F476243

General Info

Members Datasets Scaffolds Average Seq Length
702 295 1404 143

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_1185015|Ga0501081_1185015_26_529
Length 167
Sequence VSQPSLFGDVRGGAATASIDGGSRGNPGPAGYGVRIEDQDGNLIEELYGPLGIATNNVAEYNGLLAALKWAVDNGHQEVQVRADSELLVKQMRGEYKVKHPGLQPLAARARLLVGQLDDVTFQHVRREQNKDADRLSNLGMDEAEAALKAEREALPSPDDPEHPACS

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
181 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
227 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
228 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
253 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
254 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
259 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
260 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
261 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
262 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
267 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
268 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
269 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 2.99
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_1185015 3300049743 Bacteria 579
2 MBSR1b_contig_6862978 2162886012 Bacteria 1236
3 JGI25406J46586_10000979 3300003203 Bacteria 13428
4 Ga0065714_10090561 3300005288 Bacteria 1939
5 Ga0065712_10013891 3300005290 Bacteria 1937
6 Ga0065712_10407174 3300005290 Bacteria 725
7 Ga0065715_10003709 3300005293 Bacteria 5066
8 Ga0065715_10136340 3300005293 Bacteria 1924
9 Ga0065715_10173656 3300005293 Bacteria 1528
10 Ga0065715_10717562 3300005293 Unclassified 645
11 Ga0070676_10082635 3300005328 Bacteria 1952
12 Ga0070676_10277876 3300005328 Bacteria 1127
13 Ga0070676_10709408 3300005328 Bacteria 735
14 Ga0070690_100002447 3300005330 Bacteria 9979
15 Ga0070670_100005312 3300005331 Bacteria 10864
16 Ga0070670_100022441 3300005331 Bacteria 5432
17 Ga0070670_100077601 3300005331 Bacteria 2854
18 Ga0070670_100580090 3300005331 Bacteria 1002
19 Ga0070677_10125572 3300005333 Bacteria 1164
20 Ga0068869_100069500 3300005334 Bacteria 2604
21 Ga0068869_100075188 3300005334 Bacteria 2509
22 Ga0070680_100984878 3300005336 Bacteria 728
23 Ga0070660_100285801 3300005339 Bacteria 1350
24 Ga0070660_101805452 3300005339 Unclassified 521
25 Ga0070689_100014329 3300005340 Bacteria 5756
26 Ga0070689_100131326 3300005340 Bacteria 2008
27 Ga0070687_100068421 3300005343 Bacteria 1898
28 Ga0070661_100104445 3300005344 Bacteria 2111
29 Ga0070661_100564623 3300005344 Unclassified 917
30 Ga0070669_100087133 3300005353 Bacteria 2334
31 Ga0070669_100432637 3300005353 Bacteria 1082
32 Ga0070669_100519033 3300005353 Bacteria 990
33 Ga0070675_100001273 3300005354 Bacteria 18413
34 Ga0070675_100029788 3300005354 Bacteria 4404
35 Ga0070675_100036441 3300005354 Bacteria 4003
36 Ga0070675_100418994 3300005354 Bacteria 1197
37 Ga0070674_100064161 3300005356 Bacteria 2573
38 Ga0070674_100085964 3300005356 Bacteria 2258
39 Ga0070674_100256799 3300005356 Bacteria 1375
40 Ga0070674_100338039 3300005356 Bacteria 1212
41 Ga0070674_101396118 3300005356 Bacteria 627
42 Ga0070673_100009557 3300005364 Bacteria 6514
43 Ga0070673_100276726 3300005364 Bacteria 1471
44 Ga0070688_100086223 3300005365 Bacteria 2042
45 Ga0070688_100163490 3300005365 Bacteria 1531
46 Ga0070688_100195666 3300005365 Bacteria 1411
47 Ga0070688_100216754 3300005365 Bacteria 1347
48 Ga0070659_100066058 3300005366 Bacteria 2866
49 Ga0070659_100276099 3300005366 Bacteria 1397
50 Ga0070659_100477783 3300005366 Bacteria 1060
51 Ga0070659_101248411 3300005366 Unclassified 658
52 Ga0070667_100294270 3300005367 Bacteria 1461
53 Ga0070713_100035623 3300005436 Bacteria 4008
54 Ga0070701_10844287 3300005438 Bacteria 628
55 Ga0070705_100190530 3300005440 Bacteria 1397
56 Ga0070700_100489451 3300005441 Bacteria 944
57 Ga0070700_100649411 3300005441 Bacteria 833
58 Ga0070700_100812049 3300005441 Unclassified 754
59 Ga0070700_100960619 3300005441 Bacteria 700
60 Ga0070700_101164859 3300005441 Bacteria 642
61 Ga0070694_100365032 3300005444 Unclassified 1122
62 Ga0070694_100539357 3300005444 Unclassified 933
63 Ga0070694_101348523 3300005444 Unclassified 601
64 Ga0070663_100845939 3300005455 Unclassified 787
65 Ga0070678_100269941 3300005456 Bacteria 1434
66 Ga0070678_101000554 3300005456 Unclassified 768
67 Ga0070662_100075203 3300005457 Bacteria 2501
68 Ga0070681_10000707 3300005458 Bacteria 27711
69 Ga0070681_11618533 3300005458 Unclassified 573
70 Ga0068867_100206215 3300005459 Bacteria 1576
71 Ga0068867_100529761 3300005459 Unclassified 1017
72 Ga0068867_100659277 3300005459 Bacteria 919
73 Ga0068867_100915174 3300005459 Bacteria 790
74 Ga0070685_10071845 3300005466 Bacteria 2052
75 Ga0070706_100927483 3300005467 Unclassified 804
76 Ga0070707_100302850 3300005468 Bacteria 1553
77 Ga0070707_100407452 3300005468 Bacteria 1320
78 Ga0070698_100323025 3300005471 Bacteria 1474
79 Ga0070699_100193233 3300005518 Bacteria 1808
80 Ga0070679_100098541 3300005530 Bacteria 2910
81 Ga0070684_100011238 3300005535 Bacteria 7128
82 Ga0070684_101798347 3300005535 Bacteria 578
83 Ga0070697_100213287 3300005536 Unclassified 1644
84 Ga0070697_101432111 3300005536 Bacteria 617
85 Ga0068853_101315288 3300005539 Bacteria 699
86 Ga0070672_100695579 3300005543 Bacteria 890
87 Ga0070686_100006041 3300005544 Bacteria 6719
88 Ga0070695_100014662 3300005545 Bacteria 4725
89 Ga0070696_100080987 3300005546 Unclassified 2300
90 Ga0070696_100503044 3300005546 Bacteria 964
91 Ga0070696_100614504 3300005546 Unclassified 878
92 Ga0070693_100025253 3300005547 Bacteria 3196
93 Ga0070693_100295837 3300005547 Bacteria 1089
94 Ga0070693_100678584 3300005547 Bacteria 752
95 Ga0070665_100048224 3300005548 Bacteria 4277
96 Ga0070704_100141858 3300005549 Bacteria 1877
97 Ga0070704_100149994 3300005549 Bacteria 1832
98 Ga0070704_100477774 3300005549 Bacteria 1078
99 Ga0070704_101074082 3300005549 Unclassified 730
100 Ga0070704_102018163 3300005549 Unclassified 535
101 Ga0068855_100163234 3300005563 Bacteria 2527
102 Ga0070664_100012985 3300005564 Bacteria 6776
103 Ga0070664_100020610 3300005564 Bacteria 5429
104 Ga0070664_100101111 3300005564 Bacteria 2507
105 Ga0068857_100672560 3300005577 Bacteria 982
106 Ga0070702_100378927 3300005615 Unclassified 1005
107 Ga0068859_100050812 3300005617 Unclassified 4165
108 Ga0068859_100190033 3300005617 Bacteria 2138
109 Ga0068864_100128971 3300005618 Bacteria 2270
110 Ga0068864_100172475 3300005618 Bacteria 1973
111 Ga0068864_100408737 3300005618 Bacteria 1291
112 Ga0068861_100024894 3300005719 Bacteria 4334
113 Ga0068861_100164421 3300005719 Bacteria 1834
114 Ga0068861_100213989 3300005719 Bacteria 1625
115 Ga0068861_100292208 3300005719 Bacteria 1408
116 Ga0068861_100338738 3300005719 Bacteria 1316
117 Ga0068870_10409942 3300005840 Bacteria 884
118 Ga0068863_100277123 3300005841 Bacteria 1624
119 Ga0068858_100087175 3300005842 Bacteria 2903
120 Ga0068862_100139401 3300005844 Bacteria 2152
121 Ga0068862_100707820 3300005844 Bacteria 976
122 Ga0068862_101130877 3300005844 Bacteria 779
123 Ga0068862_101286904 3300005844 Bacteria 732
124 Ga0081455_10191513 3300005937 Bacteria 1539
125 Ga0081539_10001343 3300005985 Bacteria 42874
126 Ga0070717_10246319 3300006028 Archaea 1578
127 Ga0075365_10003248 3300006038 Bacteria 8331
128 Ga0075364_10116037 3300006051 Bacteria 1790
129 Ga0075432_10129378 3300006058 Bacteria 955
