacteria 1176
500 Ga0495658_0459783 3300046683 Bacteria 813
501 Ga0495613_0398467 3300046689 Bacteria 939
502 Ga0495674_0201300 3300047319 Bacteria 1652
503 Ga0495674_0248044 3300047319 Bacteria 1466
504 Ga0495674_0293454 3300047319 Bacteria 1329
505 Ga0495680_0747094 3300047322 Bacteria 643
506 Ga0495684_0107185 3300047471 Bacteria 2111
507 Ga0496106_0690465 3300048909 Bacteria 814
508 Ga0496108_0008779 3300048911 Bacteria 8194
509 Ga0496110_0122417 3300048913 Bacteria 2345
510 Ga0496110_0230933 3300048913 Bacteria 1683
511 Ga0496110_1068135 3300048913 Bacteria 715
512 Ga0496112_0006594 3300048915 Bacteria 10214
513 Ga0496112_0146829 3300048915 Bacteria 2327
514 Ga0496112_0330793 3300048915 Bacteria 1467
515 Ga0496112_0750395 3300048915 Bacteria 902
516 Ga0496113_0049273 3300048916 Bacteria 3136
517 Ga0496113_0228752 3300048916 Bacteria 1483
518 Ga0496114_0129125 3300048917 Bacteria 2181
519 Ga0496114_0326202 3300048917 Bacteria 1357
520 Ga0496114_0468504 3300048917 Bacteria 1115
521 Ga0501031_0098554 3300049568 Bacteria 1907
522 Ga0501031_0266609 3300049568 Bacteria 1112
523 Ga0501031_0369584 3300049568 Bacteria 928
524 Ga0501032_0005194 3300049569 Bacteria 9698
525 Ga0501032_0181336 3300049569 Bacteria 1378
526 Ga0501032_0193064 3300049569 Bacteria 1330
527 Ga0501033_0002752 3300049570 Bacteria 14744
528 Ga0501033_0003754 3300049570 Bacteria 12339
529 Ga0501033_0168533 3300049570 Bacteria 1573
530 Ga0501034_0007157 3300049571 Bacteria 11905
531 Ga0501034_0018018 3300049571 Bacteria 7245
532 Ga0501034_0034928 3300049571 Bacteria 5099
533 Ga0501034_0104365 3300049571 Bacteria 2827
534 Ga0501034_0105655 3300049571 Bacteria 2808
535 Ga0501034_0132677 3300049571 Bacteria 2473
536 Ga0501034_0186336 3300049571 Bacteria 2038
537 Ga0501034_0193945 3300049571 Bacteria 1992
538 Ga0501034_0476103 3300049571 Bacteria 1164
539 Ga0501036_0012094 3300049572 Bacteria 7153
540 Ga0501036_0047506 3300049572 Bacteria 3634
541 Ga0501036_0226387 3300049572 Bacteria 1569
542 Ga0501036_0290712 3300049572 Bacteria 1367
543 Ga0501037_0009630 3300049573 Bacteria 7089
544 Ga0501037_0028585 3300049573 Bacteria 4118
545 Ga0501037_0080595 3300049573 Bacteria 2361
546 Ga0501037_0578263 3300049573 Bacteria 756
547 Ga0501037_0843026 3300049573 Bacteria 603
548 Ga0501038_0007374 3300049574 Bacteria 10145
549 Ga0501038_0022512 3300049574 Bacteria 5645
550 Ga0501038_0051105 3300049574 Bacteria 3569
551 Ga0501038_0098253 3300049574 Bacteria 2441
552 Ga0501038_0159012 3300049574 Bacteria 1837
553 Ga0501039_0014186 3300049575 Bacteria 6102
554 Ga0501039_0030177 3300049575 Bacteria 4179
555 Ga0501040_1039028 3300049576 Bacteria 594
556 Ga0501041_0465679 3300049577 Bacteria 803
557 Ga0501042_0037741 3300049578 Bacteria 3429
558 Ga0501043_0103882 3300049579 Bacteria 2232
559 Ga0501043_0109295 3300049579 Bacteria 2171
560 Ga0501043_0186432 3300049579 Bacteria 1615
561 Ga0501043_0195542 3300049579 Bacteria 1571
562 Ga0501043_0467534 3300049579 Bacteria 945
563 Ga0501046_0007176 3300049580 Bacteria 9805
564 Ga0501046_0009673 3300049580 Bacteria 8312
565 Ga0501046_0023264 3300049580 Bacteria 5098
566 Ga0501046_0350161 3300049580 Bacteria 1073
567 Ga0501047_0001174 3300049581 Bacteria 25954
568 Ga0501047_0009879 3300049581 Bacteria 9020
569 Ga0501047_0017532 3300049581 Bacteria 6859
570 Ga0501047_0089862 3300049581 Bacteria 2948
571 Ga0501047_0174536 3300049581 Bacteria 2017
572 Ga0501047_0281229 3300049581 Bacteria 1508
573 Ga0501048_0004836 3300049582 Bacteria 10268
574 Ga0501048_0200316 3300049582 Bacteria 1415
