F476199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 702 | 254 | 1404 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100779626|Ga0070690_1007796262 |
| Length | 100 |
| Sequence | MVWQLVLPERSNDMGNTINQRQSLVSKLDSLSETELQEVLDYVSMIESLRRPKGSAVIEEELLVALADAHENRRARQAFEWESVRRKAERRATVRATNHF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 195 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 212 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 214 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 215 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 217 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 218 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 219 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 220 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 223 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 224 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 225 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 226 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 227 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 229 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 232 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 233 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 235 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 236 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 237 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 238 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 239 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 243 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 246 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 247 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 254 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 95.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 39.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100779626 | 3300005330 | Bacteria | 740 |
| 2 | SwRhRL2b_contig_1180576 | 2162886007 | Bacteria | 1294 |
| 3 | SwRhRL2b_contig_858736 | 2162886007 | Bacteria | 1252 |
| 4 | MRS1b_contig_2665146 | 2162886011 | Bacteria | 1277 |
| 5 | MBSR1b_contig_10732066 | 2162886012 | Bacteria | 1190 |
| 6 | CNAas_1001037 | 3300000532 | Bacteria | 2564 |
| 7 | JGI25406J46586_10004686 | 3300003203 | Bacteria | 6363 |
| 8 | rootH1_10116221 | 3300003316 | Bacteria | 1374 |
| 9 | Ga0065714_10064469 | 3300005288 | Bacteria | 61986 |
| 10 | Ga0065704_10132086 | 3300005289 | Bacteria | 1616 |
| 11 | Ga0065704_10227211 | 3300005289 | Bacteria | 1055 |
| 12 | Ga0065712_10000127 | 3300005290 | Bacteria | 117106 |
| 13 | Ga0065712_10073065 | 3300005290 | Bacteria | 4514 |
| 14 | Ga0065712_10095724 | 3300005290 | Bacteria | 2195 |
| 15 | Ga0065715_10003383 | 3300005293 | Bacteria | 4451 |
| 16 | Ga0065715_10010224 | 3300005293 | Bacteria | 2627 |
| 17 | Ga0065715_10059994 | 3300005293 | Unclassified | 745 |
| 18 | Ga0065715_10089915 | 3300005293 | Bacteria | 8144 |
| 19 | Ga0065715_10195111 | 3300005293 | Bacteria | 1392 |
| 20 | Ga0065715_10214709 | 3300005293 | Bacteria | 1298 |
| 21 | Ga0065715_10251952 | 3300005293 | Unclassified | 1163 |
| 22 | Ga0065715_10611210 | 3300005293 | Unclassified | 701 |
| 23 | Ga0065715_10774008 | 3300005293 | Bacteria | 585 |
| 24 | Ga0065707_10022770 | 3300005295 | Unclassified | 1382 |
| 25 | Ga0065707_10046589 | 3300005295 | Bacteria | 928 |
| 26 | Ga0065707_10092069 | 3300005295 | Bacteria | 3832 |
| 27 | Ga0065707_10094820 | 3300005295 | Bacteria | 3449 |
| 28 | Ga0065707_10246404 | 3300005295 | Unclassified | 1139 |
| 29 | Ga0070676_10584956 | 3300005328 | Bacteria | 803 |
| 30 | Ga0070676_10749521 | 3300005328 | Unclassified | 717 |
| 31 | Ga0070683_100662601 | 3300005329 | Unclassified | 999 |
| 32 | Ga0070690_100014691 | 3300005330 | Unclassified | 4649 |
| 33 | Ga0070690_100033178 | 3300005330 | Bacteria | 3229 |
| 34 | Ga0070690_100186456 | 3300005330 | Bacteria | 1436 |
| 35 | Ga0070670_100177057 | 3300005331 | Bacteria | 1851 |
| 36 | Ga0070670_100436315 | 3300005331 | Bacteria | 1159 |
| 37 | Ga0068869_100063021 | 3300005334 | Bacteria | 2722 |
| 38 | Ga0068869_100113181 | 3300005334 | Bacteria | 2066 |
| 39 | Ga0068869_100201903 | 3300005334 | Unclassified | 1568 |
| 40 | Ga0068869_100363006 | 3300005334 | Unclassified | 1183 |
| 41 | Ga0068869_100377077 | 3300005334 | Bacteria | 1162 |
| 42 | Ga0068869_101848775 | 3300005334 | Bacteria | 541 |
| 43 | Ga0068869_102005076 | 3300005334 | Unclassified | 519 |
| 44 | Ga0068869_102017625 | 3300005334 | Unclassified | 518 |
| 45 | Ga0070666_10071275 | 3300005335 | Bacteria | 2365 |
| 46 | Ga0070666_10456126 | 3300005335 | Bacteria | 923 |
| 47 | Ga0070666_10868004 | 3300005335 | Bacteria | 666 |
| 48 | Ga0070680_100018133 | 3300005336 | Bacteria | 5561 |
| 49 | Ga0070680_100263495 | 3300005336 | Unclassified | 1458 |
| 50 | Ga0070680_100353134 | 3300005336 | Bacteria | 1250 |
| 51 | Ga0070682_101103491 | 3300005337 | Unclassified | 664 |
| 52 | Ga0068868_100071815 | 3300005338 | Bacteria | 2761 |
| 53 | Ga0068868_100076234 | 3300005338 | Bacteria | 2681 |
| 54 | Ga0070660_100178757 | 3300005339 | Bacteria | 1716 |
| 55 | Ga0070660_100340664 | 3300005339 | Bacteria | 1234 |
| 56 | Ga0070660_101561547 | 3300005339 | Unclassified | 561 |
| 57 | Ga0070689_100281633 | 3300005340 | Bacteria | 1379 |
| 58 | Ga0070687_100008341 | 3300005343 | Bacteria | 4382 |
| 59 | Ga0070687_100063043 | 3300005343 | Bacteria | 1964 |
| 60 | Ga0070687_100176340 | 3300005343 | Unclassified | 1277 |
| 61 | Ga0070661_100232674 | 3300005344 | Bacteria | 1417 |
| 62 | Ga0070692_10095860 | 3300005345 | Bacteria | 1620 |
| 63 | Ga0070692_10171147 | 3300005345 | Unclassified | 1252 |
| 64 | Ga0070692_10351304 | 3300005345 | Unclassified | 916 |
| 65 | Ga0070692_10848765 | 3300005345 | Unclassified | 627 |
| 66 | Ga0070692_11173971 | 3300005345 | Unclassified | 545 |
| 67 | Ga0070692_11391236 | 3300005345 | Unclassified | 506 |
| 68 | Ga0070669_100034434 | 3300005353 | Bacteria | 3666 |
| 69 | Ga0070675_100025557 | 3300005354 | Unclassified | 4734 |
| 70 | Ga0070671_100041021 | 3300005355 | Bacteria | 3846 |
| 71 | Ga0070674_100145466 | 3300005356 | Bacteria | 1784 |
| 72 | Ga0070674_100202914 | 3300005356 | Bacteria | 1532 |
| 73 | Ga0070674_100299531 | 3300005356 | Bacteria | 1281 |
| 74 | Ga0070674_102025453 | 3300005356 | Bacteria | 524 |
| 75 | Ga0070673_100069575 | 3300005364 | Bacteria | 2821 |
| 76 | Ga0070673_100243588 | 3300005364 | Bacteria | 1564 |