130 Ga0075367_10051275 3300006178 Bacteria 2438
131 Ga0075367_10839948 3300006178 Bacteria 585
132 Ga0097621_100892235 3300006237 Bacteria 828
133 Ga0075370_10726372 3300006353 Bacteria 604
134 Ga0075428_100000185 3300006844 Bacteria 58526
135 Ga0075428_100000262 3300006844 Bacteria 51841
136 Ga0075428_100002977 3300006844 Bacteria 18453
137 Ga0075428_100007993 3300006844 Bacteria 11731
138 Ga0075428_100010678 3300006844 Bacteria 10208
139 Ga0075428_100011168 3300006844 Bacteria 9994
140 Ga0075428_100013314 3300006844 Bacteria 9150
141 Ga0075428_100111828 3300006844 Bacteria 2975
142 Ga0075428_100629277 3300006844 Unclassified 1145
143 Ga0075428_101072113 3300006844 Bacteria 851
144 Ga0075428_101546375 3300006844 Unclassified 694
145 Ga0075430_100000264 3300006846 Bacteria 36933
146 Ga0075430_100001093 3300006846 Bacteria 21552
147 Ga0075430_100006056 3300006846 Bacteria 10195
148 Ga0075430_100131159 3300006846 Unclassified 2088
149 Ga0075430_100141521 3300006846 Bacteria 2003
150 Ga0075430_100265557 3300006846 Unclassified 1421
151 Ga0075430_100292468 3300006846 Bacteria 1347
152 Ga0075431_100004856 3300006847 Bacteria 13237
153 Ga0075431_100009353 3300006847 Bacteria 9838
154 Ga0075431_100024918 3300006847 Bacteria 6133
155 Ga0075431_100049396 3300006847 Bacteria 4337
156 Ga0075431_100110465 3300006847 Unclassified 2837
157 Ga0075431_100143240 3300006847 Unclassified 2463
158 Ga0075431_100171799 3300006847 Bacteria 2227
159 Ga0075431_100639431 3300006847 Bacteria 1045
160 Ga0075431_101653755 3300006847 Unclassified 597
161 Ga0075433_10002214 3300006852 Bacteria 14745
162 Ga0075433_10084600 3300006852 Bacteria 2800
163 Ga0075433_10425024 3300006852 Bacteria 1172
164 Ga0075434_100016289 3300006871 Bacteria 7144
165 Ga0075434_100137355 3300006871 Bacteria 2464
166 Ga0075434_100957838 3300006871 Bacteria 870
167 Ga0075429_100025021 3300006880 Bacteria 5182
168 Ga0075429_100055289 3300006880 Bacteria 3454
169 Ga0075429_100070446 3300006880 Bacteria 3045
170 Ga0075429_100186331 3300006880 Bacteria 1818
171 Ga0075429_100259670 3300006880 Unclassified 1521
172 Ga0075429_100596211 3300006880 Bacteria 968
173 Ga0075429_101462123 3300006880 Unclassified 595
174 Ga0068865_100353884 3300006881 Bacteria 1190
175 Ga0097620_100050813 3300006931 Unclassified 4165
176 Ga0097620_100190035 3300006931 Bacteria 2138
177 Ga0075435_100137781 3300007076 Bacteria 2046
178 Ga0075435_100412029 3300007076 Bacteria 1163
179 Ga0105240_10149408 3300009093 Bacteria 2785
180 Ga0111539_10000160 3300009094 Bacteria 76643
181 Ga0111539_10000368 3300009094 Bacteria 55696
182 Ga0111539_10009899 3300009094 Bacteria 12026
183 Ga0111539_10014576 3300009094 Bacteria 9815
184 Ga0111539_10017807 3300009094 Bacteria 8796
185 Ga0111539_10079662 3300009094 Bacteria 3853
186 Ga0111539_10148804 3300009094 Bacteria 2741
187 Ga0111539_10159535 3300009094 Bacteria 2638
188 Ga0111539_10163948 3300009094 Bacteria 2599
189 Ga0111539_10225317 3300009094 Bacteria 2184
190 Ga0111539_10329874 3300009094 Bacteria 1776
191 Ga0111539_10340826 3300009094 Bacteria 1745
192 Ga0111539_10448712 3300009094 Unclassified 1502
193 Ga0111539_10930018 3300009094 Bacteria 1011
194 Ga0111539_11093965 3300009094 Unclassified 926
195 Ga0105245_10368496 3300009098 Bacteria 1427
196 Ga0105245_11108633 3300009098 Bacteria 838
197 Ga0105245_11401689 3300009098 Bacteria 749
198 Ga0114129_10000101 3300009147 Bacteria 84064
199 Ga0114129_10000408 3300009147 Bacteria 50625
200 Ga0114129_10001674 3300009147 Bacteria 30207
201 Ga0114129_10005923 3300009147 Bacteria 17301
202 Ga0114129_10148287 3300009147 Bacteria 3212
203 Ga0114129_10172008 3300009147 Bacteria 2952
204 Ga0114129_10234072 3300009147 Bacteria 2473
205 Ga0114129_10378571 3300009147 Bacteria 1870
206 Ga0114129_10445857 3300009147 Bacteria 1698
207 Ga0114129_10545680 3300009147 Bacteria 1508
208 Ga0114129_11641994 3300009147 Bacteria 786
209 Ga0105241_10806113 3300009174 Bacteria 865
210 Ga0105242_10023012 3300009176 Bacteria 4909
211 Ga0105242_10127764 3300009176 Bacteria 2190
212 Ga0105242_11330047 3300009176 Bacteria 743
213 Ga0105248_10791984 3300009177 Bacteria 1070
214 Ga0105238_10021009 3300009551 Bacteria 6650
215 Ga0105249_10173233 3300009553 Bacteria 2094
216 Ga0105249_10300409 3300009553 Bacteria 1610
217 Ga0105249_10329931 3300009553 Bacteria 1539
218 Ga0105239_10418394 3300010375 Bacteria 1518
219 Ga0105239_11797045 3300010375 Bacteria 710
220 Ga0105246_11061660 3300011119 Bacteria 737
221 Ga0157373_11274634 3300013100 Unclassified 556
222 Ga0157378_10909757 3300013297 Bacteria 911
223 Ga0163162_11979307 3300013306 Bacteria 667
224 Ga0157375_10266901 3300013308 Bacteria 1873
225 Ga0163163_10102351 3300014325 Bacteria 2888
226 Ga0163163_10230591 3300014325 Bacteria 1901
227 Ga0163163_10760027 3300014325 Bacteria 1033
228 Ga0157380_10124085 3300014326 Bacteria 2192
229 Ga0157380_10322814 3300014326 Bacteria 1432
230 Ga0157380_10611681 3300014326 Bacteria 1080
231 Ga0157380_10886811 3300014326 Bacteria 917
232 Ga0157377_10048619 3300014745 Bacteria 2381
233 Ga0157377_10323506 3300014745 Bacteria 1025
234 Ga0157377_10451624 3300014745 Bacteria 887
235 Ga0157379_10059780 3300014968 Bacteria 3408
236 Ga0157376_11715103 3300014969 Bacteria 663
237 Ga0206356_11205859 3300020070 Unclassified 1478
238 Ga0207697_10040712 3300025315 Bacteria 1908
239 Ga0207682_10179728 3300025893 Bacteria 966
240 Ga0207645_10039357 3300025907 Bacteria 3029
241 Ga0207643_10162536 3300025908 Bacteria 1344
242 Ga0207643_10252565 3300025908 Bacteria 1086
243 Ga0207643_10296401 3300025908 Bacteria 1006
244 Ga0207643_10937363 3300025908 Bacteria 561
245 Ga0207643_11081882 3300025908 Bacteria 517
246 Ga0207654_10199339 3300025911 Bacteria 1317
247 Ga0207707_10021575 3300025912 Bacteria 5629
248 Ga0207707_10214128 3300025912 Bacteria 1678
249 Ga0207707_11237264 3300025912 Unclassified 603
250 Ga0207695_10043877 3300025913 Bacteria 4760
251 Ga0207695_10241598 3300025913 Bacteria 1707
252 Ga0207662_10075482 3300025918 Bacteria 2047
253 Ga0207657_10230999 3300025919 Bacteria 1479
254 Ga0207649_10084537 3300025920 Bacteria 2063
255 Ga0207649_10309021 3300025920 Bacteria 1158
256 Ga0207649_10728465 3300025920 Bacteria 770
257 Ga0207652_10346669 3300025921 Unclassified 1340
258 Ga0207646_10201526 3300025922 Bacteria 1798
259 Ga0207681_10077506 3300025923 Bacteria 2337
260 Ga0207681_10487779 3300025923 Bacteria 1007
261 Ga0207681_10717245 3300025923 Bacteria 832
262 Ga0207650_10010695 3300025925 Bacteria 6303
263 Ga0207650_10033326 3300025925 Bacteria 3730
264 Ga0207650_10058803 3300025925 Bacteria 2863
265 Ga0207650_10287252 3300025925 Bacteria 1340
266 Ga0207650_10456688 3300025925 Bacteria 1064
267 Ga0207650_10649401 3300025925 Bacteria 889
268 Ga0207659_10000610 3300025926 Bacteria 21345
269 Ga0207659_10032292 3300025926 Bacteria 3591
270 Ga0207659_10110356 3300025926 Bacteria 2090
271 Ga0207659_10957804 3300025926 Bacteria 736
272 Ga0207659_11416659 3300025926 Bacteria 595
273 Ga0207687_10598016 3300025927 Bacteria 929
274 Ga0207700_10304232 3300025928 Archaea 1378
275 Ga0207644_10507643 3300025931 Bacteria 995
276 Ga0207690_10048130 3300025932 Bacteria 2833
277 Ga0207690_10243111 3300025932 Bacteria 1387
278 Ga0207706_10266257 3300025933 Bacteria 1496
279 Ga0207706_10354983 3300025933 Bacteria 1274
280 Ga0207670_10011428 3300025936 Bacteria 5155
281 Ga0207670_10136235 3300025936 Bacteria 1805
282 Ga0207669_10021020 3300025937 Bacteria 3436