575 Ga0501067_0022957 3300049583 Bacteria 3454
576 Ga0501067_0087310 3300049583 Bacteria 1731
577 Ga0501067_0090392 3300049583 Bacteria 1699
578 Ga0501067_0220559 3300049583 Bacteria 1056
579 Ga0501068_0010407 3300049584 Bacteria 5227
580 Ga0501068_0052847 3300049584 Bacteria 2458
581 Ga0501068_0380852 3300049584 Bacteria 908
582 Ga0501068_0473898 3300049584 Bacteria 811
583 Ga0501068_0495219 3300049584 Bacteria 792
584 Ga0501069_0029616 3300049585 Bacteria 3004
585 Ga0501071_0051440 3300049587 Bacteria 2969
586 Ga0501071_0757524 3300049587 Bacteria 748
587 Ga0501071_0814609 3300049587 Bacteria 720
588 Ga0501072_0046227 3300049588 Bacteria 3425
589 Ga0501072_0099156 3300049588 Bacteria 2316
590 Ga0501072_0310773 3300049588 Bacteria 1253
591 Ga0501073_0010926 3300049589 Bacteria 6640
592 Ga0501073_0077467 3300049589 Bacteria 2313
593 Ga0501073_0160139 3300049589 Bacteria 1559
594 Ga0501073_0325493 3300049589 Bacteria 1061
595 Ga0501074_0020019 3300049590 Bacteria 4863
596 Ga0501074_0110798 3300049590 Bacteria 1964
597 Ga0501075_0039710 3300049591 Bacteria 3522
598 Ga0501075_0174528 3300049591 Bacteria 1640
599 Ga0501075_0179274 3300049591 Bacteria 1617
600 Ga0501076_0043093 3300049592 Bacteria 3555
601 Ga0501076_0113678 3300049592 Bacteria 2190
602 Ga0501076_0362490 3300049592 Bacteria 1191
603 Ga0501077_0112643 3300049593 Bacteria 1725
604 Ga0501077_0312275 3300049593 Bacteria 1002
605 Ga0501077_0654000 3300049593 Bacteria 675
606 Ga0501259_001142 3300049688 Unclassified 4425
607 Ga0501079_0011370 3300049741 Bacteria 6793
608 Ga0501079_0038754 3300049741 Bacteria 3675
609 Ga0501079_0284627 3300049741 Bacteria 1292
610 Ga0501080_0000262 3300049742 Bacteria 39808
611 Ga0501080_0088041 3300049742 Bacteria 2884
612 Ga0501080_0328471 3300049742 Bacteria 1383
613 Ga0501081_0116209 3300049743 Bacteria 1902
614 Ga0501081_0383997 3300049743 Bacteria 1038
615 Ga0501083_0011332 3300049744 Bacteria 6253
616 Ga0501083_0026659 3300049744 Bacteria 3992
617 Ga0501083_0076180 3300049744 Bacteria 2226
618 Ga0501083_0192941 3300049744 Bacteria 1329
619 Ga0501035_0158491 3300049822 Bacteria 1960
620 Ga0501044_0006636 3300049823 Bacteria 12758
621 Ga0501044_0159010 3300049823 Bacteria 2237
622 Ga0501044_0210352 3300049823 Bacteria 1899
623 Ga0501044_0783172 3300049823 Bacteria 834
624 Ga0501045_0033671 3300049824 Bacteria 3716
625 Ga0501045_0683451 3300049824 Bacteria 758
626 nmdc:mga03683_988_c1 3300050489 Bacteria 8299
627 nmdc:mga03n38_6462_c1 3300050490 Bacteria 4073
628 nmdc:mga00v17_14728_c1 3300050491 Bacteria 4374
629 nmdc:mga00v17_3090_c1 3300050491 Bacteria 8562
630 nmdc:mga00v17_64952_c1 3300050491 Bacteria 2250
631 nmdc:mga0yw44_11740_c1 3300050492 Bacteria 4538
632 nmdc:mga0k408_5791_c1 3300050493 Bacteria 6579
633 nmdc:mga06z11_254407_c1 3300050494 Bacteria 1035
634 nmdc:mga07m45_2608_c1 3300050496 Bacteria 8489
635 nmdc:mga07m45_720_c1 3300050496 Bacteria 14083
636 nmdc:mga05p37_1089556_c1 3300050507 Bacteria 838
637 nmdc:mga05p37_145177_c1 3300050507 Bacteria 2906
638 nmdc:mga05p37_16647_c1 3300050507 Bacteria 8857
639 nmdc:mga05p37_18912_c1 3300050507 Bacteria 8328
640 nmdc:mga05p37_204_c1 3300050507 Bacteria 59503
641 nmdc:mga05p37_252594_c1 3300050507 Bacteria 2114
642 nmdc:mga05p37_956306_c1 3300050507 Bacteria 916
643 nmdc:mga09592_120857_c1 3300050508 Bacteria 2250
644 nmdc:mga09592_416338_c1 3300050508 Bacteria 1161
645 nmdc:mga09592_717695_c1 3300050508 Bacteria 850
646 nmdc:mga09592_98321_c1 3300050508 Bacteria 2505
647 nmdc:mga06r32_175822_c1 3300050510 Bacteria 2125