| 77 | Ga0070673_100326175 | 3300005364 | Bacteria | 1357 |
| 78 | Ga0070673_101233740 | 3300005364 | Unclassified | 701 |
| 79 | Ga0070673_101821172 | 3300005364 | Unclassified | 577 |
| 80 | Ga0070673_101932771 | 3300005364 | Unclassified | 560 |
| 81 | Ga0070688_100872965 | 3300005365 | Unclassified | 708 |
| 82 | Ga0070659_100078773 | 3300005366 | Bacteria | 2629 |
| 83 | Ga0070659_100689395 | 3300005366 | Bacteria | 883 |
| 84 | Ga0070659_100811565 | 3300005366 | Bacteria | 814 |
| 85 | Ga0070659_100953233 | 3300005366 | Unclassified | 752 |
| 86 | Ga0070667_100171259 | 3300005367 | Bacteria | 1917 |
| 87 | Ga0070667_101309336 | 3300005367 | Bacteria | 679 |
| 88 | Ga0070703_10375006 | 3300005406 | Unclassified | 613 |
| 89 | Ga0070701_10066043 | 3300005438 | Bacteria | 1921 |
| 90 | Ga0070701_10205016 | 3300005438 | Bacteria | 1168 |
| 91 | Ga0070701_10424372 | 3300005438 | Bacteria | 848 |
| 92 | Ga0070701_11064203 | 3300005438 | Unclassified | 567 |
| 93 | Ga0070705_100369548 | 3300005440 | Bacteria | 1052 |
| 94 | Ga0070705_100730651 | 3300005440 | Unclassified | 781 |
| 95 | Ga0070705_101192052 | 3300005440 | Unclassified | 627 |
| 96 | Ga0070705_101565561 | 3300005440 | Bacteria | 554 |
| 97 | Ga0070705_101577508 | 3300005440 | Unclassified | 552 |
| 98 | Ga0070700_100578450 | 3300005441 | Unclassified | 877 |
| 99 | Ga0070700_100630555 | 3300005441 | Bacteria | 844 |
| 100 | Ga0070700_101289460 | 3300005441 | Unclassified | 613 |
| 101 | Ga0070694_100060356 | 3300005444 | Bacteria | 2586 |
| 102 | Ga0070694_100118883 | 3300005444 | Unclassified | 1894 |
| 103 | Ga0070694_100209881 | 3300005444 | Bacteria | 1456 |
| 104 | Ga0070694_100263192 | 3300005444 | Bacteria | 1309 |
| 105 | Ga0070694_100264405 | 3300005444 | Bacteria | 1306 |
| 106 | Ga0070694_100332305 | 3300005444 | Unclassified | 1173 |
| 107 | Ga0070694_100453595 | 3300005444 | Bacteria | 1013 |
| 108 | Ga0070694_101484958 | 3300005444 | Bacteria | 573 |
| 109 | Ga0070708_100000123 | 3300005445 | Bacteria | 52148 |
| 110 | Ga0070708_100293073 | 3300005445 | Bacteria | 1532 |
| 111 | Ga0070678_100011993 | 3300005456 | Bacteria | 5368 |
| 112 | Ga0070678_101612980 | 3300005456 | Unclassified | 609 |
| 113 | Ga0070662_100021594 | 3300005457 | Bacteria | 4398 |
| 114 | Ga0070662_100040781 | 3300005457 | Unclassified | 3308 |
| 115 | Ga0070662_100356498 | 3300005457 | Bacteria | 1199 |
| 116 | Ga0070681_10002170 | 3300005458 | Bacteria | 17858 |
| 117 | Ga0070681_10067251 | 3300005458 | Bacteria | 3551 |
| 118 | Ga0068867_100026649 | 3300005459 | Bacteria | 4151 |
| 119 | Ga0068867_100116773 | 3300005459 | Bacteria | 2057 |
| 120 | Ga0068867_100258428 | 3300005459 | Bacteria | 1419 |
| 121 | Ga0068867_100655051 | 3300005459 | Bacteria | 922 |
| 122 | Ga0068867_101126020 | 3300005459 | Unclassified | 718 |
| 123 | Ga0070685_10382197 | 3300005466 | Bacteria | 970 |
| 124 | Ga0070685_10465148 | 3300005466 | Bacteria | 889 |
| 125 | Ga0070685_10595464 | 3300005466 | Unclassified | 795 |
| 126 | Ga0070685_11320044 | 3300005466 | Bacteria | 551 |
| 127 | Ga0070706_100018212 | 3300005467 | Bacteria | 6480 |
| 128 | Ga0070706_100048441 | 3300005467 | Bacteria | 3921 |
| 129 | Ga0070706_100709163 | 3300005467 | Unclassified | 933 |
| 130 | Ga0070706_100884892 | 3300005467 | Unclassified | 825 |
| 131 | Ga0070706_100952194 | 3300005467 | Bacteria | 792 |
| 132 | Ga0070706_101562999 | 3300005467 | Unclassified | 602 |
| 133 | Ga0070707_100081443 | 3300005468 | Bacteria | 3125 |
| 134 | Ga0070707_100176327 | 3300005468 | Bacteria | 2083 |
| 135 | Ga0070707_100365047 | 3300005468 | Bacteria | 1403 |
| 136 | Ga0070707_101096248 | 3300005468 | Bacteria | 762 |
| 137 | Ga0070707_102310250 | 3300005468 | Unclassified | 505 |
| 138 | Ga0070698_100002252 | 3300005471 | Bacteria | 21345 |
| 139 | Ga0070698_100009435 | 3300005471 | Bacteria | 10452 |
| 140 | Ga0070698_100043300 | 3300005471 | Bacteria | 4616 |
| 141 | Ga0070698_101110534 | 3300005471 | Bacteria | 739 |
| 142 | Ga0070699_100001087 | 3300005518 | Bacteria | 25323 |
| 143 | Ga0070699_101054223 | 3300005518 | Unclassified | 746 |
| 144 | Ga0070699_101068338 | 3300005518 | Unclassified | 740 |
| 145 | Ga0070679_100001783 | 3300005530 | Bacteria | 19405 |
| 146 | Ga0070679_101289465 | 3300005530 | Unclassified | 676 |
| 147 | Ga0070684_100032447 | 3300005535 | Bacteria | 4451 |
| 148 | Ga0070697_100005522 | 3300005536 | Bacteria | 9749 |
| 149 | Ga0070697_100453825 | 3300005536 | Bacteria | 1117 |
| 150 | Ga0070697_100608971 | 3300005536 | Unclassified | 960 |
| 151 | Ga0070697_101567762 | 3300005536 | Unclassified | 589 |
| 152 | Ga0068853_100138841 | 3300005539 | Bacteria | 2181 |
| 153 | Ga0068853_100383091 | 3300005539 | Bacteria | 1314 |
| 154 | Ga0068853_100625050 | 3300005539 | Bacteria | 1024 |
| 155 | Ga0068853_100777222 | 3300005539 | Bacteria | 916 |
| 156 | Ga0068853_101113398 | 3300005539 | Bacteria | 761 |
| 157 | Ga0070672_100193601 | 3300005543 | Bacteria | 1698 |
| 158 | Ga0070672_100612570 | 3300005543 | Unclassified | 949 |
| 159 | Ga0070686_100003689 | 3300005544 | Bacteria | 8407 |
| 160 | Ga0070686_100055924 | 3300005544 | Bacteria | 2530 |
| 161 | Ga0070686_100928225 | 3300005544 | Unclassified | 710 |
| 162 | Ga0070686_101053972 | 3300005544 | Bacteria | 669 |
| 163 | Ga0070695_100142806 | 3300005545 | Bacteria | 1662 |
| 164 | Ga0070695_100291685 | 3300005545 | Unclassified | 1203 |
| 165 | Ga0070695_100383065 | 3300005545 | Unclassified | 1062 |
| 166 | Ga0070695_100384612 | 3300005545 | Bacteria | 1060 |
| 167 | Ga0070695_100962100 | 3300005545 | Unclassified | 693 |
| 168 | Ga0070695_101081194 | 3300005545 | Bacteria | 656 |
| 169 | Ga0070695_101226569 | 3300005545 | Unclassified | 618 |
| 170 | Ga0070696_100048370 | 3300005546 | Bacteria | 2952 |
| 171 | Ga0070693_100369017 | 3300005547 | Bacteria | 987 |
| 172 | Ga0070693_100400823 | 3300005547 | Unclassified | 951 |
| 173 | Ga0070693_100514883 | 3300005547 | Unclassified | 851 |
| 174 | Ga0070693_100650467 | 3300005547 | Bacteria | 766 |
| 175 | Ga0070693_101091915 | 3300005547 | Unclassified | 608 |
| 176 | Ga0070665_101848310 | 3300005548 | Unclassified | 610 |
| 177 | Ga0070704_100038318 | 3300005549 | Bacteria | 3283 |
| 178 | Ga0070704_100141525 | 3300005549 | Bacteria | 1879 |
| 179 | Ga0070704_100245502 | 3300005549 | Bacteria | 1467 |
| 180 | Ga0070704_100802374 | 3300005549 | Unclassified | 841 |
| 181 | Ga0068855_100808401 | 3300005563 | Bacteria | 996 |