283 Ga0207669_10043020 3300025937 Bacteria 2642
284 Ga0207669_10271645 3300025937 Bacteria 1274
285 Ga0207669_10283854 3300025937 Bacteria 1250
286 Ga0207704_10855018 3300025938 Bacteria 763
287 Ga0207691_10651807 3300025940 Bacteria 890
288 Ga0207711_10255233 3300025941 Bacteria 1611
289 Ga0207689_10108668 3300025942 Bacteria 2279
290 Ga0207689_10154738 3300025942 Bacteria 1890
291 Ga0207689_10222720 3300025942 Bacteria 1559
292 Ga0207661_10011975 3300025944 Bacteria 6300
293 Ga0207661_10075903 3300025944 Bacteria 2759
294 Ga0207679_10024940 3300025945 Bacteria 4105
295 Ga0207679_10072952 3300025945 Bacteria 2595
296 Ga0207679_10237710 3300025945 Bacteria 1542
297 Ga0207667_10156968 3300025949 Bacteria 2341
298 Ga0207651_10003257 3300025960 Bacteria 7949
299 Ga0207651_10067435 3300025960 Bacteria 2518
300 Ga0207651_10693588 3300025960 Unclassified 897
301 Ga0207712_10140511 3300025961 Unclassified 1852
302 Ga0207712_10265254 3300025961 Bacteria 1394
303 Ga0207668_10843930 3300025972 Bacteria 813
304 Ga0207658_10309448 3300025986 Bacteria 1364
305 Ga0207658_10982168 3300025986 Bacteria 770
306 Ga0207703_10358819 3300026035 Bacteria 1344
307 Ga0207703_10425176 3300026035 Bacteria 1237
308 Ga0207639_10352104 3300026041 Bacteria 1315
309 Ga0207639_10725666 3300026041 Unclassified 923
310 Ga0207639_12197304 3300026041 Bacteria 513
311 Ga0207678_10096274 3300026067 Bacteria 2529
312 Ga0207678_10780136 3300026067 Unclassified 843
313 Ga0207708_10050146 3300026075 Bacteria 3178
314 Ga0207708_10296628 3300026075 Bacteria 1314
315 Ga0207708_10522741 3300026075 Bacteria 997
316 Ga0207708_10576270 3300026075 Bacteria 951
317 Ga0207708_11139230 3300026075 Unclassified 681
318 Ga0207641_11955386 3300026088 Archaea 588
319 Ga0207676_10053787 3300026095 Bacteria 3152
320 Ga0207676_10071294 3300026095 Bacteria 2789
321 Ga0207676_10161104 3300026095 Unclassified 1944
322 Ga0207676_10678892 3300026095 Bacteria 996
323 Ga0207676_10910536 3300026095 Bacteria 863
324 Ga0207674_10218686 3300026116 Bacteria 1853
325 Ga0207674_10575755 3300026116 Bacteria 1088
326 Ga0207675_100028747 3300026118 Bacteria 5179
327 Ga0207675_100099108 3300026118 Bacteria 2745
328 Ga0207675_100243974 3300026118 Bacteria 1736
329 Ga0207675_100258276 3300026118 Bacteria 1688
330 Ga0207675_100424861 3300026118 Bacteria 1313
331 Ga0207683_10207476 3300026121 Unclassified 1782
332 Ga0207683_10262375 3300026121 Bacteria 1577
333 Ga0207683_10275216 3300026121 Bacteria 1538
334 Ga0209970_1022016 3300027614 Bacteria 1081
335 Ga0209970_1024586 3300027614 Bacteria 1029
336 Ga0209983_1050769 3300027665 Bacteria 908
337 Ga0209971_1065508 3300027682 Bacteria 880
338 Ga0209974_10101527 3300027876 Bacteria 1006
339 Ga0209974_10308458 3300027876 Bacteria 607
340 Ga0209974_10391015 3300027876 Bacteria 545
341 Ga0207428_10000234 3300027907 Bacteria 76592
342 Ga0207428_10001318 3300027907 Bacteria 26410
343 Ga0207428_10001595 3300027907 Bacteria 23617
344 Ga0207428_10053535 3300027907 Bacteria 3217
345 Ga0207428_10096906 3300027907 Bacteria 2283
346 Ga0207428_10108475 3300027907 Bacteria 2138
347 Ga0207428_10273402 3300027907 Unclassified 1255
348 Ga0207428_10762129 3300027907 Bacteria 689
349 Ga0207428_11021296 3300027907 Unclassified 580
350 Ga0268265_10099477 3300028380 Bacteria 2345
351 Ga0268264_10267510 3300028381 Bacteria 1596
352 Ga0307408_100015730 3300031548 Bacteria 5041
353 Ga0307408_100034047 3300031548 Bacteria 3564
354 Ga0307408_100077279 3300031548 Unclassified 2479
355 Ga0307408_100087923 3300031548 Bacteria 2339
356 Ga0307408_100163453 3300031548 Unclassified 1770
357 Ga0307408_100272368 3300031548 Bacteria 1406
358 Ga0307408_100654887 3300031548 Bacteria 939
359 Ga0307408_100817746 3300031548 Bacteria 847
360 Ga0307408_101045995 3300031548 Bacteria 755
361 Ga0316578_10124409 3300031728 Bacteria 1551
362 Ga0307405_10030593 3300031731 Bacteria 3158
363 Ga0307405_10098926 3300031731 Bacteria 1951
364 Ga0307405_10166658 3300031731 Bacteria 1567
365 Ga0307405_10421707 3300031731 Bacteria 1050
366 Ga0307405_10660955 3300031731 Archaea 861
367 Ga0307405_10728057 3300031731 Bacteria 824
368 Ga0307405_11636902 3300031731 Bacteria 569
369 Ga0307413_10061534 3300031824 Bacteria 2317
370 Ga0307413_10099620 3300031824 Bacteria 1916
371 Ga0307413_10160966 3300031824 Bacteria 1577
372 Ga0307413_10498188 3300031824 Bacteria 977
373 Ga0307410_10006076 3300031852 Bacteria 6474
374 Ga0307410_10031584 3300031852 Bacteria 3400
375 Ga0307410_10053582 3300031852 Bacteria 2730
376 Ga0307410_10167915 3300031852 Bacteria 1650
377 Ga0307410_10431722 3300031852 Bacteria 1071
378 Ga0307410_10490246 3300031852 Bacteria 1009
379 Ga0307410_11265875 3300031852 Bacteria 644
380 Ga0307406_10073310 3300031901 Bacteria 2251
381 Ga0307406_10118454 3300031901 Bacteria 1836
382 Ga0307406_10147869 3300031901 Bacteria 1672
383 Ga0307406_10578066 3300031901 Bacteria 923
384 Ga0307406_10624890 3300031901 Bacteria 891
385 Ga0307407_10007607 3300031903 Bacteria 4915
386 Ga0307407_10009128 3300031903 Bacteria 4601
387 Ga0307407_10291529 3300031903 Bacteria 1134
388 Ga0307407_10461320 3300031903 Bacteria 924
389 Ga0307412_10054286 3300031911 Bacteria 2659
390 Ga0307412_10096989 3300031911 Bacteria 2076
391 Ga0307412_10131044 3300031911 Bacteria 1821
392 Ga0307412_10175312 3300031911 Bacteria 1607
393 Ga0307412_10291235 3300031911 Bacteria 1286
394 Ga0307412_10294036 3300031911 Unclassified 1281
395 Ga0307412_10445652 3300031911 Bacteria 1065
396 Ga0307412_10554333 3300031911 Bacteria 966
397 Ga0307409_100004156 3300031995 Bacteria 8061
398 Ga0307409_100021269 3300031995 Bacteria 4444
399 Ga0307409_100174238 3300031995 Bacteria 1897
400 Ga0307409_100209684 3300031995 Bacteria 1750
401 Ga0307409_100382975 3300031995 Unclassified 1338
402 Ga0307409_100506707 3300031995 Bacteria 1176
403 Ga0307409_100651314 3300031995 Bacteria 1047
404 Ga0307409_100957472 3300031995 Bacteria 872
405 Ga0307416_100002441 3300032002 Bacteria 10674
406 Ga0307416_100005244 3300032002 Bacteria 7927
407 Ga0307416_100008062 3300032002 Bacteria 6752
408 Ga0307416_100035301 3300032002 Unclassified 3817
409 Ga0307416_100069530 3300032002 Bacteria 2914
410 Ga0307416_100086897 3300032002 Bacteria 2667
411 Ga0307416_100329179 3300032002 Bacteria 1534
412 Ga0307416_100618083 3300032002 Bacteria 1165
413 Ga0307416_102247149 3300032002 Unclassified 646
414 Ga0307414_10255025 3300032004 Bacteria 1460
415 Ga0307414_10462013 3300032004 Bacteria 1116
416 Ga0307414_10944876 3300032004 Bacteria 792
417 Ga0307411_10001004 3300032005 Bacteria 10876
418 Ga0307411_10005742 3300032005 Bacteria 6135
419 Ga0307411_10061066 3300032005 Bacteria 2507
420 Ga0307411_10063303 3300032005 Bacteria 2471
421 Ga0307411_10198096 3300032005 Unclassified 1540
422 Ga0307411_10229481 3300032005 Bacteria 1446
423 Ga0307411_10399232 3300032005 Bacteria 1136
424 Ga0307411_10752143 3300032005 Bacteria 854
425 Ga0307415_100010614 3300032126 Bacteria 5224
426 Ga0307415_100048995 3300032126 Bacteria 2853
427 Ga0307415_100124647 3300032126 Bacteria 1939
428 Ga0307415_100306362 3300032126 Archaea 1318
429 Ga0307415_100930668 3300032126 Bacteria 803
430 Ga0373926_0122938 3300035083 Bacteria 979
431 Ga0373944_0269629 3300035089 Bacteria 632
432 Ga0373923_0431429 3300035111 Bacteria 637
433 Ga0373953_0105410 3300035117 Bacteria 1189
434 Ga0373943_0064045 3300035170 Bacteria 1845
435 Ga0373946_0050751 3300035171 Bacteria 1734
436 Ga0373946_0165758 3300035171 Bacteria 1040