648 nmdc:mga06r32_189143_c1 3300050510 Bacteria 2046
649 nmdc:mga06r32_227782_c1 3300050510 Bacteria 1852
650 nmdc:mga06r32_257613_c1 3300050510 Bacteria 1732
651 nmdc:mga06r32_80955_c1 3300050510 Bacteria 3161
652 nmdc:mga08y16_15221_c1 3300050511 Bacteria 8091
653 nmdc:mga08y16_196209_c1 3300050511 Bacteria 2092
654 nmdc:mga08y16_24560_c1 3300050511 Bacteria 6360
655 nmdc:mga08y16_30618_c1 3300050511 Bacteria 5662
656 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
657 nmdc:mga08y16_540868_c1 3300050511 Bacteria 1180
658 nmdc:mga08y16_5934_c1 3300050511 Bacteria 12801
659 nmdc:mga08y16_824727_c1 3300050511 Bacteria 919
660 nmdc:mga0n895_28663_c1 3300050512 Bacteria 5300
661 nmdc:mga0n895_51518_c1 3300050512 Bacteria 4039
662 nmdc:mga0n895_588428_c1 3300050512 Bacteria 1116
663 nmdc:mga0rr50_113189_c1 3300050513 Bacteria 2150
664 nmdc:mga0rr50_202634_c1 3300050513 Bacteria 1631
665 nmdc:mga0rr50_288508_c1 3300050513 Bacteria 1371
666 nmdc:mga0rr50_2940_c1 3300050513 Bacteria 9735
667 nmdc:mga0rr50_58317_c1 3300050513 Bacteria 2893
668 nmdc:mga0rr50_629024_c1 3300050513 Bacteria 915
669 nmdc:mga08x19_177347_c1 3300050514 Bacteria 1454
670 nmdc:mga08x19_288688_c1 3300050514 Bacteria 1138
671 nmdc:mga08x19_318562_c1 3300050514 Bacteria 1082
672 nmdc:mga08x19_909749_c1 3300050514 Bacteria 625
673 nmdc:mga0a205_207704_c1 3300050515 Bacteria 1847
674 nmdc:mga0a205_438114_c1 3300050515 Bacteria 1168
675 nmdc:mga0a205_73814_c1 3300050515 Bacteria 3296
676 Ga0495601_0117061 3300053077 Bacteria 1729
677 Ga0495601_0351519 3300053077 Bacteria 958
678 Ga0495612_0050814 3300053078 Bacteria 1703
679 Ga0495655_0165961 3300053083 Bacteria 704
680 Ga0495595_0105846 3300053084 Bacteria 1361
681 Ga0495619_0100695 3300053085 Bacteria 1966
682 Ga0500627_0224366 3300053158 Bacteria 838
683 Ga0501084_0008305 3300054114 Bacteria 8569
684 Ga0501084_0016296 3300054114 Bacteria 6171
685 Ga0501084_0037225 3300054114 Bacteria 4065
686 Ga0501084_0168723 3300054114 Bacteria 1847
687 Ga0501084_0248393 3300054114 Bacteria 1502
688 Ga0501084_0591535 3300054114 Bacteria 937
689 Ga0501084_0770687 3300054114 Bacteria 810
690 Ga0587067_021920 3300059640 Bacteria 1107
691 Ga0501082_0026938 3300060353 Bacteria 4952
692 Ga0501082_0045330 3300060353 Bacteria 3792
693 Ga0501082_0131745 3300060353 Bacteria 2169
694 Ga0501082_0156810 3300060353 Bacteria 1978
695 Ga0501082_0266204 3300060353 Bacteria 1491
696 Ga0501082_0338890 3300060353 Bacteria 1310
697 Ga0501082_0536160 3300060353 Bacteria 1023
698 Ga0501082_0604532 3300060353 Bacteria 959
699 Ga0501082_0903653 3300060353 Bacteria 772
700 Ga0466962_0286897 3300061719 Bacteria 813
701 Ga0530510_0093709 3300061734 Bacteria 2193
702 Ga0530510_0421275 3300061734 Bacteria 1008
703 Ga0530510_0462276 3300061734 Bacteria 960
704 Ga0075365_10670241
705 JGI24751J29686_10023919
706 Ga0065704_10178713
707 Ga0065704_10348259
708 Ga0065704_10368055
709 Ga0065712_10011491
710 Ga0065712_10070887
711 Ga0065712_10089047
712 Ga0065712_10099667
713 Ga0065712_10173755
714 Ga0065712_10178324
715 Ga0065712_10224638
716 Ga0065712_10293429
717 Ga0065712_10404645
718 Ga0065712_10446080
719 Ga0065715_10010997
720 Ga0065715_10012178
721 Ga0065715_10039862
722 Ga0065715_10098529
723 Ga0065715_10107521
724 Ga0065715_10150939
725 Ga0065715_10163689
726 Ga0065715_10212774
727 Ga0065715_10218123
728 Ga0065715_10307137
729 Ga0065715_10315097
730 Ga0065715_10572322
731 Ga0065707_10046871
732 Ga0065707_10085305
733 Ga0065707_10096051
734 Ga0065707_10147528
735 Ga0065707_10199108