| 182 | Ga0070664_100003926 | 3300005564 | Bacteria | 11993 |
| 183 | Ga0070664_100166231 | 3300005564 | Bacteria | 1955 |
| 184 | Ga0070664_100888080 | 3300005564 | Bacteria | 835 |
| 185 | Ga0070664_100939406 | 3300005564 | Bacteria | 812 |
| 186 | Ga0070664_101966753 | 3300005564 | Unclassified | 555 |
| 187 | Ga0070664_102104461 | 3300005564 | Bacteria | 535 |
| 188 | Ga0068857_100018451 | 3300005577 | Bacteria | 6120 |
| 189 | Ga0068857_100281950 | 3300005577 | Bacteria | 1528 |
| 190 | Ga0068857_100421218 | 3300005577 | Bacteria | 1245 |
| 191 | Ga0068857_100484510 | 3300005577 | Bacteria | 1159 |
| 192 | Ga0068857_101201463 | 3300005577 | Unclassified | 734 |
| 193 | Ga0068857_102251087 | 3300005577 | Unclassified | 535 |
| 194 | Ga0068857_102417758 | 3300005577 | Unclassified | 516 |
| 195 | Ga0068854_100094284 | 3300005578 | Bacteria | 2233 |
| 196 | Ga0068854_100312889 | 3300005578 | Bacteria | 1274 |
| 197 | Ga0068854_101235499 | 3300005578 | Unclassified | 670 |
| 198 | Ga0070702_100045492 | 3300005615 | Bacteria | 2483 |
| 199 | Ga0070702_101477072 | 3300005615 | Unclassified | 558 |
| 200 | Ga0068852_101004332 | 3300005616 | Bacteria | 853 |
| 201 | Ga0068852_101776192 | 3300005616 | Unclassified | 639 |
| 202 | Ga0068852_102258172 | 3300005616 | Bacteria | 565 |
| 203 | Ga0068859_100049402 | 3300005617 | Unclassified | 4224 |
| 204 | Ga0068859_100069862 | 3300005617 | Bacteria | 3548 |
| 205 | Ga0068859_100310235 | 3300005617 | Bacteria | 1671 |
| 206 | Ga0068859_100330478 | 3300005617 | Unclassified | 1618 |
| 207 | Ga0068859_100402529 | 3300005617 | Bacteria | 1465 |
| 208 | Ga0068859_100536526 | 3300005617 | Unclassified | 1265 |
| 209 | Ga0068859_100592983 | 3300005617 | Bacteria | 1201 |
| 210 | Ga0068859_100642276 | 3300005617 | Bacteria | 1153 |
| 211 | Ga0068859_100754296 | 3300005617 | Unclassified | 1062 |
| 212 | Ga0068859_101082407 | 3300005617 | Unclassified | 881 |
| 213 | Ga0068859_101587354 | 3300005617 | Unclassified | 722 |
| 214 | Ga0068859_102512910 | 3300005617 | Unclassified | 567 |
| 215 | Ga0068864_100011143 | 3300005618 | Bacteria | 7432 |
| 216 | Ga0068864_100016406 | 3300005618 | Bacteria | 6166 |
| 217 | Ga0068864_100196491 | 3300005618 | Bacteria | 1851 |
| 218 | Ga0068864_100226445 | 3300005618 | Bacteria | 1727 |
| 219 | Ga0068864_100258676 | 3300005618 | Bacteria | 1618 |
| 220 | Ga0068864_101368813 | 3300005618 | Unclassified | 709 |
| 221 | Ga0068864_101476703 | 3300005618 | Bacteria | 683 |
| 222 | Ga0068864_102655776 | 3300005618 | Unclassified | 506 |
| 223 | Ga0068866_10007393 | 3300005718 | Bacteria | 4597 |
| 224 | Ga0068866_10236648 | 3300005718 | Unclassified | 1110 |
| 225 | Ga0068861_100032292 | 3300005719 | Bacteria | 3853 |
| 226 | Ga0068861_100084626 | 3300005719 | Bacteria | 2490 |
| 227 | Ga0068861_100576777 | 3300005719 | Bacteria | 1029 |
| 228 | Ga0068861_100796350 | 3300005719 | Unclassified | 887 |
| 229 | Ga0068861_100870994 | 3300005719 | Bacteria | 851 |
| 230 | Ga0068861_101401323 | 3300005719 | Bacteria | 683 |
| 231 | Ga0068870_10038462 | 3300005840 | Bacteria | 2471 |
| 232 | Ga0068870_10043528 | 3300005840 | Bacteria | 2342 |
| 233 | Ga0068870_10066001 | 3300005840 | Bacteria | 1959 |
| 234 | Ga0068870_10555741 | 3300005840 | Unclassified | 773 |
| 235 | Ga0068870_11104368 | 3300005840 | Unclassified | 570 |
| 236 | Ga0068863_100043379 | 3300005841 | Bacteria | 4270 |
| 237 | Ga0068863_100783218 | 3300005841 | Unclassified | 950 |
| 238 | Ga0068863_101438851 | 3300005841 | Bacteria | 697 |
| 239 | Ga0068858_100159102 | 3300005842 | Bacteria | 2126 |
| 240 | Ga0068858_100382148 | 3300005842 | Bacteria | 1351 |
| 241 | Ga0068858_100477165 | 3300005842 | Bacteria | 1203 |
| 242 | Ga0068858_100536235 | 3300005842 | Bacteria | 1132 |
| 243 | Ga0068858_100952007 | 3300005842 | Unclassified | 840 |
| 244 | Ga0068858_101245272 | 3300005842 | Unclassified | 732 |
| 245 | Ga0068858_101272160 | 3300005842 | Unclassified | 724 |
| 246 | Ga0068858_101694615 | 3300005842 | Bacteria | 624 |
| 247 | Ga0068860_100061190 | 3300005843 | Unclassified | 3577 |
| 248 | Ga0068860_100102004 | 3300005843 | Bacteria | 2738 |
| 249 | Ga0068860_100102549 | 3300005843 | Unclassified | 2730 |
| 250 | Ga0068860_100242409 | 3300005843 | Unclassified | 1754 |
| 251 | Ga0068860_100900533 | 3300005843 | Bacteria | 901 |
| 252 | Ga0068860_101861717 | 3300005843 | Bacteria | 623 |
| 253 | Ga0068860_102734761 | 3300005843 | Bacteria | 512 |
| 254 | Ga0068862_100036057 | 3300005844 | Bacteria | 4190 |
| 255 | Ga0068862_100176547 | 3300005844 | Bacteria | 1915 |
| 256 | Ga0068862_100287623 | 3300005844 | Bacteria | 1509 |
| 257 | Ga0081539_10000156 | 3300005985 | Bacteria | 158871 |
| 258 | Ga0081539_10001446 | 3300005985 | Bacteria | 40634 |
| 259 | Ga0081539_10002820 | 3300005985 | Bacteria | 23219 |
| 260 | Ga0081539_10003677 | 3300005985 | Bacteria | 18372 |
| 261 | Ga0081539_10459590 | 3300005985 | Unclassified | 527 |
| 262 | Ga0070716_100012283 | 3300006173 | Bacteria | 4338 |
| 263 | Ga0097621_100308884 | 3300006237 | Bacteria | 1398 |
| 264 | Ga0097621_100387892 | 3300006237 | Unclassified | 1248 |
| 265 | Ga0097621_101359971 | 3300006237 | Unclassified | 672 |
| 266 | Ga0068871_100305964 | 3300006358 | Bacteria | 1396 |
| 267 | Ga0068871_100777021 | 3300006358 | Bacteria | 882 |
| 268 | Ga0068871_101248763 | 3300006358 | Unclassified | 698 |
| 269 | Ga0075428_100915725 | 3300006844 | Unclassified | 930 |
| 270 | Ga0075428_101274711 | 3300006844 | Unclassified | 773 |
| 271 | Ga0075431_100737283 | 3300006847 | Unclassified | 961 |
| 272 | Ga0075433_10006630 | 3300006852 | Bacteria | 9163 |
| 273 | Ga0075433_10123698 | 3300006852 | Unclassified | 2298 |
| 274 | Ga0075433_10157491 | 3300006852 | Unclassified | 2021 |
| 275 | Ga0075433_10242605 | 3300006852 | Unclassified | 1599 |
| 276 | Ga0075433_10403639 | 3300006852 | Bacteria | 1206 |
| 277 | Ga0075433_10435738 | 3300006852 | Bacteria | 1156 |
| 278 | Ga0075433_11946409 | 3300006852 | Unclassified | 504 |
| 279 | Ga0075434_100043154 | 3300006871 | Bacteria | 4471 |
| 280 | Ga0075434_100567173 | 3300006871 | Unclassified | 1155 |
| 281 | Ga0075434_101508800 | 3300006871 | Bacteria | 681 |
| 282 | Ga0068865_100026015 | 3300006881 | Bacteria | 3854 |
| 283 | Ga0068865_100316999 | 3300006881 | Unclassified | 1253 |
| 284 | Ga0068865_101265043 | 3300006881 | Unclassified | 655 |
| 285 | Ga0075436_100046521 | 3300006914 | Unclassified | 2992 |