437 Ga0373955_0408559 3300035172 Bacteria 825
438 Ga0373924_0404828 3300035410 Bacteria 610
439 Ga0373935_0488951 3300035692 Bacteria 892
440 Ga0373933_0258996 3300035724 Bacteria 1121
441 Ga0373947_0193132 3300035725 Bacteria 1329
442 Ga0373937_0021570 3300036401 Bacteria 5779
443 Ga0373937_0212876 3300036401 Bacteria 1819
444 Ga0373937_1858798 3300036401 Bacteria 548
445 Ga0373925_0023975 3300037068 Bacteria 4452
446 Ga0373925_0254085 3300037068 Unclassified 1410
447 Ga0395905_0506783 3300037471 Bacteria 1107
448 Ga0436365_1208974 3300039437 Bacteria 708
449 Ga0439450_017688 3300042008 Bacteria 1489
450 Ga0450913_013210 3300042117 Unclassified 691
451 Ga0450920_030380 3300042122 Bacteria 1062
452 Ga0450923_009367 3300042125 Bacteria 1711
453 Ga0450923_042369 3300042125 Bacteria 960
454 Ga0450895_000068 3300042132 Bacteria 3961
455 Ga0450895_027647 3300042132 Bacteria 545
456 Ga0450896_000240 3300042133 Bacteria 4986
457 Ga0450896_053903 3300042133 Unclassified 645
458 Ga0439446_0049001 3300042156 Unclassified 1259
459 Ga0439435_0033394 3300042436 Bacteria 1409
460 Ga0439435_0058852 3300042436 Bacteria 1115
461 Ga0439435_0167763 3300042436 Bacteria 712
462 Ga0439444_0091094 3300042437 Bacteria 680
463 Ga0439464_0000374 3300042439 Bacteria 8743
464 Ga0439464_0030634 3300042439 Bacteria 1507
465 Ga0439460_0015425 3300042461 Bacteria 2023
466 Ga0439460_0043740 3300042461 Bacteria 1324
467 Ga0450918_004259 3300042531 Bacteria 2618
468 Ga0451577_0038999 3300042876 Bacteria 4269
469 Ga0453684_0212901 3300044712 Bacteria 2245
470 Ga0451576_0746651 3300045051 Bacteria 1028
471 Ga0495653_0647215 3300046463 Unclassified 646
472 Ga0495608_0755513 3300046511 Archaea 576
473 Ga0495628_0719636 3300046516 Bacteria 704
474 Ga0495628_0912571 3300046516 Bacteria 609
475 Ga0495643_0007053 3300046522 Bacteria 7298
476 Ga0495642_0108080 3300046528 Bacteria 1188
477 Ga0495652_0380519 3300046529 Bacteria 1004
478 Ga0495587_0488388 3300046536 Unclassified 681
479 Ga0495598_0022533 3300046537 Bacteria 1687
480 Ga0495621_0044190 3300046539 Bacteria 1574
481 Ga0495621_0077174 3300046539 Bacteria 1237
482 Ga0495621_0146011 3300046539 Bacteria 928
483 Ga0495645_0410121 3300046543 Bacteria 862
484 Ga0495633_0064053 3300046558 Bacteria 1719
485 Ga0495656_0608813 3300046615 Bacteria 585
486 Ga0495634_0147647 3300046642 Archaea 1489
487 Ga0495635_0157594 3300046663 Bacteria 1545
488 Ga0495658_0118796 3300046683 Bacteria 1597
489 Ga0495658_1050116 3300046683 Bacteria 520
490 Ga0495669_0322966 3300046684 Bacteria 745
491 Ga0495600_0078091 3300046809 Bacteria 2162
492 Ga0495636_0424906 3300047318 Bacteria 636
493 Ga0495674_0137160 3300047319 Unclassified 2058
494 Ga0495684_0084606 3300047471 Bacteria 2406
495 Ga0496100_0142955 3300048903 Bacteria 1698
496 Ga0496101_0090165 3300048904 Bacteria 2280
497 Ga0496102_0403792 3300048905 Bacteria 1284
498 Ga0496103_0293521 3300048906 Bacteria 1046
499 Ga0496104_0007704 3300048907 Bacteria 9536
500 Ga0496104_0135045 3300048907 Bacteria 2370
501 Ga0496104_0338165 3300048907 Unclassified 1418
502 Ga0496105_0006357 3300048908 Bacteria 9075
503 Ga0496105_0170281 3300048908 Bacteria 1786
504 Ga0496106_0197195 3300048909 Bacteria 1602
505 Ga0496108_0304196 3300048911 Bacteria 1389
506 Ga0496109_0018822 3300048912 Bacteria 6075
507 Ga0496109_0114742 3300048912 Bacteria 2506
508 Ga0496109_0558193 3300048912 Bacteria 1080
509 Ga0496110_0612669 3300048913 Bacteria 987
510 Ga0496111_0001065 3300048914 Bacteria 15132
511 Ga0496111_0207968 3300048914 Bacteria 1454
512 Ga0496112_0000271 3300048915 Bacteria 33508
513 Ga0496112_0192515 3300048915 Bacteria 2000
514 Ga0496113_0233693 3300048916 Bacteria 1466
515 Ga0496114_0005483 3300048917 Bacteria 9929
516 Ga0501291_034085 3300049514 Bacteria 871
517 Ga0501293_006952 3300049516 Bacteria 931
518 Ga0501295_080943 3300049518 Bacteria 739
519 Ga0501036_0982442 3300049572 Bacteria 691
520 Ga0501037_0765133 3300049573 Bacteria 639
521 Ga0501038_0264774 3300049574 Bacteria 1357
522 Ga0501038_0754591 3300049574 Bacteria 726
523 Ga0501039_0073858 3300049575 Bacteria 2650
524 Ga0501039_0087703 3300049575 Bacteria 2424
525 Ga0501039_1170833 3300049575 Bacteria 595
526 Ga0501040_0078942 3300049576 Bacteria 2278
527 Ga0501040_0133999 3300049576 Bacteria 1743
528 Ga0501040_0235229 3300049576 Bacteria 1305
529 Ga0501040_0284003 3300049576 Bacteria 1182
530 Ga0501040_0569598 3300049576 Bacteria 818
531 Ga0501041_0037333 3300049577 Bacteria 2944
532 Ga0501041_0139186 3300049577 Bacteria 1513
533 Ga0501041_0163103 3300049577 Bacteria 1394
534 Ga0501041_0267975 3300049577 Bacteria 1074
535 Ga0501041_0725491 3300049577 Bacteria 636
536 Ga0501042_0109894 3300049578 Bacteria 1985
537 Ga0501042_0244693 3300049578 Unclassified 1294
538 Ga0501042_0279849 3300049578 Bacteria 1205
539 Ga0501042_0610937 3300049578 Bacteria 793
540 Ga0501043_0299431 3300049579 Bacteria 1229
541 Ga0501043_0593642 3300049579 Unclassified 819
542 Ga0501046_0143251 3300049580 Bacteria 1807
543 Ga0501047_0012943 3300049581 Bacteria 7900
544 Ga0501048_0179618 3300049582 Bacteria 1500
545 Ga0501069_0050722 3300049585 Bacteria 2308
546 Ga0501071_0567425 3300049587 Bacteria 872
547 Ga0501071_0766783 3300049587 Bacteria 743
548 Ga0501072_0047651 3300049588 Bacteria 3375
549 Ga0501072_0056393 3300049588 Bacteria 3096
550 Ga0501072_0129345 3300049588 Bacteria 2012
551 Ga0501072_0197500 3300049588 Bacteria 1604
552 Ga0501072_0886964 3300049588 Bacteria 697
553 Ga0501073_0276982 3300049589 Bacteria 1157
554 Ga0501073_0568460 3300049589 Bacteria 783
555 Ga0501074_0364211 3300049590 Bacteria 1026
556 Ga0501075_0013526 3300049591 Bacteria 5825
557 Ga0501075_0083135 3300049591 Bacteria 2425
558 Ga0501075_0126832 3300049591 Bacteria 1943
559 Ga0501075_0185398 3300049591 Bacteria 1587
560 Ga0501075_0951141 3300049591 Bacteria 653
561 Ga0501076_0020359 3300049592 Bacteria 5078
562 Ga0501076_0060578 3300049592 Bacteria 3011
563 Ga0501076_0062099 3300049592 Bacteria 2975
564 Ga0501076_0136569 3300049592 Bacteria 1991
565 Ga0501076_0258273 3300049592 Bacteria 1426
566 Ga0501076_0311756 3300049592 Bacteria 1290
567 Ga0501076_0471351 3300049592 Bacteria 1034
568 Ga0501076_0611759 3300049592 Bacteria 899
569 Ga0501077_0241117 3300049593 Bacteria 1149
570 Ga0501077_0481368 3300049593 Bacteria 795
571 Ga0501202_012703 3300049652 Bacteria 1593
572 Ga0501207_028483 3300049654 Bacteria 929
573 Ga0501216_025699 3300049660 Bacteria 1059
574 Ga0501217_056785 3300049661 Bacteria 1036
575 Ga0501224_052723 3300049664 Bacteria 626
576 Ga0501230_150553 3300049667 Unclassified 528
577 Ga0501233_052726 3300049668 Bacteria 989
578 Ga0501233_233747 3300049668 Bacteria 547
579 Ga0501235_066360 3300049669 Archaea 850
580 Ga0501235_210477 3300049669 Bacteria 530
581 Ga0501246_031719 3300049676 Bacteria 597
582 Ga0501249_084861 3300049679 Bacteria 747
583 Ga0501255_030624 3300049684 Bacteria 747
584 Ga0501257_232536 3300049686 Bacteria 541
585 Ga0501261_037824 3300049690 Bacteria 751
586 Ga0501221_077373 3300049704 Bacteria 795
587 Ga0501225_0176710 3300049705 Bacteria 665
588 Ga0501079_0015881 3300049741 Bacteria 5755
589 Ga0501079_0089167 3300049741 Bacteria 2388
590 Ga0501079_0386347 3300049741 Unclassified 1098
591 Ga0501079_0561527 3300049741 Bacteria 898
592 Ga0501080_0045127 3300049742 Bacteria 4103
593 Ga0501080_0070312 3300049742 Bacteria 3255
594 Ga0501080_0463610 3300049742 Bacteria 1135
595 Ga0501080_0466087 3300049742 Bacteria 1131