736 Ga0065707_10269147
737 Ga0065707_10290350
738 Ga0065707_10365118
739 Ga0065707_10431676
740 Ga0065707_10448678
741 Ga0070658_10283172
742 Ga0070676_10011008
743 Ga0070676_10060762
744 Ga0070676_10325239
745 Ga0070683_100586059
746 Ga0070683_101293952
747 Ga0070670_100027351
748 Ga0070670_100052037
749 Ga0070670_100206868
750 Ga0070670_100535737
751 Ga0070677_10092566
752 Ga0068869_100041538
753 Ga0068869_100328723
754 Ga0068869_100925239
755 Ga0070666_10187181
756 Ga0070680_101022028
757 Ga0070682_100216755
758 Ga0068868_100086718
759 Ga0068868_100256290
760 Ga0068868_100516727
761 Ga0068868_101415811
762 Ga0070660_100018917
763 Ga0070660_100190580
764 Ga0070689_100050511
765 Ga0070689_100137239
766 Ga0070689_100283073
767 Ga0070689_100984273
768 Ga0070687_100041858
769 Ga0070661_100105659
770 Ga0070661_100610454
771 Ga0070661_100653202
772 Ga0070692_10462033
773 Ga0070668_100022182
774 Ga0070668_100161101
775 Ga0070669_100320265
776 Ga0070675_100209320
777 Ga0070675_100307494
778 Ga0070675_100353231
779 Ga0070671_100093758
780 Ga0070671_101282593
781 Ga0070674_100014528
782 Ga0070674_100023422
783 Ga0070674_100086162
784 Ga0070674_100086490
785 Ga0070674_100088683
786 Ga0070674_100094063
787 Ga0070673_100035863
788 Ga0070673_100342727
789 Ga0070673_100448272
790 Ga0070688_100030223
791 Ga0070688_100056716
792 Ga0070659_100379825
793 Ga0070667_100044527
794 Ga0070667_100599548
795 Ga0070713_100003643
796 Ga0070701_10016432
797 Ga0070701_10030874
798 Ga0070701_10251637
799 Ga0070705_100038938
800 Ga0070705_100521766
801 Ga0070700_100269846
802 Ga0070700_100586152
803 Ga0070694_100008007
804 Ga0070694_100017695
805 Ga0070694_100159265
806 Ga0070663_100149336
807 Ga0070678_100009162
808 Ga0070678_100538847
809 Ga0070662_100470786
810 Ga0068867_100012999
811 Ga0068867_100231275
812 Ga0068867_100610155
813 Ga0068867_100641272
814 Ga0070685_10217255
815 Ga0070707_100016942
816 Ga0070707_100243323
817 Ga0070707_100547414
818 Ga0070707_100646551
819 Ga0070707_101027263
820 Ga0070698_100018978
821 Ga0070698_100051643
822 Ga0070698_100162917
823 Ga0070699_100066431
824 Ga0070699_100290144
825 Ga0070679_100016517
826 Ga0070679_100247685
827 Ga0070684_100081768
828 Ga0070684_100156461
829 Ga0070684_100828251
830 Ga0070697_100247904
831 Ga0070672_100002598
832 Ga0070672_100163736
833 Ga0070672_100177872
834 Ga0070672_100218803
835 Ga0070672_100861980
836 Ga0070695_100006738
837 Ga0070695_100086402
838 Ga0070695_100258357
839 Ga0070695_100345885
840 Ga0070695_100976571
841 Ga0070696_100161162
842 Ga0070696_100218888
843 Ga0070696_100264358
844 Ga0070696_100375508
845 Ga0070696_100465577
846 Ga0070693_100193863
847 Ga0070665_100102380
848 Ga0070704_100055278
849 Ga0070704_100139858
850 Ga0070704_100196367
851 Ga0070704_100397835
852 Ga0070704_100985659
853 Ga0068855_100088631
854 Ga0070664_100088878
855 Ga0070664_100285462
856 Ga0070664_100428233
857 Ga0068857_100850730
858 Ga0068854_100037831
859 Ga0068854_100556684
860 Ga0070702_100041699
861 Ga0068852_100083669
862 Ga0068852_100313360
863 Ga0068859_100053081
864 Ga0068859_100319117
865 Ga0068859_100326709
866 Ga0068859_100447581
867 Ga0068864_100010173
868 Ga0068864_100324080
869 Ga0068864_100566188
870 Ga0068864_100580745
871 Ga0068866_10076011
872 Ga0068861_100010150
873 Ga0068863_100456389
874 Ga0068863_100672552
875 Ga0068858_100006437
876 Ga0068858_100153792
877 Ga0068858_100496473
878 Ga0068858_100534384
879 Ga0068858_100707482
880 Ga0068860_100025065
881 Ga0068860_100120521
882 Ga0068862_100120841