| 286 | Ga0097620_100049405 | 3300006931 | Unclassified | 4224 |
| 287 | Ga0097620_100069865 | 3300006931 | Bacteria | 3548 |
| 288 | Ga0097620_100310222 | 3300006931 | Bacteria | 1671 |
| 289 | Ga0097620_100330464 | 3300006931 | Unclassified | 1618 |
| 290 | Ga0097620_100402525 | 3300006931 | Bacteria | 1465 |
| 291 | Ga0097620_100536531 | 3300006931 | Unclassified | 1265 |
| 292 | Ga0097620_100592950 | 3300006931 | Bacteria | 1201 |
| 293 | Ga0097620_100642243 | 3300006931 | Bacteria | 1153 |
| 294 | Ga0097620_100754254 | 3300006931 | Unclassified | 1062 |
| 295 | Ga0097620_101082420 | 3300006931 | Unclassified | 881 |
| 296 | Ga0097620_101587365 | 3300006931 | Unclassified | 722 |
| 297 | Ga0097620_102512357 | 3300006931 | Unclassified | 567 |
| 298 | Ga0075435_100065324 | 3300007076 | Bacteria | 2958 |
| 299 | Ga0075435_100415448 | 3300007076 | Unclassified | 1158 |
| 300 | Ga0075435_100481597 | 3300007076 | Bacteria | 1072 |
| 301 | Ga0105251_10302369 | 3300009011 | Unclassified | 725 |
| 302 | Ga0105244_10456909 | 3300009036 | Bacteria | 587 |
| 303 | Ga0105240_10261750 | 3300009093 | Unclassified | 1995 |
| 304 | Ga0105240_12096045 | 3300009093 | Unclassified | 587 |
| 305 | Ga0111539_10232737 | 3300009094 | Bacteria | 2145 |
| 306 | Ga0105245_10424803 | 3300009098 | Bacteria | 1333 |
| 307 | Ga0105245_10983895 | 3300009098 | Bacteria | 887 |
| 308 | Ga0105245_12984973 | 3300009098 | Unclassified | 524 |
| 309 | Ga0105247_10004883 | 3300009101 | Bacteria | 8531 |
| 310 | Ga0105247_10587063 | 3300009101 | Unclassified | 824 |
| 311 | Ga0105247_11342988 | 3300009101 | Unclassified | 576 |
| 312 | Ga0105247_11571770 | 3300009101 | Unclassified | 539 |
| 313 | Ga0114129_10002599 | 3300009147 | Bacteria | 25103 |
| 314 | Ga0114129_10005977 | 3300009147 | Bacteria | 17238 |
| 315 | Ga0114129_10022580 | 3300009147 | Bacteria | 8925 |
| 316 | Ga0114129_10086674 | 3300009147 | Unclassified | 4343 |
| 317 | Ga0114129_10117502 | 3300009147 | Bacteria | 3664 |
| 318 | Ga0114129_10558729 | 3300009147 | Bacteria | 1487 |
| 319 | Ga0114129_10877597 | 3300009147 | Unclassified | 1138 |
| 320 | Ga0114129_11569622 | 3300009147 | Unclassified | 807 |
| 321 | Ga0114129_11591939 | 3300009147 | Bacteria | 800 |
| 322 | Ga0114129_12872928 | 3300009147 | Unclassified | 570 |
| 323 | Ga0105243_10006910 | 3300009148 | Bacteria | 8745 |
| 324 | Ga0105243_10446846 | 3300009148 | Unclassified | 1212 |
| 325 | Ga0105243_10527569 | 3300009148 | Bacteria | 1124 |
| 326 | Ga0105243_10593086 | 3300009148 | Bacteria | 1065 |
| 327 | Ga0105243_10642931 | 3300009148 | Bacteria | 1027 |
| 328 | Ga0105243_10693858 | 3300009148 | Unclassified | 991 |
| 329 | Ga0105243_10815564 | 3300009148 | Bacteria | 921 |
| 330 | Ga0105243_10872085 | 3300009148 | Unclassified | 893 |
| 331 | Ga0105243_10893473 | 3300009148 | Bacteria | 883 |
| 332 | Ga0105243_11171184 | 3300009148 | Unclassified | 780 |
| 333 | Ga0105241_10089919 | 3300009174 | Unclassified | 2420 |
| 334 | Ga0105241_10116401 | 3300009174 | Bacteria | 2147 |
| 335 | Ga0105241_11895606 | 3300009174 | Unclassified | 584 |
| 336 | Ga0105241_12399417 | 3300009174 | Unclassified | 526 |
| 337 | Ga0105242_10004059 | 3300009176 | Bacteria | 11376 |
| 338 | Ga0105242_10434920 | 3300009176 | Unclassified | 1233 |
| 339 | Ga0105242_10852121 | 3300009176 | Unclassified | 907 |
| 340 | Ga0105242_11642277 | 3300009176 | Unclassified | 677 |
| 341 | Ga0105248_10007166 | 3300009177 | Bacteria | 12233 |
| 342 | Ga0105248_10090612 | 3300009177 | Bacteria | 3443 |
| 343 | Ga0105248_10191997 | 3300009177 | Unclassified | 2301 |
| 344 | Ga0105248_10299372 | 3300009177 | Bacteria | 1811 |
| 345 | Ga0105248_10846155 | 3300009177 | Bacteria | 1033 |
| 346 | Ga0105237_11112574 | 3300009545 | Bacteria | 797 |
| 347 | Ga0105238_10993301 | 3300009551 | Unclassified | 860 |
| 348 | Ga0105249_10010812 | 3300009553 | Bacteria | 8023 |
| 349 | Ga0105249_10914180 | 3300009553 | Bacteria | 945 |
| 350 | Ga0105239_10067080 | 3300010375 | Bacteria | 3941 |
| 351 | Ga0105239_10295944 | 3300010375 | Bacteria | 1822 |
| 352 | Ga0105239_10702224 | 3300010375 | Bacteria | 1156 |
| 353 | Ga0105239_11273376 | 3300010375 | Bacteria | 848 |
| 354 | Ga0105246_10131817 | 3300011119 | Bacteria | 1868 |
| 355 | Ga0105246_10621268 | 3300011119 | Unclassified | 936 |
| 356 | Ga0105246_11024809 | 3300011119 | Bacteria | 749 |
| 357 | Ga0105246_11698256 | 3300011119 | Bacteria | 600 |
| 358 | Ga0157373_10016306 | 3300013100 | Bacteria | 5421 |
| 359 | Ga0157373_10272414 | 3300013100 | Bacteria | 1198 |
| 360 | Ga0157373_10810098 | 3300013100 | Unclassified | 691 |
| 361 | Ga0157373_11356878 | 3300013100 | Bacteria | 540 |
| 362 | Ga0157371_10266233 | 3300013102 | Bacteria | 1236 |
| 363 | Ga0157371_10719536 | 3300013102 | Unclassified | 748 |
| 364 | Ga0157374_10175645 | 3300013296 | Bacteria | 2091 |
| 365 | Ga0157374_11010121 | 3300013296 | Bacteria | 851 |
| 366 | Ga0157374_12420942 | 3300013296 | Bacteria | 552 |
| 367 | Ga0157378_10005652 | 3300013297 | Bacteria | 10947 |
| 368 | Ga0157378_10012103 | 3300013297 | Bacteria | 7558 |
| 369 | Ga0157378_10529042 | 3300013297 | Bacteria | 1181 |
| 370 | Ga0163162_10003591 | 3300013306 | Bacteria | 14849 |
| 371 | Ga0163162_10162131 | 3300013306 | Bacteria | 2358 |
| 372 | Ga0163162_10664349 | 3300013306 | Bacteria | 1165 |
| 373 | Ga0163162_10725523 | 3300013306 | Bacteria | 1114 |
| 374 | Ga0163162_12733895 | 3300013306 | Bacteria | 568 |
| 375 | Ga0157372_10038536 | 3300013307 | Bacteria | 5275 |
| 376 | Ga0157372_11703360 | 3300013307 | Bacteria | 725 |
| 377 | Ga0157372_11844287 | 3300013307 | Bacteria | 695 |
| 378 | Ga0157375_10003843 | 3300013308 | Bacteria | 13030 |
| 379 | Ga0157375_10331388 | 3300013308 | Bacteria | 1687 |
| 380 | Ga0157375_10397268 | 3300013308 | Bacteria | 1545 |
| 381 | Ga0157375_10768766 | 3300013308 | Bacteria | 1113 |
| 382 | Ga0157375_10799215 | 3300013308 | Unclassified | 1092 |
| 383 | Ga0157375_11281177 | 3300013308 | Unclassified | 861 |
| 384 | Ga0157375_11464247 | 3300013308 | Unclassified | 805 |
| 385 | Ga0163163_10050560 | 3300014325 | Bacteria | 4093 |
| 386 | Ga0163163_10263891 | 3300014325 | Bacteria | 1773 |
| 387 | Ga0163163_10332202 | 3300014325 | Bacteria | 1575 |
| 388 | Ga0163163_10366352 | 3300014325 | Bacteria | 1498 |
| 389 | Ga0163163_10969160 | 3300014325 | Unclassified | 914 |
| 390 | Ga0163163_12237213 | 3300014325 | Unclassified | 606 |