596 Ga0501081_0140318 3300049743 Bacteria 1732
597 Ga0501083_0722786 3300049744 Bacteria 648
598 Ga0501232_074566 3300049757 Bacteria 565
599 Ga0501279_038259 3300049775 Unclassified 729
600 Ga0501282_018447 3300049778 Unclassified 762
601 Ga0501283_113250 3300049779 Unclassified 538
602 Ga0501035_0461922 3300049822 Unclassified 1049
603 Ga0501044_0770925 3300049823 Bacteria 843
604 Ga0501045_0044873 3300049824 Bacteria 3220
605 Ga0501045_0061276 3300049824 Bacteria 2760
606 Ga0501045_0118266 3300049824 Bacteria 1967
607 Ga0501045_0452243 3300049824 Bacteria 955
608 Ga0501045_0474161 3300049824 Bacteria 930
609 nmdc:mga00v17_156625_c1 3300050491 Bacteria 1465
610 nmdc:mga0k408_2906_c2 3300050493 Bacteria 7704
611 nmdc:mga0k408_63437_c1 3300050493 Bacteria 2149
612 nmdc:mga06z11_414705_c1 3300050494 Bacteria 811
613 nmdc:mga06z11_722290_c1 3300050494 Bacteria 607
614 nmdc:mga06z11_906342_c1 3300050494 Bacteria 537
615 nmdc:mga04h51_99717_c1 3300050495 Bacteria 1057
616 nmdc:mga07m45_691684_c1 3300050496 Bacteria 587
617 nmdc:mga05p37_107937_c1 3300050507 Bacteria 3424
618 nmdc:mga05p37_11381_c1 3300050507 Bacteria 10588
619 nmdc:mga05p37_159635_c1 3300050507 Bacteria 2754
620 nmdc:mga05p37_1621833_c1 3300050507 Bacteria 636
621 nmdc:mga05p37_2057735_c1 3300050507 Bacteria 537
622 nmdc:mga05p37_213789_c1 3300050507 Bacteria 2330
623 nmdc:mga05p37_2745_c1 3300050507 Bacteria 20452
624 nmdc:mga05p37_3256_c1 3300050507 Bacteria 18915
625 nmdc:mga05p37_422504_c1 3300050507 Bacteria 1551
626 nmdc:mga05p37_558441_c1 3300050507 Bacteria 1301
627 nmdc:mga05p37_632648_c1 3300050507 Bacteria 1202
628 nmdc:mga09592_3132_c1 3300050508 Bacteria 13434
629 nmdc:mga09592_431398_c1 3300050508 Archaea 1138
630 nmdc:mga09592_438197_c1 3300050508 Bacteria 1128
631 nmdc:mga09592_54523_c1 3300050508 Unclassified 3378
632 nmdc:mga09592_948_c2 3300050508 Bacteria 15223
633 nmdc:mga0qj67_1514879_c1 3300050509 Unclassified 516
634 nmdc:mga0qj67_250597_c1 3300050509 Bacteria 1437
635 nmdc:mga0qj67_28137_c1 3300050509 Bacteria 4361
636 nmdc:mga0qj67_3297_c1 3300050509 Bacteria 11630
637 nmdc:mga0qj67_36349_c1 3300050509 Bacteria 3853
638 nmdc:mga0qj67_46538_c1 3300050509 Bacteria 3425
639 nmdc:mga0qj67_517877_c1 3300050509 Unclassified 958
640 nmdc:mga0qj67_73054_c1 3300050509 Bacteria 2739
641 nmdc:mga06r32_11879_c1 3300050510 Bacteria 7844
642 nmdc:mga06r32_135761_c1 3300050510 Bacteria 2435
643 nmdc:mga06r32_15303_c1 3300050510 Bacteria 6969
644 nmdc:mga06r32_156896_c1 3300050510 Bacteria 925
645 nmdc:mga06r32_219220_c1 3300050510 Bacteria 1891
646 nmdc:mga06r32_617166_c1 3300050510 Bacteria 1054
647 nmdc:mga06r32_7092_c1 3300050510 Bacteria 10090
648 nmdc:mga06r32_767346_c1 3300050510 Bacteria 926
649 nmdc:mga06r32_7731_c1 3300050510 Bacteria 9666
650 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
651 nmdc:mga08y16_1215_c1 3300050511 Bacteria 25486
652 nmdc:mga08y16_177755_c1 3300050511 Bacteria 2210
653 nmdc:mga08y16_200424_c1 3300050511 Bacteria 2068
654 nmdc:mga08y16_227618_c1 3300050511 Bacteria 1929
655 nmdc:mga08y16_30241_c1 3300050511 Bacteria 5701
656 nmdc:mga08y16_353_c1 3300050511 Bacteria 41478
657 nmdc:mga08y16_361493_c1 3300050511 Bacteria 1490
658 nmdc:mga08y16_362383_c1 3300050511 Bacteria 1488
659 nmdc:mga08y16_642914_c1 3300050511 Bacteria 1066
660 nmdc:mga08y16_80621_c1 3300050511 Bacteria 3394
661 nmdc:mga0n895_111818_c1 3300050512 Bacteria 2748
662 nmdc:mga0n895_1169837_c1 3300050512 Bacteria 744
663 nmdc:mga0n895_205497_c1 3300050512 Bacteria 2000
664 nmdc:mga0n895_21735_c1 3300050512 Bacteria 6005
665 nmdc:mga0rr50_1260932_c1 3300050513 Bacteria 627
666 nmdc:mga0rr50_57954_c1 3300050513 Bacteria 2900
667 nmdc:mga0rr50_66593_c1 3300050513 Bacteria 2733
668 nmdc:mga0rr50_842666_c1 3300050513 Unclassified 782
669 nmdc:mga0a205_136635_c1 3300050515 Bacteria 2352
670 nmdc:mga0a205_1526213_c1 3300050515 Bacteria 516
671 nmdc:mga0a205_17935_c1 3300050515 Bacteria 6645
672 nmdc:mga0a205_263751_c1 3300050515 Bacteria 1600
673 nmdc:mga0a205_28083_c1 3300050515 Bacteria 5377
674 nmdc:mga0a205_565560_c1 3300050515 Unclassified 991
675 Ga0495601_0036449 3300053077 Unclassified 3071
676 Ga0495601_0163172 3300053077 Bacteria 1456
677 Ga0495612_0038711 3300053078 Bacteria 1938
678 Ga0495619_0005735 3300053085 Bacteria 7870
679 Ga0501084_0067574 3300054114 Bacteria 2992
680 Ga0501084_0322688 3300054114 Bacteria 1304
681 Ga0501084_0356098 3300054114 Bacteria 1236
682 Ga0501084_0540248 3300054114 Bacteria 985
683 Ga0501084_0763135 3300054114 Bacteria 815
684 Ga0501084_1325487 3300054114 Bacteria 603
685 Ga0590071_000040 3300059421 Bacteria 32740
686 Ga0590071_000362 3300059421 Bacteria 13414
687 Ga0590071_052356 3300059421 Unclassified 991
688 Ga0590074_000925 3300059423 Bacteria 4590
689 Ga0590075_000500 3300059424 Bacteria 10643
690 Ga0590075_001932 3300059424 Bacteria 5019
691 Ga0590075_055841 3300059424 Bacteria 1015
692 Ga0590077_000209 3300059426 Bacteria 16935
693 Ga0590077_001909 3300059426 Bacteria 4609
694 Ga0501082_0168863 3300060353 Bacteria 1902
695 Ga0501082_0279375 3300060353 Bacteria 1454
696 Ga0501082_0347768 3300060353 Bacteria 1292
697 Ga0501082_0601261 3300060353 Bacteria 962
698 Ga0501082_1553924 3300060353 Bacteria 578
699 Ga0530510_0008426 3300061734 Bacteria 7186
700 Ga0530510_0093299 3300061734 Bacteria 2198
701 Ga0530510_0113459 3300061734 Bacteria 1986
702 Ga0530510_0503943 3300061734 Unclassified 918
703 Ga0501081_1185015
704 MBSR1b_contig_6862978
705 JGI25406J46586_10000979
706 Ga0065714_10090561
707 Ga0065712_10013891
708 Ga0065712_10407174
709 Ga0065715_10003709
710 Ga0065715_10136340
711 Ga0065715_10173656
712 Ga0065715_10717562
713 Ga0070676_10082635
714 Ga0070676_10277876
715 Ga0070676_10709408
716 Ga0070690_100002447
717 Ga0070670_100005312
718 Ga0070670_100022441
719 Ga0070670_100077601
720 Ga0070670_100580090
721 Ga0070677_10125572
722 Ga0068869_100069500
723 Ga0068869_100075188
724 Ga0070680_100984878
725 Ga0070660_100285801
726 Ga0070660_101805452
727 Ga0070689_100014329
728 Ga0070689_100131326
729 Ga0070687_100068421
730 Ga0070661_100104445
731 Ga0070661_100564623
732 Ga0070669_100087133
733 Ga0070669_100432637
734 Ga0070669_100519033
735 Ga0070675_100001273
736 Ga0070675_100029788
737 Ga0070675_100036441
738 Ga0070675_100418994
739 Ga0070674_100064161
740 Ga0070674_100085964
741 Ga0070674_100256799
742 Ga0070674_100338039
743 Ga0070674_101396118
744 Ga0070673_100009557
745 Ga0070673_100276726
746 Ga0070688_100086223
747 Ga0070688_100163490
748 Ga0070688_100195666
749 Ga0070688_100216754
750 Ga0070659_100066058
751 Ga0070659_100276099
752 Ga0070659_100477783
753 Ga0070659_101248411
754 Ga0070667_100294270
755 Ga0070713_100035623
756 Ga0070701_10844287
757 Ga0070705_100190530
758 Ga0070700_100489451
759 Ga0070700_100649411
760 Ga0070700_100812049
761 Ga0070700_100960619
762 Ga0070700_101164859
763 Ga0070694_100365032
764 Ga0070694_100539357
765 Ga0070694_101348523
766 Ga0070663_100845939
767 Ga0070678_100269941
768 Ga0070678_101000554
769 Ga0070662_100075203
770 Ga0070681_10000707
771 Ga0070681_11618533
772 Ga0068867_100206215
773 Ga0068867_100529761
774 Ga0068867_100659277
775 Ga0068867_100915174
776 Ga0070685_10071845
777 Ga0070706_100927483
778 Ga0070707_100302850
779 Ga0070707_100407452
780 Ga0070698_100323025
781 Ga0070699_100193233
782 Ga0070679_100098541
783 Ga0070684_100011238
784 Ga0070684_101798347
785 Ga0070697_100213287