883 Ga0068862_100165510
884 Ga0081455_10086861
885 Ga0070717_10031295
886 Ga0075365_10080806
887 Ga0075363_100000184
888 Ga0075364_10000216
889 Ga0075364_10063064
890 Ga0075364_10075516
891 Ga0070715_10396564
892 Ga0075367_10026515
893 Ga0075367_10048517
894 Ga0075366_10025419
895 Ga0075366_10091578
896 Ga0075366_10185417
897 Ga0097621_100145958
898 Ga0075370_10001078
899 Ga0075370_10004898
900 Ga0068871_100125192
901 Ga0068871_100289913
902 Ga0068871_100837714
903 Ga0068871_101580144
904 Ga0075428_100000108
905 Ga0075428_100050041
906 Ga0075428_100081295
907 Ga0075428_100649919
908 Ga0075431_100014832
909 Ga0075431_100046036
910 Ga0075431_100133204
911 Ga0075431_100164766
912 Ga0075433_10048617
913 Ga0075433_10136726
914 Ga0075433_10169331
915 Ga0075433_10186696
916 Ga0075433_10193776
917 Ga0075433_10399007
918 Ga0075433_10414739
919 Ga0075434_100006295
920 Ga0075434_100125622
921 Ga0075434_100190218
922 Ga0075434_100279545
923 Ga0075434_100621054
924 Ga0075434_100878792
925 Ga0075429_100113290
926 Ga0068865_100253477
927 Ga0068865_100410102
928 Ga0075436_100046415
929 Ga0075436_100088335
930 Ga0075436_100139869
931 Ga0097620_100053081
932 Ga0097620_100319127
933 Ga0097620_100326749
934 Ga0097620_100447583
935 Ga0075435_100006980
936 Ga0075435_100009659
937 Ga0075435_100457038
938 Ga0075435_100544531
939 Ga0099795_10277225
940 Ga0105251_10394954
941 Ga0105244_10376414
942 Ga0105240_10094372
943 Ga0111539_10000001
944 Ga0111539_10002263
945 Ga0111539_10022709
946 Ga0111539_10028916
947 Ga0111539_10032649
948 Ga0111539_10147557
949 Ga0111539_10378748
950 Ga0111539_10590656
951 Ga0111539_10962548
952 Ga0105245_10074485
953 Ga0105247_10056455
954 Ga0105247_10140003
955 Ga0114129_10000174
956 Ga0114129_10023013
957 Ga0114129_10068327
958 Ga0114129_10256497
959 Ga0114129_10749334
960 Ga0105243_10062383
961 Ga0105243_10227763
962 Ga0105243_10964766
963 Ga0105248_10020179
964 Ga0105248_10078331
965 Ga0105248_10175058
966 Ga0105248_10184460
967 Ga0105248_10444226
968 Ga0105248_10624040
969 Ga0105249_10069913
970 Ga0105249_10134901
971 Ga0105249_10441537
972 Ga0105249_10802809
973 Ga0105249_10899031
974 Ga0105249_11466012
975 Ga0105239_10984595
976 Ga0157343_1019654
977 Ga0157373_11113291
978 Ga0157370_10348531
979 Ga0157369_10847820
980 Ga0157374_10226196
981 Ga0157374_10591186
982 Ga0163162_10068321
983 Ga0157372_10690490
984 Ga0157375_10522200
985 Ga0157375_11135211
986 Ga0163163_10044160
987 Ga0163163_10379000
988 Ga0157380_10120703
989 Ga0157380_10379721
990 Ga0157380_10395136
991 Ga0157380_10407060
992 Ga0157379_10035068
993 Ga0157379_10232534
994 Ga0157376_10036646
995 Ga0157376_10223213
996 Ga0207697_10002088
997 Ga0207656_10108215
998 Ga0207682_10037726
999 Ga0207642_10325313
1000 Ga0207710_10054032
1001 Ga0207710_10128898
1002 Ga0207680_10123921
1003 Ga0207680_10363512
1004 Ga0207645_10027068
1005 Ga0207645_10217065
1006 Ga0207643_10166632
1007 Ga0207643_10355552
1008 Ga0207684_10307023
1009 Ga0207654_10246171
1010 Ga0207695_10072016
1011 Ga0207660_10213304
1012 Ga0207662_10069768
1013 Ga0207662_10312170
1014 Ga0207657_10066571
1015 Ga0207652_10002486
1016 Ga0207652_10040793
1017 Ga0207652_10207430
1018 Ga0207646_10032977
1019 Ga0207646_10049267
1020 Ga0207646_10140996
1021 Ga0207646_10818939
1022 Ga0207681_10075708
1023 Ga0207681_10747432
1024 Ga0207650_10417775
1025 Ga0207650_10522149
1026 Ga0207650_10732580
1027 Ga0207650_11393106
1028 Ga0207659_10202719
1029 Ga0207659_10236161
1030 Ga0207659_10445095
1031 Ga0207659_10675635
1032 Ga0207659_11122182
1033 Ga0207700_10024321