| 391 | Ga0157380_10003054 | 3300014326 | Bacteria | 11411 |
| 392 | Ga0157380_10333689 | 3300014326 | Bacteria | 1411 |
| 393 | Ga0157380_11371978 | 3300014326 | Bacteria | 756 |
| 394 | Ga0157377_10019746 | 3300014745 | Unclassified | 3524 |
| 395 | Ga0157379_10142123 | 3300014968 | Unclassified | 2164 |
| 396 | Ga0157379_10288336 | 3300014968 | Bacteria | 1495 |
| 397 | Ga0157379_11053373 | 3300014968 | Unclassified | 777 |
| 398 | Ga0157379_11962749 | 3300014968 | Bacteria | 578 |
| 399 | Ga0157379_11985510 | 3300014968 | Bacteria | 575 |
| 400 | Ga0157376_10408468 | 3300014969 | Bacteria | 1315 |
| 401 | Ga0182007_10279700 | 3300015262 | Bacteria | 607 |
| 402 | Ga0182005_1201175 | 3300015265 | Bacteria | 599 |
| 403 | Ga0163161_10016710 | 3300017792 | Bacteria | 5128 |
| 404 | Ga0163161_10241195 | 3300017792 | Bacteria | 1406 |
| 405 | Ga0213876_10000600 | 3300021384 | Bacteria | 26721 |
| 406 | Ga0213876_10011599 | 3300021384 | Bacteria | 4703 |
| 407 | Ga0213876_10148167 | 3300021384 | Bacteria | 1248 |
| 408 | Ga0207697_10148832 | 3300025315 | Bacteria | 1018 |
| 409 | Ga0207642_10052463 | 3300025899 | Unclassified | 1850 |
| 410 | Ga0207642_10187836 | 3300025899 | Bacteria | 1131 |
| 411 | Ga0207642_10463411 | 3300025899 | Unclassified | 770 |
| 412 | Ga0207710_10006543 | 3300025900 | Bacteria | 4965 |
| 413 | Ga0207710_10083274 | 3300025900 | Unclassified | 1487 |
| 414 | Ga0207710_10101088 | 3300025900 | Unclassified | 1360 |
| 415 | Ga0207688_10021806 | 3300025901 | Bacteria | 3502 |
| 416 | Ga0207647_10101781 | 3300025904 | Bacteria | 1704 |
| 417 | Ga0207647_10461828 | 3300025904 | Unclassified | 711 |
| 418 | Ga0207645_10042206 | 3300025907 | Bacteria | 2918 |
| 419 | Ga0207645_10359980 | 3300025907 | Unclassified | 974 |
| 420 | Ga0207645_10647759 | 3300025907 | Unclassified | 718 |
| 421 | Ga0207645_11089503 | 3300025907 | Unclassified | 539 |
| 422 | Ga0207643_10047380 | 3300025908 | Bacteria | 2432 |
| 423 | Ga0207643_10107388 | 3300025908 | Bacteria | 1641 |
| 424 | Ga0207643_10141287 | 3300025908 | Bacteria | 1438 |
| 425 | Ga0207643_10168058 | 3300025908 | Bacteria | 1322 |
| 426 | Ga0207643_10504479 | 3300025908 | Unclassified | 773 |
| 427 | Ga0207684_10017479 | 3300025910 | Bacteria | 6152 |
| 428 | Ga0207684_10451783 | 3300025910 | Unclassified | 1103 |
| 429 | Ga0207684_10823646 | 3300025910 | Unclassified | 784 |
| 430 | Ga0207654_10064791 | 3300025911 | Bacteria | 2150 |
| 431 | Ga0207707_10011879 | 3300025912 | Bacteria | 7576 |
| 432 | Ga0207707_10195636 | 3300025912 | Unclassified | 1764 |
| 433 | Ga0207707_10403712 | 3300025912 | Bacteria | 1173 |
| 434 | Ga0207693_10359577 | 3300025915 | Bacteria | 1139 |
| 435 | Ga0207660_10095717 | 3300025917 | Bacteria | 2209 |
| 436 | Ga0207660_10588215 | 3300025917 | Unclassified | 906 |
| 437 | Ga0207662_10001422 | 3300025918 | Bacteria | 11605 |
| 438 | Ga0207662_10087703 | 3300025918 | Bacteria | 1909 |
| 439 | Ga0207662_10101312 | 3300025918 | Bacteria | 1784 |
| 440 | Ga0207657_10160162 | 3300025919 | Bacteria | 1828 |
| 441 | Ga0207649_10059398 | 3300025920 | Bacteria | 2399 |
| 442 | Ga0207646_10088724 | 3300025922 | Unclassified | 2767 |
| 443 | Ga0207646_10161131 | 3300025922 | Bacteria | 2024 |
| 444 | Ga0207646_10191717 | 3300025922 | Bacteria | 1846 |
| 445 | Ga0207681_10112594 | 3300025923 | Bacteria | 1982 |
| 446 | Ga0207681_10179535 | 3300025923 | Bacteria | 1611 |
| 447 | Ga0207681_11304705 | 3300025923 | Bacteria | 610 |
| 448 | Ga0207650_10147943 | 3300025925 | Bacteria | 1851 |
| 449 | Ga0207650_10450886 | 3300025925 | Bacteria | 1071 |
| 450 | Ga0207659_10274748 | 3300025926 | Bacteria | 1375 |
| 451 | Ga0207644_11187382 | 3300025931 | Unclassified | 641 |
| 452 | Ga0207690_10081620 | 3300025932 | Bacteria | 2260 |
| 453 | Ga0207690_10408431 | 3300025932 | Unclassified | 1084 |
| 454 | Ga0207706_10037674 | 3300025933 | Bacteria | 4292 |
| 455 | Ga0207706_10083380 | 3300025933 | Bacteria | 2810 |
| 456 | Ga0207706_10179276 | 3300025933 | Bacteria | 1861 |
| 457 | Ga0207706_10313988 | 3300025933 | Bacteria | 1364 |
| 458 | Ga0207686_10362669 | 3300025934 | Bacteria | 1094 |
| 459 | Ga0207686_11376328 | 3300025934 | Unclassified | 580 |
| 460 | Ga0207709_10290548 | 3300025935 | Bacteria | 1211 |
| 461 | Ga0207709_10760367 | 3300025935 | Unclassified | 780 |
| 462 | Ga0207709_10900871 | 3300025935 | Unclassified | 719 |
| 463 | Ga0207709_10903719 | 3300025935 | Unclassified | 718 |
| 464 | Ga0207670_10222590 | 3300025936 | Unclassified | 1445 |
| 465 | Ga0207670_10880101 | 3300025936 | Bacteria | 749 |
| 466 | Ga0207669_10240688 | 3300025937 | Bacteria | 1341 |
| 467 | Ga0207669_10408783 | 3300025937 | Bacteria | 1065 |
| 468 | Ga0207704_10410584 | 3300025938 | Bacteria | 1071 |
| 469 | Ga0207665_10075122 | 3300025939 | Bacteria | 2314 |
| 470 | Ga0207691_10003051 | 3300025940 | Bacteria | 16337 |
| 471 | Ga0207691_10686525 | 3300025940 | Unclassified | 864 |
| 472 | Ga0207711_10013079 | 3300025941 | Bacteria | 6894 |
| 473 | Ga0207711_10091934 | 3300025941 | Unclassified | 2669 |
| 474 | Ga0207711_10119444 | 3300025941 | Unclassified | 2352 |
| 475 | Ga0207711_10282664 | 3300025941 | Unclassified | 1528 |
| 476 | Ga0207711_10476304 | 3300025941 | Bacteria | 1163 |
| 477 | Ga0207711_11182680 | 3300025941 | Bacteria | 706 |
| 478 | Ga0207711_11737266 | 3300025941 | Unclassified | 567 |
| 479 | Ga0207711_11922900 | 3300025941 | Unclassified | 534 |
| 480 | Ga0207689_10045159 | 3300025942 | Bacteria | 3644 |
| 481 | Ga0207689_10083689 | 3300025942 | Bacteria | 2623 |
| 482 | Ga0207689_10225854 | 3300025942 | Unclassified | 1547 |
| 483 | Ga0207689_10532354 | 3300025942 | Bacteria | 986 |
| 484 | Ga0207689_10993276 | 3300025942 | Unclassified | 708 |
| 485 | Ga0207689_11055346 | 3300025942 | Bacteria | 685 |
| 486 | Ga0207689_11191023 | 3300025942 | Bacteria | 641 |
| 487 | Ga0207679_10189554 | 3300025945 | Bacteria | 1708 |
| 488 | Ga0207679_10194615 | 3300025945 | Bacteria | 1689 |
| 489 | Ga0207679_10332163 | 3300025945 | Bacteria | 1320 |
| 490 | Ga0207679_10701976 | 3300025945 | Bacteria | 918 |
| 491 | Ga0207679_11624995 | 3300025945 | Bacteria | 592 |
| 492 | Ga0207667_10500262 | 3300025949 | Bacteria | 1233 |
| 493 | Ga0207667_11200958 | 3300025949 | Bacteria | 738 |
| 494 | Ga0207651_10014231 | 3300025960 | Bacteria | 4586 |
| 495 | Ga0207651_10082894 | 3300025960 | Unclassified | 2317 |
| 496 | Ga0207651_10374672 | 3300025960 | Bacteria | 1205 |