786 Ga0070697_101432111
787 Ga0068853_101315288
788 Ga0070672_100695579
789 Ga0070686_100006041
790 Ga0070695_100014662
791 Ga0070696_100080987
792 Ga0070696_100503044
793 Ga0070696_100614504
794 Ga0070693_100025253
795 Ga0070693_100295837
796 Ga0070693_100678584
797 Ga0070665_100048224
798 Ga0070704_100141858
799 Ga0070704_100149994
800 Ga0070704_100477774
801 Ga0070704_101074082
802 Ga0070704_102018163
803 Ga0068855_100163234
804 Ga0070664_100012985
805 Ga0070664_100020610
806 Ga0070664_100101111
807 Ga0068857_100672560
808 Ga0070702_100378927
809 Ga0068859_100050812
810 Ga0068859_100190033
811 Ga0068864_100128971
812 Ga0068864_100172475
813 Ga0068864_100408737
814 Ga0068861_100024894
815 Ga0068861_100164421
816 Ga0068861_100213989
817 Ga0068861_100292208
818 Ga0068861_100338738
819 Ga0068870_10409942
820 Ga0068863_100277123
821 Ga0068858_100087175
822 Ga0068862_100139401
823 Ga0068862_100707820
824 Ga0068862_101130877
825 Ga0068862_101286904
826 Ga0081455_10191513
827 Ga0081539_10001343
828 Ga0070717_10246319
829 Ga0075365_10003248
830 Ga0075364_10116037
831 Ga0075432_10129378
832 Ga0075367_10051275
833 Ga0075367_10839948
834 Ga0097621_100892235
835 Ga0075370_10726372
836 Ga0075428_100000185
837 Ga0075428_100000262
838 Ga0075428_100002977
839 Ga0075428_100007993
840 Ga0075428_100010678
841 Ga0075428_100011168
842 Ga0075428_100013314
843 Ga0075428_100111828
844 Ga0075428_100629277
845 Ga0075428_101072113
846 Ga0075428_101546375
847 Ga0075430_100000264
848 Ga0075430_100001093
849 Ga0075430_100006056
850 Ga0075430_100131159
851 Ga0075430_100141521
852 Ga0075430_100265557
853 Ga0075430_100292468
854 Ga0075431_100004856
855 Ga0075431_100009353
856 Ga0075431_100024918
857 Ga0075431_100049396
858 Ga0075431_100110465
859 Ga0075431_100143240
860 Ga0075431_100171799
861 Ga0075431_100639431
862 Ga0075431_101653755
863 Ga0075433_10002214
864 Ga0075433_10084600
865 Ga0075433_10425024
866 Ga0075434_100016289
867 Ga0075434_100137355
868 Ga0075434_100957838
869 Ga0075429_100025021
870 Ga0075429_100055289
871 Ga0075429_100070446
872 Ga0075429_100186331
873 Ga0075429_100259670
874 Ga0075429_100596211
875 Ga0075429_101462123
876 Ga0068865_100353884
877 Ga0097620_100050813
878 Ga0097620_100190035
879 Ga0075435_100137781
880 Ga0075435_100412029
881 Ga0105240_10149408
882 Ga0111539_10000160
883 Ga0111539_10000368
884 Ga0111539_10009899
885 Ga0111539_10014576
886 Ga0111539_10017807
887 Ga0111539_10079662
888 Ga0111539_10148804
889 Ga0111539_10159535
890 Ga0111539_10163948
891 Ga0111539_10225317
892 Ga0111539_10329874
893 Ga0111539_10340826
894 Ga0111539_10448712
895 Ga0111539_10930018
896 Ga0111539_11093965
897 Ga0105245_10368496
898 Ga0105245_11108633
899 Ga0105245_11401689
900 Ga0114129_10000101
901 Ga0114129_10000408
902 Ga0114129_10001674
903 Ga0114129_10005923
904 Ga0114129_10148287
905 Ga0114129_10172008
906 Ga0114129_10234072
907 Ga0114129_10378571
908 Ga0114129_10445857
909 Ga0114129_10545680
910 Ga0114129_11641994
911 Ga0105241_10806113
912 Ga0105242_10023012
913 Ga0105242_10127764
914 Ga0105242_11330047
915 Ga0105248_10791984
916 Ga0105238_10021009
917 Ga0105249_10173233
918 Ga0105249_10300409
919 Ga0105249_10329931
920 Ga0105239_10418394
921 Ga0105239_11797045
922 Ga0105246_11061660
923 Ga0157373_11274634
924 Ga0157378_10909757
925 Ga0163162_11979307
926 Ga0157375_10266901
927 Ga0163163_10102351
928 Ga0163163_10230591
929 Ga0163163_10760027
930 Ga0157380_10124085
931 Ga0157380_10322814
932 Ga0157380_10611681
933 Ga0157380_10886811
934 Ga0157377_10048619
935 Ga0157377_10323506
936 Ga0157377_10451624
937 Ga0157379_10059780
938 Ga0157376_11715103
939 Ga0206356_11205859
940 Ga0207697_10040712
941 Ga0207682_10179728
942 Ga0207645_10039357
943 Ga0207643_10162536
944 Ga0207643_10252565
945 Ga0207643_10296401
946 Ga0207643_10937363
947 Ga0207643_11081882
948 Ga0207654_10199339
949 Ga0207707_10021575
950 Ga0207707_10214128
951 Ga0207707_11237264
952 Ga0207695_10043877
953 Ga0207695_10241598
954 Ga0207662_10075482
955 Ga0207657_10230999
956 Ga0207649_10084537
957 Ga0207649_10309021
958 Ga0207649_10728465
959 Ga0207652_10346669
960 Ga0207646_10201526
961 Ga0207681_10077506
962 Ga0207681_10487779
963 Ga0207681_10717245
964 Ga0207650_10010695
965 Ga0207650_10033326
966 Ga0207650_10058803
967 Ga0207650_10287252
968 Ga0207650_10456688
969 Ga0207650_10649401
970 Ga0207659_10000610
971 Ga0207659_10032292
972 Ga0207659_10110356
973 Ga0207659_10957804
974 Ga0207659_11416659
975 Ga0207687_10598016
976 Ga0207700_10304232
977 Ga0207644_10507643
978 Ga0207690_10048130
979 Ga0207690_10243111
980 Ga0207706_10266257
981 Ga0207706_10354983
982 Ga0207670_10011428
983 Ga0207670_10136235
984 Ga0207669_10021020
985 Ga0207669_10043020
986 Ga0207669_10271645
987 Ga0207669_10283854
988 Ga0207704_10855018
989 Ga0207691_10651807
990 Ga0207711_10255233
991 Ga0207689_10108668
992 Ga0207689_10154738
993 Ga0207689_10222720
994 Ga0207661_10011975
995 Ga0207661_10075903
996 Ga0207679_10024940
997 Ga0207679_10072952
998 Ga0207679_10237710
999 Ga0207667_10156968
1000 Ga0207651_10003257
1001 Ga0207651_10067435
1002 Ga0207651_10693588
1003 Ga0207712_10140511
1004 Ga0207712_10265254
1005 Ga0207668_10843930
1006 Ga0207658_10309448
1007 Ga0207658_10982168
1008 Ga0207703_10358819
1009 Ga0207703_10425176
1010 Ga0207639_10352104
1011 Ga0207639_10725666
1012 Ga0207639_12197304
1013 Ga0207678_10096274
1014 Ga0207678_10780136
1015 Ga0207708_10050146
1016 Ga0207708_10296628
1017 Ga0207708_10522741
1018 Ga0207708_10576270
1019 Ga0207708_11139230
1020 Ga0207641_11955386
1021 Ga0207676_10053787
1022 Ga0207676_10071294
1023 Ga0207676_10161104
1024 Ga0207676_10678892
1025 Ga0207676_10910536
1026 Ga0207674_10218686
1027 Ga0207674_10575755
1028 Ga0207675_100028747
1029 Ga0207675_100099108
1030 Ga0207675_100243974
1031 Ga0207675_100258276
1032 Ga0207675_100424861
1033 Ga0207683_10207476
1034 Ga0207683_10262375
1035 Ga0207683_10275216
1036 Ga0209970_1022016
1037 Ga0209970_1024586
1038 Ga0209983_1050769
1039 Ga0209971_1065508
1040 Ga0209974_10101527
1041 Ga0209974_10308458
1042 Ga0209974_10391015
1043 Ga0207428_10000234
1044 Ga0207428_10001318
1045 Ga0207428_10001595
1046 Ga0207428_10053535
1047 Ga0207428_10096906
1048 Ga0207428_10108475
1049 Ga0207428_10273402
1050 Ga0207428_10762129
1051 Ga0207428_11021296
1052 Ga0268265_10099477
1053 Ga0268264_10267510
1054 Ga0307408_100015730
1055 Ga0307408_100034047
1056 Ga0307408_100077279
1057 Ga0307408_100087923
1058 Ga0307408_100163453
1059 Ga0307408_100272368
1060 Ga0307408_100654887
1061 Ga0307408_100817746
1062 Ga0307408_101045995
1063 Ga0316578_10124409
1064 Ga0307405_10030593
1065 Ga0307405_10098926
1066 Ga0307405_10166658
1067 Ga0307405_10421707
1068 Ga0307405_10660955
1069 Ga0307405_10728057
1070 Ga0307405_11636902
1071 Ga0307413_10061534
1072 Ga0307413_10099620
1073 Ga0307413_10160966
1074 Ga0307413_10498188
1075 Ga0307410_10006076
1076 Ga0307410_10031584
1077 Ga0307410_10053582
1078 Ga0307410_10167915
1079 Ga0307410_10431722
1080 Ga0307410_10490246
1081 Ga0307410_11265875
1082 Ga0307406_10073310
1083 Ga0307406_10118454
1084 Ga0307406_10147869
1085 Ga0307406_10578066
1086 Ga0307406_10624890
1087 Ga0307407_10007607
1088 Ga0307407_10009128
1089 Ga0307407_10291529
1090 Ga0307407_10461320
1091 Ga0307412_10054286
1092 Ga0307412_10096989
1093 Ga0307412_10131044
1094 Ga0307412_10175312
1095 Ga0307412_10291235
1096 Ga0307412_10294036
1097 Ga0307412_10445652
1098 Ga0307412_10554333
1099 Ga0307409_100004156
1100 Ga0307409_100021269