1034 Ga0207644_10099738
1035 Ga0207644_11210992
1036 Ga0207690_10057603
1037 Ga0207690_10208924
1038 Ga0207686_10003681
1039 Ga0207709_10004342
1040 Ga0207670_10303832
1041 Ga0207670_10329178
1042 Ga0207669_10019186
1043 Ga0207669_10035699
1044 Ga0207669_10039512
1045 Ga0207669_10061165
1046 Ga0207669_10246259
1047 Ga0207669_10977338
1048 Ga0207704_10367735
1049 Ga0207665_10269420
1050 Ga0207691_10013925
1051 Ga0207691_10214776
1052 Ga0207691_10217480
1053 Ga0207691_10562844
1054 Ga0207711_10012271
1055 Ga0207711_10070774
1056 Ga0207711_10211872
1057 Ga0207711_10374969
1058 Ga0207711_10396217
1059 Ga0207711_10402248
1060 Ga0207711_10754183
1061 Ga0207689_10078486
1062 Ga0207689_10317453
1063 Ga0207661_10401470
1064 Ga0207679_10133289
1065 Ga0207679_10382299
1066 Ga0207679_10533780
1067 Ga0207667_11246325
1068 Ga0207651_10005977
1069 Ga0207651_10045441
1070 Ga0207651_10352574
1071 Ga0207651_10441198
1072 Ga0207712_10080155
1073 Ga0207712_10107400
1074 Ga0207712_10171282
1075 Ga0207712_10189580
1076 Ga0207712_10506077
1077 Ga0207668_10019227
1078 Ga0207668_10105912
1079 Ga0207668_10356365
1080 Ga0207668_10432301
1081 Ga0207640_10093769
1082 Ga0207640_10340039
1083 Ga0207677_10255847
1084 Ga0207677_10366528
1085 Ga0207677_10496484
1086 Ga0207703_10016106
1087 Ga0207703_11237577
1088 Ga0207678_10122882
1089 Ga0207678_10131956
1090 Ga0207708_10004690
1091 Ga0207708_10004696
1092 Ga0207708_10287032
1093 Ga0207702_10569383
1094 Ga0207641_10081749
1095 Ga0207641_10487931
1096 Ga0207648_10018612
1097 Ga0207648_10123098
1098 Ga0207648_10243869
1099 Ga0207648_10348227
1100 Ga0207648_10378542
1101 Ga0207676_10015116
1102 Ga0207676_10073193
1103 Ga0207676_10133403
1104 Ga0207676_10632358
1105 Ga0207674_10829493
1106 Ga0207675_100022777
1107 Ga0207675_100202763
1108 Ga0207675_100486179
1109 Ga0207675_100600587
1110 Ga0207675_101281764
1111 Ga0207683_10040591
1112 Ga0207683_10071425
1113 Ga0207683_10079795
1114 Ga0207683_10175937
1115 Ga0207683_10417429
1116 Ga0207698_10115669
1117 Ga0207698_10521999
1118 Ga0209970_1024055
1119 Ga0207428_10000002
1120 Ga0207428_10010923
1121 Ga0207428_10013278
1122 Ga0207428_10019371
1123 Ga0207428_10249205
1124 Ga0268265_10137479
1125 Ga0268265_10143894
1126 Ga0268264_10155032
1127 Ga0268264_10243190
1128 Ga0268264_11078001
1129 Ga0316576_10194201
1130 Ga0316578_10036414
1131 Ga0307405_10326121
1132 Ga0307405_10443008
1133 Ga0307406_10512248
1134 Ga0307412_10149661
1135 Ga0307412_10153208
1136 Ga0307409_100211943
1137 Ga0307416_100075637
1138 Ga0307416_100090161
1139 Ga0307416_100115167
1140 Ga0307416_101657878
1141 Ga0307415_100501150
1142 Ga0373928_0044116
1143 Ga0373951_0120050
1144 Ga0373923_0108483
1145 Ga0373923_0265822
1146 Ga0373941_0137875
1147 Ga0373945_0025460
1148 Ga0373943_0093978
1149 Ga0373955_0005801
1150 Ga0373955_0085036
1151 Ga0373955_0470331
1152 Ga0373931_0067500
1153 Ga0373935_0518491
1154 Ga0373933_0468325
1155 Ga0373947_0117913
1156 Ga0373937_0001949
1157 Ga0373937_0198015
1158 Ga0373937_0239172
1159 Ga0373937_0480442
1160 Ga0373937_0745859
1161 Ga0316584_1012660
1162 Ga0373925_0003799
1163 Ga0373925_1086088
1164 Ga0395905_0149340
1165 Ga0395905_0576373
1166 Ga0436365_0324434
1167 Ga0451837_0778326
1168 Ga0439431_0090865
1169 Ga0439449_0034651
1170 Ga0439457_052102
1171 Ga0450920_035940
1172 Ga0439435_0110468
1173 Ga0466963_0177260
1174 Ga0453684_0000298
1175 Ga0453684_0035315
1176 Ga0451576_0000033
1177 Ga0466967_0374398
1178 Ga0466967_0628099
1179 Ga0495592_0356755
1180 Ga0495582_0074303
1181 Ga0495582_0107079