| 497 | Ga0207712_10115704 | 3300025961 | Bacteria | 2019 |
| 498 | Ga0207712_10154087 | 3300025961 | Unclassified | 1778 |
| 499 | Ga0207712_11451258 | 3300025961 | Bacteria | 614 |
| 500 | Ga0207712_11896855 | 3300025961 | Unclassified | 534 |
| 501 | Ga0207640_10104047 | 3300025981 | Unclassified | 1997 |
| 502 | Ga0207640_10454765 | 3300025981 | Bacteria | 1056 |
| 503 | Ga0207640_10698099 | 3300025981 | Bacteria | 870 |
| 504 | Ga0207640_11634956 | 3300025981 | Unclassified | 581 |
| 505 | Ga0207658_10081116 | 3300025986 | Unclassified | 2487 |
| 506 | Ga0207677_10059407 | 3300026023 | Bacteria | 2637 |
| 507 | Ga0207677_10389610 | 3300026023 | Bacteria | 1178 |
| 508 | Ga0207703_10308030 | 3300026035 | Unclassified | 1447 |
| 509 | Ga0207703_10349653 | 3300026035 | Unclassified | 1360 |
| 510 | Ga0207703_10352198 | 3300026035 | Bacteria | 1356 |
| 511 | Ga0207703_11149528 | 3300026035 | Unclassified | 746 |
| 512 | Ga0207703_11540701 | 3300026035 | Unclassified | 640 |
| 513 | Ga0207703_12233203 | 3300026035 | Unclassified | 523 |
| 514 | Ga0207639_10022120 | 3300026041 | Bacteria | 4578 |
| 515 | Ga0207639_10497022 | 3300026041 | Bacteria | 1114 |
| 516 | Ga0207639_12245908 | 3300026041 | Unclassified | 507 |
| 517 | Ga0207678_11682325 | 3300026067 | Bacteria | 557 |
| 518 | Ga0207708_10015015 | 3300026075 | Bacteria | 5804 |
| 519 | Ga0207708_10029243 | 3300026075 | Bacteria | 4175 |
| 520 | Ga0207708_10069910 | 3300026075 | Bacteria | 2688 |
| 521 | Ga0207708_10482713 | 3300026075 | Bacteria | 1036 |
| 522 | Ga0207702_10718893 | 3300026078 | Bacteria | 985 |
| 523 | Ga0207641_10139838 | 3300026088 | Bacteria | 2183 |
| 524 | Ga0207641_11522280 | 3300026088 | Unclassified | 671 |
| 525 | Ga0207641_11618722 | 3300026088 | Unclassified | 649 |
| 526 | Ga0207641_12313796 | 3300026088 | Bacteria | 537 |
| 527 | Ga0207648_10010405 | 3300026089 | Bacteria | 8818 |
| 528 | Ga0207648_10072413 | 3300026089 | Bacteria | 3003 |
| 529 | Ga0207648_10285464 | 3300026089 | Bacteria | 1477 |
| 530 | Ga0207676_10021086 | 3300026095 | Unclassified | 4777 |
| 531 | Ga0207676_10030876 | 3300026095 | Unclassified | 4025 |
| 532 | Ga0207676_10032368 | 3300026095 | Unclassified | 3939 |
| 533 | Ga0207676_10165471 | 3300026095 | Bacteria | 1921 |
| 534 | Ga0207676_11816009 | 3300026095 | Unclassified | 608 |
| 535 | Ga0207676_11951350 | 3300026095 | Unclassified | 586 |
| 536 | Ga0207676_12201389 | 3300026095 | Unclassified | 549 |
| 537 | Ga0207676_12540444 | 3300026095 | Unclassified | 509 |
| 538 | Ga0207674_10000198 | 3300026116 | Bacteria | 74606 |
| 539 | Ga0207674_10231592 | 3300026116 | Bacteria | 1795 |
| 540 | Ga0207674_10552824 | 3300026116 | Bacteria | 1112 |
| 541 | Ga0207674_11323650 | 3300026116 | Bacteria | 690 |
| 542 | Ga0207674_11554201 | 3300026116 | Unclassified | 630 |
| 543 | Ga0207674_11965250 | 3300026116 | Unclassified | 550 |
| 544 | Ga0207675_100006518 | 3300026118 | Bacteria | 11048 |
| 545 | Ga0207675_100059926 | 3300026118 | Unclassified | 3553 |
| 546 | Ga0207675_100168255 | 3300026118 | Bacteria | 2094 |
| 547 | Ga0207675_100251502 | 3300026118 | Bacteria | 1711 |
| 548 | Ga0207675_100803679 | 3300026118 | Bacteria | 954 |
| 549 | Ga0207675_100870313 | 3300026118 | Unclassified | 916 |
| 550 | Ga0207675_101098919 | 3300026118 | Bacteria | 815 |
| 551 | Ga0207683_10168653 | 3300026121 | Bacteria | 1982 |
| 552 | Ga0207698_11347614 | 3300026142 | Bacteria | 728 |
| 553 | Ga0207428_10307428 | 3300027907 | Bacteria | 1173 |
| 554 | Ga0207428_10898755 | 3300027907 | Unclassified | 626 |
| 555 | Ga0268265_10350711 | 3300028380 | Bacteria | 1347 |
| 556 | Ga0268265_11064672 | 3300028380 | Unclassified | 801 |
| 557 | Ga0268264_10039551 | 3300028381 | Unclassified | 3896 |
| 558 | Ga0268264_10072273 | 3300028381 | Bacteria | 2925 |
| 559 | Ga0268264_10097485 | 3300028381 | Bacteria | 2548 |
| 560 | Ga0268264_10493518 | 3300028381 | Unclassified | 1193 |
| 561 | Ga0268264_10821320 | 3300028381 | Bacteria | 930 |
| 562 | Ga0316176_1073199 | 3300030732 | Unclassified | 502 |
| 563 | Ga0307513_10000792 | 3300031456 | Bacteria | 45967 |
| 564 | Ga0307408_100860936 | 3300031548 | Unclassified | 827 |
| 565 | Ga0307405_11951838 | 3300031731 | Unclassified | 524 |
| 566 | Ga0307407_11638733 | 3300031903 | Unclassified | 511 |
| 567 | Ga0307412_12292685 | 3300031911 | Unclassified | 504 |
| 568 | Ga0307412_12310592 | 3300031911 | Bacteria | 502 |
| 569 | Ga0307409_100091196 | 3300031995 | Bacteria | 2497 |
| 570 | Ga0307409_102194234 | 3300031995 | Unclassified | 582 |
| 571 | Ga0307416_100286465 | 3300032002 | Bacteria | 1628 |
| 572 | Ga0307416_100888022 | 3300032002 | Unclassified | 991 |
| 573 | Ga0307414_11025015 | 3300032004 | Unclassified | 760 |
| 574 | Ga0307411_10097445 | 3300032005 | Unclassified | 2070 |
| 575 | Ga0307411_10353650 | 3300032005 | Unclassified | 1199 |
| 576 | Ga0307411_10480938 | 3300032005 | Unclassified | 1046 |
| 577 | Ga0307415_100047183 | 3300032126 | Bacteria | 2899 |
| 578 | Ga0307415_100600581 | 3300032126 | Unclassified | 979 |
| 579 | Ga0307415_100971829 | 3300032126 | Bacteria | 787 |
| 580 | Ga0307415_102262666 | 3300032126 | Unclassified | 533 |
| 581 | Ga0373952_0202709 | 3300035092 | Unclassified | 582 |
| 582 | Ga0373941_0052681 | 3300035115 | Bacteria | 1299 |
| 583 | Ga0373942_0001100 | 3300035207 | Bacteria | 7222 |
| 584 | Ga0395900_0498869 | 3300037418 | Unclassified | 1168 |
| 585 | Ga0395900_0531216 | 3300037418 | Unclassified | 1123 |
| 586 | Ga0395900_1399807 | 3300037418 | Unclassified | 612 |
| 587 | Ga0395898_1244460 | 3300037466 | Unclassified | 675 |
| 588 | Ga0395898_1514790 | 3300037466 | Unclassified | 596 |
| 589 | Ga0395905_0013141 | 3300037471 | Bacteria | 7948 |
| 590 | Ga0395905_0370412 | 3300037471 | Unclassified | 1326 |
| 591 | Ga0395905_0925229 | 3300037471 | Unclassified | 775 |
| 592 | Ga0395905_1006794 | 3300037471 | Unclassified | 736 |
| 593 | Ga0436364_0092994 | 3300037853 | Unclassified | 2172 |
| 594 | Ga0395901_0117560 | 3300038443 | Bacteria | 2794 |
| 595 | Ga0395901_0210938 | 3300038443 | Unclassified | 2033 |
| 596 | Ga0395901_1086247 | 3300038443 | Unclassified | 771 |
| 597 | Ga0395901_1128687 | 3300038443 | Unclassified | 753 |
| 598 | Ga0395901_1163233 | 3300038443 | Unclassified | 739 |
| 599 | Ga0242420_005078 | 3300038996 | Unclassified | 2021 |
| 600 | Ga0436365_0192215 | 3300039437 | Unclassified | 1499 |
| 601 | Ga0436365_0568464 | 3300039437 | Bacteria | 4696 |