1101 Ga0307409_100174238
1102 Ga0307409_100209684
1103 Ga0307409_100382975
1104 Ga0307409_100506707
1105 Ga0307409_100651314
1106 Ga0307409_100957472
1107 Ga0307416_100002441
1108 Ga0307416_100005244
1109 Ga0307416_100008062
1110 Ga0307416_100035301
1111 Ga0307416_100069530
1112 Ga0307416_100086897
1113 Ga0307416_100329179
1114 Ga0307416_100618083
1115 Ga0307416_102247149
1116 Ga0307414_10255025
1117 Ga0307414_10462013
1118 Ga0307414_10944876
1119 Ga0307411_10001004
1120 Ga0307411_10005742
1121 Ga0307411_10061066
1122 Ga0307411_10063303
1123 Ga0307411_10198096
1124 Ga0307411_10229481
1125 Ga0307411_10399232
1126 Ga0307411_10752143
1127 Ga0307415_100010614
1128 Ga0307415_100048995
1129 Ga0307415_100124647
1130 Ga0307415_100306362
1131 Ga0307415_100930668
1132 Ga0373926_0122938
1133 Ga0373944_0269629
1134 Ga0373923_0431429
1135 Ga0373953_0105410
1136 Ga0373943_0064045
1137 Ga0373946_0050751
1138 Ga0373946_0165758
1139 Ga0373955_0408559
1140 Ga0373924_0404828
1141 Ga0373935_0488951
1142 Ga0373933_0258996
1143 Ga0373947_0193132
1144 Ga0373937_0021570
1145 Ga0373937_0212876
1146 Ga0373937_1858798
1147 Ga0373925_0023975
1148 Ga0373925_0254085
1149 Ga0395905_0506783
1150 Ga0436365_1208974
1151 Ga0439450_017688
1152 Ga0450913_013210
1153 Ga0450920_030380
1154 Ga0450923_009367
1155 Ga0450923_042369
1156 Ga0450895_000068
1157 Ga0450895_027647
1158 Ga0450896_000240
1159 Ga0450896_053903
1160 Ga0439446_0049001
1161 Ga0439435_0033394
1162 Ga0439435_0058852
1163 Ga0439435_0167763
1164 Ga0439444_0091094
1165 Ga0439464_0000374
1166 Ga0439464_0030634
1167 Ga0439460_0015425
1168 Ga0439460_0043740
1169 Ga0450918_004259
1170 Ga0451577_0038999
1171 Ga0453684_0212901
1172 Ga0451576_0746651
1173 Ga0495653_0647215
1174 Ga0495608_0755513
1175 Ga0495628_0719636
1176 Ga0495628_0912571
1177 Ga0495643_0007053
1178 Ga0495642_0108080
1179 Ga0495652_0380519
1180 Ga0495587_0488388
1181 Ga0495598_0022533
1182 Ga0495621_0044190
1183 Ga0495621_0077174
1184 Ga0495621_0146011
1185 Ga0495645_0410121
1186 Ga0495633_0064053
1187 Ga0495656_0608813
1188 Ga0495634_0147647
1189 Ga0495635_0157594
1190 Ga0495658_0118796
1191 Ga0495658_1050116
1192 Ga0495669_0322966
1193 Ga0495600_0078091
1194 Ga0495636_0424906
1195 Ga0495674_0137160
1196 Ga0495684_0084606
1197 Ga0496100_0142955
1198 Ga0496101_0090165
1199 Ga0496102_0403792
1200 Ga0496103_0293521
1201 Ga0496104_0007704
1202 Ga0496104_0135045
1203 Ga0496104_0338165
1204 Ga0496105_0006357
1205 Ga0496105_0170281
1206 Ga0496106_0197195
1207 Ga0496108_0304196
1208 Ga0496109_0018822
1209 Ga0496109_0114742
1210 Ga0496109_0558193
1211 Ga0496110_0612669
1212 Ga0496111_0001065
1213 Ga0496111_0207968
1214 Ga0496112_0000271
1215 Ga0496112_0192515
1216 Ga0496113_0233693
1217 Ga0496114_0005483
1218 Ga0501291_034085
1219 Ga0501293_006952
1220 Ga0501295_080943
1221 Ga0501036_0982442
1222 Ga0501037_0765133
1223 Ga0501038_0264774
1224 Ga0501038_0754591
1225 Ga0501039_0073858
1226 Ga0501039_0087703
1227 Ga0501039_1170833
1228 Ga0501040_0078942
1229 Ga0501040_0133999
1230 Ga0501040_0235229
1231 Ga0501040_0284003
1232 Ga0501040_0569598
1233 Ga0501041_0037333
1234 Ga0501041_0139186
1235 Ga0501041_0163103
1236 Ga0501041_0267975
1237 Ga0501041_0725491
1238 Ga0501042_0109894
1239 Ga0501042_0244693
1240 Ga0501042_0279849
1241 Ga0501042_0610937
1242 Ga0501043_0299431
1243 Ga0501043_0593642
1244 Ga0501046_0143251
1245 Ga0501047_0012943
1246 Ga0501048_0179618
1247 Ga0501069_0050722
1248 Ga0501071_0567425
1249 Ga0501071_0766783
1250 Ga0501072_0047651
1251 Ga0501072_0056393
1252 Ga0501072_0129345
1253 Ga0501072_0197500
1254 Ga0501072_0886964
1255 Ga0501073_0276982
1256 Ga0501073_0568460
1257 Ga0501074_0364211
1258 Ga0501075_0013526
1259 Ga0501075_0083135
1260 Ga0501075_0126832
1261 Ga0501075_0185398
1262 Ga0501075_0951141
1263 Ga0501076_0020359
1264 Ga0501076_0060578
1265 Ga0501076_0062099
1266 Ga0501076_0136569
1267 Ga0501076_0258273
1268 Ga0501076_0311756
1269 Ga0501076_0471351
1270 Ga0501076_0611759
1271 Ga0501077_0241117
1272 Ga0501077_0481368
1273 Ga0501202_012703
1274 Ga0501207_028483
1275 Ga0501216_025699
1276 Ga0501217_056785
1277 Ga0501224_052723
1278 Ga0501230_150553
1279 Ga0501233_052726
1280 Ga0501233_233747
1281 Ga0501235_066360
1282 Ga0501235_210477
1283 Ga0501246_031719
1284 Ga0501249_084861
1285 Ga0501255_030624
1286 Ga0501257_232536
1287 Ga0501261_037824
1288 Ga0501221_077373
1289 Ga0501225_0176710
1290 Ga0501079_0015881
1291 Ga0501079_0089167
1292 Ga0501079_0386347
1293 Ga0501079_0561527
1294 Ga0501080_0045127
1295 Ga0501080_0070312
1296 Ga0501080_0463610
1297 Ga0501080_0466087
1298 Ga0501081_0140318
1299 Ga0501083_0722786
1300 Ga0501232_074566
1301 Ga0501279_038259
1302 Ga0501282_018447
1303 Ga0501283_113250
1304 Ga0501035_0461922
1305 Ga0501044_0770925
1306 Ga0501045_0044873
1307 Ga0501045_0061276
1308 Ga0501045_0118266
1309 Ga0501045_0452243
1310 Ga0501045_0474161
1311 nmdc:mga00v17_156625_c1
1312 nmdc:mga0k408_2906_c2
1313 nmdc:mga0k408_63437_c1
1314 nmdc:mga06z11_414705_c1
1315 nmdc:mga06z11_722290_c1
1316 nmdc:mga06z11_906342_c1
1317 nmdc:mga04h51_99717_c1
1318 nmdc:mga07m45_691684_c1
1319 nmdc:mga05p37_107937_c1
1320 nmdc:mga05p37_11381_c1
1321 nmdc:mga05p37_159635_c1
1322 nmdc:mga05p37_1621833_c1
1323 nmdc:mga05p37_2057735_c1
1324 nmdc:mga05p37_213789_c1
1325 nmdc:mga05p37_2745_c1
1326 nmdc:mga05p37_3256_c1
1327 nmdc:mga05p37_422504_c1
1328 nmdc:mga05p37_558441_c1
1329 nmdc:mga05p37_632648_c1
1330 nmdc:mga09592_3132_c1
1331 nmdc:mga09592_431398_c1
1332 nmdc:mga09592_438197_c1
1333 nmdc:mga09592_54523_c1
1334 nmdc:mga09592_948_c2
1335 nmdc:mga0qj67_1514879_c1
1336 nmdc:mga0qj67_250597_c1
1337 nmdc:mga0qj67_28137_c1
1338 nmdc:mga0qj67_3297_c1
1339 nmdc:mga0qj67_36349_c1
1340 nmdc:mga0qj67_46538_c1
1341 nmdc:mga0qj67_517877_c1
1342 nmdc:mga0qj67_73054_c1
1343 nmdc:mga06r32_11879_c1
1344 nmdc:mga06r32_135761_c1
1345 nmdc:mga06r32_15303_c1
1346 nmdc:mga06r32_156896_c1
1347 nmdc:mga06r32_219220_c1
1348 nmdc:mga06r32_617166_c1
1349 nmdc:mga06r32_7092_c1
1350 nmdc:mga06r32_767346_c1
1351 nmdc:mga06r32_7731_c1
1352 nmdc:mga08y16_10_c1
1353 nmdc:mga08y16_1215_c1
1354 nmdc:mga08y16_177755_c1
1355 nmdc:mga08y16_200424_c1
1356 nmdc:mga08y16_227618_c1
1357 nmdc:mga08y16_30241_c1
1358 nmdc:mga08y16_353_c1
1359 nmdc:mga08y16_361493_c1
1360 nmdc:mga08y16_362383_c1
1361 nmdc:mga08y16_642914_c1
1362 nmdc:mga08y16_80621_c1
1363 nmdc:mga0n895_111818_c1
1364 nmdc:mga0n895_1169837_c1
1365 nmdc:mga0n895_205497_c1
1366 nmdc:mga0n895_21735_c1
1367 nmdc:mga0rr50_1260932_c1
1368 nmdc:mga0rr50_57954_c1
1369 nmdc:mga0rr50_66593_c1
1370 nmdc:mga0rr50_842666_c1
1371 nmdc:mga0a205_136635_c1
1372 nmdc:mga0a205_1526213_c1
1373 nmdc:mga0a205_17935_c1
1374 nmdc:mga0a205_263751_c1
1375 nmdc:mga0a205_28083_c1
1376 nmdc:mga0a205_565560_c1
1377 Ga0495601_0036449
1378 Ga0495601_0163172
1379 Ga0495612_0038711
1380 Ga0495619_0005735
1381 Ga0501084_0067574
1382 Ga0501084_0322688
1383 Ga0501084_0356098
1384 Ga0501084_0540248
1385 Ga0501084_0763135
1386 Ga0501084_1325487
1387 Ga0590071_000040
1388 Ga0590071_000362
1389 Ga0590071_052356
1390 Ga0590074_000925
1391 Ga0590075_000500
1392 Ga0590075_001932
1393 Ga0590075_055841
1394 Ga0590077_000209
1395 Ga0590077_001909
1396 Ga0501082_0168863
1397 Ga0501082_0279375
1398 Ga0501082_0347768
1399 Ga0501082_0601261
1400 Ga0501082_1553924
1401 Ga0530510_0008426
1402 Ga0530510_0093299
1403 Ga0530510_0113459
1404 Ga0530510_0503943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13456