1182 Ga0495639_0110168
1183 Ga0495662_0189731
1184 Ga0495664_0076457
1185 Ga0495664_0409115
1186 Ga0495664_0703604
1187 Ga0495618_0244313
1188 Ga0495628_0301919
1189 Ga0495628_0315931
1190 Ga0495630_0156520
1191 Ga0495666_0161990
1192 Ga0495586_0509379
1193 Ga0495645_0001445
1194 Ga0495645_0168718
1195 Ga0495667_0503215
1196 Ga0495634_0105388
1197 Ga0495635_0262133
1198 Ga0495599_0077052
1199 Ga0495599_0495384
1200 Ga0495658_0120054
1201 Ga0495658_0124421
1202 Ga0495658_0224997
1203 Ga0495658_0459783
1204 Ga0495613_0398467
1205 Ga0495674_0201300
1206 Ga0495674_0248044
1207 Ga0495674_0293454
1208 Ga0495680_0747094
1209 Ga0495684_0107185
1210 Ga0496106_0690465
1211 Ga0496108_0008779
1212 Ga0496110_0122417
1213 Ga0496110_0230933
1214 Ga0496110_1068135
1215 Ga0496112_0006594
1216 Ga0496112_0146829
1217 Ga0496112_0330793
1218 Ga0496112_0750395
1219 Ga0496113_0049273
1220 Ga0496113_0228752
1221 Ga0496114_0129125
1222 Ga0496114_0326202
1223 Ga0496114_0468504
1224 Ga0501031_0098554
1225 Ga0501031_0266609
1226 Ga0501031_0369584
1227 Ga0501032_0005194
1228 Ga0501032_0181336
1229 Ga0501032_0193064
1230 Ga0501033_0002752
1231 Ga0501033_0003754
1232 Ga0501033_0168533
1233 Ga0501034_0007157
1234 Ga0501034_0018018
1235 Ga0501034_0034928
1236 Ga0501034_0104365
1237 Ga0501034_0105655
1238 Ga0501034_0132677
1239 Ga0501034_0186336
1240 Ga0501034_0193945
1241 Ga0501034_0476103
1242 Ga0501036_0012094
1243 Ga0501036_0047506
1244 Ga0501036_0226387
1245 Ga0501036_0290712
1246 Ga0501037_0009630
1247 Ga0501037_0028585
1248 Ga0501037_0080595
1249 Ga0501037_0578263
1250 Ga0501037_0843026
1251 Ga0501038_0007374
1252 Ga0501038_0022512
1253 Ga0501038_0051105
1254 Ga0501038_0098253
1255 Ga0501038_0159012
1256 Ga0501039_0014186
1257 Ga0501039_0030177
1258 Ga0501040_1039028
1259 Ga0501041_0465679
1260 Ga0501042_0037741
1261 Ga0501043_0103882
1262 Ga0501043_0109295
1263 Ga0501043_0186432
1264 Ga0501043_0195542
1265 Ga0501043_0467534
1266 Ga0501046_0007176
1267 Ga0501046_0009673
1268 Ga0501046_0023264
1269 Ga0501046_0350161
1270 Ga0501047_0001174
1271 Ga0501047_0009879
1272 Ga0501047_0017532
1273 Ga0501047_0089862
1274 Ga0501047_0174536
1275 Ga0501047_0281229
1276 Ga0501048_0004836
1277 Ga0501048_0200316
1278 Ga0501067_0022957
1279 Ga0501067_0087310
1280 Ga0501067_0090392
1281 Ga0501067_0220559
1282 Ga0501068_0010407
1283 Ga0501068_0052847
1284 Ga0501068_0380852
1285 Ga0501068_0473898
1286 Ga0501068_0495219
1287 Ga0501069_0029616
1288 Ga0501071_0051440
1289 Ga0501071_0757524
1290 Ga0501071_0814609
1291 Ga0501072_0046227
1292 Ga0501072_0099156
1293 Ga0501072_0310773
1294 Ga0501073_0010926
1295 Ga0501073_0077467
1296 Ga0501073_0160139
1297 Ga0501073_0325493
1298 Ga0501074_0020019
1299 Ga0501074_0110798
1300 Ga0501075_0039710
1301 Ga0501075_0174528
1302 Ga0501075_0179274
1303 Ga0501076_0043093
1304 Ga0501076_0113678
1305 Ga0501076_0362490
1306 Ga0501077_0112643
1307 Ga0501077_0312275
1308 Ga0501077_0654000
1309 Ga0501259_001142
1310 Ga0501079_0011370
1311 Ga0501079_0038754
1312 Ga0501079_0284627
1313 Ga0501080_0000262
1314 Ga0501080_0088041
1315 Ga0501080_0328471
1316 Ga0501081_0116209
1317 Ga0501081_0383997
1318 Ga0501083_0011332
1319 Ga0501083_0026659
1320 Ga0501083_0076180
1321 Ga0501083_0192941
1322 Ga0501035_0158491
1323 Ga0501044_0006636
1324 Ga0501044_0159010
1325 Ga0501044_0210352
1326 Ga0501044_0783172
1327 Ga0501045_0033671
1328 Ga0501045_0683451
1329 nmdc:mga03683_988_c1
1330 nmdc:mga03n38_6462_c1
1331 nmdc:mga00v17_14728_c1
1332 nmdc:mga00v17_3090_c1
1333 nmdc:mga00v17_64952_c1
1334 nmdc:mga0yw44_11740_c1