| 602 | Ga0436365_0915988 | 3300039437 | Bacteria | 51495 |
| 603 | Ga0436365_1614537 | 3300039437 | Bacteria | 1422 |
| 604 | Ga0436365_1777818 | 3300039437 | Bacteria | 1234 |
| 605 | Ga0436362_1016805 | 3300039453 | Bacteria | 1157 |
| 606 | Ga0439448_0249737 | 3300042005 | Unclassified | 626 |
| 607 | Ga0453683_0105666 | 3300044673 | Unclassified | 1769 |
| 608 | Ga0466960_0562203 | 3300044901 | Unclassified | 674 |
| 609 | Ga0451576_0861771 | 3300045051 | Bacteria | 951 |
| 610 | Ga0451576_0863034 | 3300045051 | Unclassified | 950 |
| 611 | Ga0451576_1551116 | 3300045051 | Unclassified | 687 |
| 612 | Ga0451576_2342173 | 3300045051 | Unclassified | 547 |
| 613 | Ga0466967_1632914 | 3300045976 | Bacteria | 642 |
| 614 | Ga0495632_0036488 | 3300046519 | Unclassified | 2500 |
| 615 | Ga0495669_0060182 | 3300046684 | Unclassified | 1717 |
| 616 | Ga0495672_0449971 | 3300047320 | Unclassified | 581 |
| 617 | Ga0496104_0073453 | 3300048907 | Bacteria | 3254 |
| 618 | Ga0496106_0136910 | 3300048909 | Bacteria | 1924 |
| 619 | Ga0496106_0162244 | 3300048909 | Bacteria | 1768 |
| 620 | Ga0496106_1325667 | 3300048909 | Unclassified | 558 |
| 621 | Ga0496107_0055101 | 3300048910 | Bacteria | 2872 |
| 622 | Ga0496107_0404477 | 3300048910 | Unclassified | 1015 |
| 623 | Ga0496108_0070033 | 3300048911 | Bacteria | 2960 |
| 624 | Ga0496108_0084040 | 3300048911 | Bacteria | 2701 |
| 625 | Ga0496109_0375126 | 3300048912 | Unclassified | 1344 |
| 626 | Ga0496110_0787687 | 3300048913 | Bacteria | 855 |
| 627 | Ga0496110_1615653 | 3300048913 | Unclassified | 558 |
| 628 | Ga0496111_1294877 | 3300048914 | Bacteria | 514 |
| 629 | Ga0496112_0107804 | 3300048915 | Unclassified | 2756 |
| 630 | Ga0496112_0203029 | 3300048915 | Bacteria | 1941 |
| 631 | Ga0496112_1530491 | 3300048915 | Unclassified | 581 |
| 632 | Ga0496112_1554559 | 3300048915 | Bacteria | 575 |
| 633 | Ga0496112_1940893 | 3300048915 | Unclassified | 500 |
| 634 | Ga0496113_0391750 | 3300048916 | Unclassified | 1115 |
| 635 | Ga0501290_002897 | 3300049513 | Bacteria | 2186 |
| 636 | Ga0501291_002071 | 3300049514 | Bacteria | 2373 |
| 637 | Ga0501292_001602 | 3300049515 | Bacteria | 2808 |
| 638 | Ga0501292_002071 | 3300049515 | Bacteria | 2549 |
| 639 | Ga0501295_006177 | 3300049518 | Bacteria | 1674 |
| 640 | Ga0501296_000336 | 3300049519 | Bacteria | 4773 |
| 641 | Ga0501296_022727 | 3300049519 | Bacteria | 809 |
| 642 | Ga0501297_007815 | 3300049520 | Unclassified | 1168 |
| 643 | Ga0501298_001169 | 3300049521 | Bacteria | 3806 |
| 644 | Ga0501298_008042 | 3300049521 | Bacteria | 1763 |
| 645 | Ga0501299_010855 | 3300049522 | Unclassified | 1528 |
| 646 | Ga0501300_005781 | 3300049523 | Bacteria | 1821 |
| 647 | Ga0501300_015126 | 3300049523 | Unclassified | 1127 |
| 648 | Ga0501303_003232 | 3300049526 | Bacteria | 1297 |
| 649 | Ga0501048_0336059 | 3300049582 | Bacteria | 1077 |
| 650 | Ga0501198_064252 | 3300049649 | Unclassified | 680 |
| 651 | Ga0501198_156585 | 3300049649 | Unclassified | 506 |
| 652 | Ga0501202_004045 | 3300049652 | Unclassified | 2548 |
| 653 | Ga0501202_015782 | 3300049652 | Bacteria | 1458 |
| 654 | Ga0501206_100873 | 3300049653 | Unclassified | 523 |
| 655 | Ga0501207_005246 | 3300049654 | Bacteria | 1788 |
| 656 | Ga0501211_006241 | 3300049658 | Unclassified | 1182 |
| 657 | Ga0501223_011789 | 3300049663 | Bacteria | 1754 |
| 658 | Ga0501230_144768 | 3300049667 | Unclassified | 537 |
| 659 | Ga0501233_004307 | 3300049668 | Bacteria | 2601 |
| 660 | Ga0501233_026362 | 3300049668 | Unclassified | 1283 |
| 661 | Ga0501235_002240 | 3300049669 | Bacteria | 4158 |
| 662 | Ga0501243_003807 | 3300049675 | Bacteria | 2252 |
| 663 | Ga0501246_031054 | 3300049676 | Unclassified | 601 |
| 664 | Ga0501251_002203 | 3300049681 | Bacteria | 1869 |
| 665 | Ga0501252_024616 | 3300049682 | Unclassified | 806 |
| 666 | Ga0501257_074366 | 3300049686 | Unclassified | 871 |
| 667 | Ga0501260_005015 | 3300049689 | Bacteria | 1236 |
| 668 | Ga0501260_005682 | 3300049689 | Unclassified | 1179 |
| 669 | Ga0501261_016426 | 3300049690 | Unclassified | 1027 |
| 670 | Ga0501221_119543 | 3300049704 | Bacteria | 672 |
| 671 | Ga0501225_0008169 | 3300049705 | Bacteria | 3010 |
| 672 | Ga0501225_0141162 | 3300049705 | Bacteria | 728 |
| 673 | Ga0501234_014514 | 3300049707 | Unclassified | 1238 |
| 674 | Ga0501245_008377 | 3300049708 | Unclassified | 1472 |
| 675 | Ga0501264_022042 | 3300049761 | Unclassified | 682 |
| 676 | Ga0501272_017953 | 3300049769 | Unclassified | 835 |
| 677 | Ga0501280_043001 | 3300049776 | Unclassified | 738 |
| 678 | Ga0501283_000258 | 3300049779 | Bacteria | 6988 |
| 679 | Ga0501212_077369 | 3300049851 | Unclassified | 597 |
| 680 | nmdc:mga05p37_1381188_c1 | 3300050507 | Unclassified | 711 |
| 681 | nmdc:mga05p37_1416351_c1 | 3300050507 | Unclassified | 699 |
| 682 | nmdc:mga05p37_146291_c1 | 3300050507 | Bacteria | 2893 |
| 683 | nmdc:mga05p37_1855341_c1 | 3300050507 | Bacteria | 578 |
| 684 | nmdc:mga05p37_271315_c1 | 3300050507 | Bacteria | 2027 |
| 685 | nmdc:mga05p37_28059_c1 | 3300050507 | Bacteria | 6859 |
| 686 | nmdc:mga05p37_435734_c1 | 3300050507 | Bacteria | 1521 |
| 687 | nmdc:mga05p37_66912_c1 | 3300050507 | Bacteria | 4420 |
| 688 | nmdc:mga08y16_164908_c1 | 3300050511 | Bacteria | 2302 |
| 689 | nmdc:mga08y16_758695_c1 | 3300050511 | Unclassified | 966 |
| 690 | nmdc:mga0n895_1067712_c1 | 3300050512 | Unclassified | 786 |
| 691 | nmdc:mga0n895_1299390_c1 | 3300050512 | Bacteria | 698 |
| 692 | nmdc:mga0n895_137833_c1 | 3300050512 | Bacteria | 2467 |
| 693 | nmdc:mga0n895_73209_c1 | 3300050512 | Bacteria | 3401 |
| 694 | nmdc:mga0rr50_366248_c1 | 3300050513 | Bacteria | 1214 |
| 695 | nmdc:mga08x19_5549_c1 | 3300050514 | Bacteria | 7459 |
| 696 | nmdc:mga0a205_144721_c1 | 3300050515 | Unclassified | 2277 |
| 697 | nmdc:mga0a205_14543_c1 | 3300050515 | Bacteria | 7343 |
| 698 | nmdc:mga0a205_1579671_c1 | 3300050515 | Unclassified | 504 |
| 699 | nmdc:mga0a205_2078_c1 | 3300050515 | Bacteria | 17510 |
| 700 | nmdc:mga0a205_823422_c1 | 3300050515 | Bacteria | 776 |
| 701 | Ga0500616_0002252 | 3300053153 | Bacteria | 16437 |
| 702 | Ga0587072_183377 | 3300059643 | Unclassified | 523 |
| 703 | Ga0070690_100779626 | |||
| 704 | SwRhRL2b_contig_1180576 | |||
| 705 | SwRhRL2b_contig_858736 | |||
| 706 | MRS1b_contig_2665146 | |||
| 707 | MBSR1b_contig_10732066 | |||
| 708 | CNAas_1001037 | |||
| 709 | JGI25406J46586_10004686 | |||
| 710 | rootH1_10116221 | |||
| 711 | Ga0065714_10064469 | |||