RVT_3

Reverse transcriptase-like

18

140

0.97

PF00075

RNase_H

RNase H

14

142

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9694 2 129
4e19-assembly2.cif.gz_B crystal structure of rnase h1 from halophilic archaeon halobacterium salinarum nrc-1 0.9634 2 129
4h8k-assembly1.cif.gz_B crystal structure of lc11-rnase h1 in complex with rna/dna hybrid 0.9469 1 131
3u3g-assembly3.cif.gz_C structure of lc11-rnase h1 isolated from compost by metagenomic approach: insight into the structural bases for unusual enzymatic properties of sto-rnase h1 0.9435 1 131
3hst-assembly4.cif.gz_D n-terminal rnase h domain of rv2228c from mycobacterium tuberculosis as a fusion protein with maltose binding protein 0.9408 2 129
ID Description Score Start End Superfamily
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9883 1 129 3.30.420.10
3hstD00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9694 2 129 3.30.420.10
af_A0A0P0X025_51_179_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9635 2 127 3.30.420.10
4e19A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9622 2 129 3.30.420.10
af_A0A0R0FBC1_213_345_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9518 1 129 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2V8IWV3-F1-model_v4 Ribonuclease H 1.002 2 138 GO:0003676
GO:0004523
AF-A0A1S4BH65-F1-model_v4 Uncharacterized protein Mb2253c-like isoform X7 0.9937 2 128 GO:0003676
GO:0004523
AF-A0A453QD94-F1-model_v4 RNase H type-1 domain-containing protein 0.9927 2 78 GO:0003676
GO:0004523
AF-A0A2K3P743-F1-model_v4 Ribonuclease H 0.9923 2 68 GO:0003676
GO:0004523
AF-A0A2E4KM01-F1-model_v4 RNase H type-1 domain-containing protein 0.9918 1 114 GO:0003676
GO:0004523

Map