1335 nmdc:mga0k408_5791_c1
1336 nmdc:mga06z11_254407_c1
1337 nmdc:mga07m45_2608_c1
1338 nmdc:mga07m45_720_c1
1339 nmdc:mga05p37_1089556_c1
1340 nmdc:mga05p37_145177_c1
1341 nmdc:mga05p37_16647_c1
1342 nmdc:mga05p37_18912_c1
1343 nmdc:mga05p37_204_c1
1344 nmdc:mga05p37_252594_c1
1345 nmdc:mga05p37_956306_c1
1346 nmdc:mga09592_120857_c1
1347 nmdc:mga09592_416338_c1
1348 nmdc:mga09592_717695_c1
1349 nmdc:mga09592_98321_c1
1350 nmdc:mga06r32_175822_c1
1351 nmdc:mga06r32_189143_c1
1352 nmdc:mga06r32_227782_c1
1353 nmdc:mga06r32_257613_c1
1354 nmdc:mga06r32_80955_c1
1355 nmdc:mga08y16_15221_c1
1356 nmdc:mga08y16_196209_c1
1357 nmdc:mga08y16_24560_c1
1358 nmdc:mga08y16_30618_c1
1359 nmdc:mga08y16_3_c1
1360 nmdc:mga08y16_540868_c1
1361 nmdc:mga08y16_5934_c1
1362 nmdc:mga08y16_824727_c1
1363 nmdc:mga0n895_28663_c1
1364 nmdc:mga0n895_51518_c1
1365 nmdc:mga0n895_588428_c1
1366 nmdc:mga0rr50_113189_c1
1367 nmdc:mga0rr50_202634_c1
1368 nmdc:mga0rr50_288508_c1
1369 nmdc:mga0rr50_2940_c1
1370 nmdc:mga0rr50_58317_c1
1371 nmdc:mga0rr50_629024_c1
1372 nmdc:mga08x19_177347_c1
1373 nmdc:mga08x19_288688_c1
1374 nmdc:mga08x19_318562_c1
1375 nmdc:mga08x19_909749_c1
1376 nmdc:mga0a205_207704_c1
1377 nmdc:mga0a205_438114_c1
1378 nmdc:mga0a205_73814_c1
1379 Ga0495601_0117061
1380 Ga0495601_0351519
1381 Ga0495612_0050814
1382 Ga0495655_0165961
1383 Ga0495595_0105846
1384 Ga0495619_0100695
1385 Ga0500627_0224366
1386 Ga0501084_0008305
1387 Ga0501084_0016296
1388 Ga0501084_0037225
1389 Ga0501084_0168723
1390 Ga0501084_0248393
1391 Ga0501084_0591535
1392 Ga0501084_0770687
1393 Ga0587067_021920
1394 Ga0501082_0026938
1395 Ga0501082_0045330
1396 Ga0501082_0131745
1397 Ga0501082_0156810
1398 Ga0501082_0266204
1399 Ga0501082_0338890
1400 Ga0501082_0536160
1401 Ga0501082_0604532
1402 Ga0501082_0903653
1403 Ga0466962_0286897
1404 Ga0530510_0093709
1405 Ga0530510_0421275
1406 Ga0530510_0462276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

4

159

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dhk-assembly2.cif.gz_B crystal structure of a deoxycytidine triphosphate deaminase (dctp deaminase) from burkholderia thailandensis 0.9272 4 156
4dhk-assembly1.cif.gz_A crystal structure of a deoxycytidine triphosphate deaminase (dctp deaminase) from burkholderia thailandensis 0.9267 4 168
3km3-assembly1.cif.gz_A crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.9204 3 158
3km3-assembly1.cif.gz_B crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.9184 3 157
3km3-assembly1.cif.gz_B crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.9017 3 157
ID Description Score Start End Superfamily
3km3A00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9204 3 158 2.70.40.10
3km3A00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8883 3 158 2.70.40.10
2yzjA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8338 6 157 2.70.40.10
4xjcF00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8263 3 180 2.70.40.10
2yzjA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8116 6 157 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A522ZRR5-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9608 81 184 GO:0006229
GO:0008829
GO:0015949
AF-A0A3N5MAB7-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9583 53 184 GO:0006229
GO:0008829
GO:0015949
AF-A0A317JAR1-F1-model_v4 dCTP deaminase 0.9579 64 184 GO:0006229
GO:0008829
GO:0015949
AF-A0A536XJE5-F1-model_v4 dCTP deaminase (EC 3.5.4.13) 0.9579 82 184 GO:0006229
GO:0008829
GO:0015949
AF-A0A656K9A9-F1-model_v4 deleted 0.9577 63 184

Map