| 712 | Ga0065704_10132086 | |||
| 713 | Ga0065704_10227211 | |||
| 714 | Ga0065712_10000127 | |||
| 715 | Ga0065712_10073065 | |||
| 716 | Ga0065712_10095724 | |||
| 717 | Ga0065715_10003383 | |||
| 718 | Ga0065715_10010224 | |||
| 719 | Ga0065715_10059994 | |||
| 720 | Ga0065715_10089915 | |||
| 721 | Ga0065715_10195111 | |||
| 722 | Ga0065715_10214709 | |||
| 723 | Ga0065715_10251952 | |||
| 724 | Ga0065715_10611210 | |||
| 725 | Ga0065715_10774008 | |||
| 726 | Ga0065707_10022770 | |||
| 727 | Ga0065707_10046589 | |||
| 728 | Ga0065707_10092069 | |||
| 729 | Ga0065707_10094820 | |||
| 730 | Ga0065707_10246404 | |||
| 731 | Ga0070676_10584956 | |||
| 732 | Ga0070676_10749521 | |||
| 733 | Ga0070683_100662601 | |||
| 734 | Ga0070690_100014691 | |||
| 735 | Ga0070690_100033178 | |||
| 736 | Ga0070690_100186456 | |||
| 737 | Ga0070670_100177057 | |||
| 738 | Ga0070670_100436315 | |||
| 739 | Ga0068869_100063021 | |||
| 740 | Ga0068869_100113181 | |||
| 741 | Ga0068869_100201903 | |||
| 742 | Ga0068869_100363006 | |||
| 743 | Ga0068869_100377077 | |||
| 744 | Ga0068869_101848775 | |||
| 745 | Ga0068869_102005076 | |||
| 746 | Ga0068869_102017625 | |||
| 747 | Ga0070666_10071275 | |||
| 748 | Ga0070666_10456126 | |||
| 749 | Ga0070666_10868004 | |||
| 750 | Ga0070680_100018133 | |||
| 751 | Ga0070680_100263495 | |||
| 752 | Ga0070680_100353134 | |||
| 753 | Ga0070682_101103491 | |||
| 754 | Ga0068868_100071815 | |||
| 755 | Ga0068868_100076234 | |||
| 756 | Ga0070660_100178757 | |||
| 757 | Ga0070660_100340664 | |||
| 758 | Ga0070660_101561547 | |||
| 759 | Ga0070689_100281633 | |||
| 760 | Ga0070687_100008341 | |||
| 761 | Ga0070687_100063043 | |||
| 762 | Ga0070687_100176340 | |||
| 763 | Ga0070661_100232674 | |||
| 764 | Ga0070692_10095860 | |||
| 765 | Ga0070692_10171147 | |||
| 766 | Ga0070692_10351304 | |||
| 767 | Ga0070692_10848765 | |||
| 768 | Ga0070692_11173971 | |||
| 769 | Ga0070692_11391236 | |||
| 770 | Ga0070669_100034434 | |||
| 771 | Ga0070675_100025557 | |||
| 772 | Ga0070671_100041021 | |||
| 773 | Ga0070674_100145466 | |||
| 774 | Ga0070674_100202914 | |||
| 775 | Ga0070674_100299531 | |||
| 776 | Ga0070674_102025453 | |||
| 777 | Ga0070673_100069575 | |||
| 778 | Ga0070673_100243588 | |||
| 779 | Ga0070673_100326175 | |||
| 780 | Ga0070673_101233740 | |||
| 781 | Ga0070673_101821172 | |||
| 782 | Ga0070673_101932771 | |||
| 783 | Ga0070688_100872965 | |||
| 784 | Ga0070659_100078773 | |||
| 785 | Ga0070659_100689395 | |||
| 786 | Ga0070659_100811565 | |||
| 787 | Ga0070659_100953233 | |||
| 788 | Ga0070667_100171259 | |||
| 789 | Ga0070667_101309336 | |||
| 790 | Ga0070703_10375006 | |||
| 791 | Ga0070701_10066043 | |||
| 792 | Ga0070701_10205016 | |||
| 793 | Ga0070701_10424372 | |||
| 794 | Ga0070701_11064203 | |||
| 795 | Ga0070705_100369548 | |||
| 796 | Ga0070705_100730651 | |||
| 797 | Ga0070705_101192052 | |||
| 798 | Ga0070705_101565561 | |||
| 799 | Ga0070705_101577508 | |||
| 800 | Ga0070700_100578450 | |||
| 801 | Ga0070700_100630555 | |||
| 802 | Ga0070700_101289460 | |||
| 803 | Ga0070694_100060356 | |||
| 804 | Ga0070694_100118883 | |||
| 805 | Ga0070694_100209881 | |||
| 806 | Ga0070694_100263192 | |||
| 807 | Ga0070694_100264405 | |||
| 808 | Ga0070694_100332305 | |||
| 809 | Ga0070694_100453595 | |||
| 810 | Ga0070694_101484958 | |||
| 811 | Ga0070708_100000123 | |||
| 812 | Ga0070708_100293073 | |||
| 813 | Ga0070678_100011993 | |||
| 814 | Ga0070678_101612980 | |||
| 815 | Ga0070662_100021594 | |||
| 816 | Ga0070662_100040781 | |||
| 817 | Ga0070662_100356498 | |||
| 818 | Ga0070681_10002170 | |||
| 819 | Ga0070681_10067251 | |||
| 820 | Ga0068867_100026649 | |||
| 821 | Ga0068867_100116773 | |||
| 822 | Ga0068867_100258428 | |||
| 823 | Ga0068867_100655051 | |||
| 824 | Ga0068867_101126020 | |||
| 825 | Ga0070685_10382197 | |||
| 826 | Ga0070685_10465148 | |||
| 827 | Ga0070685_10595464 | |||
| 828 | Ga0070685_11320044 | |||
| 829 | Ga0070706_100018212 | |||
| 830 | Ga0070706_100048441 | |||
| 831 | Ga0070706_100709163 | |||
| 832 | Ga0070706_100884892 | |||
| 833 | Ga0070706_100952194 | |||
| 834 | Ga0070706_101562999 | |||
| 835 | Ga0070707_100081443 | |||
| 836 | Ga0070707_100176327 | |||
| 837 | Ga0070707_100365047 | |||
| 838 | Ga0070707_101096248 | |||
| 839 | Ga0070707_102310250 | |||
| 840 | Ga0070698_100002252 | |||
| 841 | Ga0070698_100009435 | |||
| 842 | Ga0070698_100043300 | |||
| 843 | Ga0070698_101110534 | |||
| 844 | Ga0070699_100001087 | |||
| 845 | Ga0070699_101054223 | |||
| 846 | Ga0070699_101068338 | |||
| 847 | Ga0070679_100001783 | |||
| 848 | Ga0070679_101289465 | |||
| 849 | Ga0070684_100032447 | |||
| 850 | Ga0070697_100005522 | |||
| 851 | Ga0070697_100453825 | |||
| 852 | Ga0070697_100608971 | |||
| 853 | Ga0070697_101567762 | |||
| 854 | Ga0068853_100138841 | |||
| 855 | Ga0068853_100383091 | |||
| 856 | Ga0068853_100625050 | |||
| 857 | Ga0068853_100777222 | |||
| 858 | Ga0068853_101113398 | |||
| 859 | Ga0070672_100193601 | |||
| 860 | Ga0070672_100612570 | |||
| 861 | Ga0070686_100003689 | |||
| 862 | Ga0070686_100055924 | |||
| 863 | Ga0070686_100928225 | |||
| 864 | Ga0070686_101053972 | |||
| 865 | Ga0070695_100142806 | |||
| 866 | Ga0070695_100291685 | |||
| 867 | Ga0070695_100383065 | |||
| 868 | Ga0070695_100384612 | |||
| 869 | Ga0070695_100962100 | |||
| 870 | Ga0070695_101081194 | |||
| 871 | Ga0070695_101226569 | |||
| 872 | Ga0070696_100048370 | |||
| 873 | Ga0070693_100369017 | |||
| 874 | Ga0070693_100400823 | |||
| 875 | Ga0070693_100514883 | |||
| 876 | Ga0070693_100650467 | |||
| 877 | Ga0070693_101091915 | |||
| 878 | Ga0070665_101848310 | |||
| 879 | Ga0070704_100038318 | |||
| 880 | Ga0070704_100141525 | |||
| 881 | Ga0070704_100245502 | |||
| 882 | Ga0070704_100802374 | |||
| 883 | Ga0068855_100808401 | |||
| 884 | Ga0070664_100003926 | |||
| 885 | Ga0070664_100166231 | |||
| 886 | Ga0070664_100888080 | |||
| 887 | Ga0070664_100939406 | |||
| 888 | Ga0070664_101966753 | |||
| 889 | Ga0070664_102104461 | |||
| 890 | Ga0068857_100018451 | |||
| 891 | Ga0068857_100281950 | |||
| 892 | Ga0068857_100421218 | |||
| 893 | Ga0068857_100484510 | |||
| 894 | Ga0068857_101201463 | |||
| 895 | Ga0068857_102251087 | |||
| 896 | Ga0068857_102417758 | |||
| 897 | Ga0068854_100094284 | |||
| 898 | Ga0068854_100312889 | |||
| 899 | Ga0068854_101235499 | |||
| 900 | Ga0070702_100045492 | |||
| 901 | Ga0070702_101477072 | |||
| 902 | Ga0068852_101004332 | |||
| 903 | Ga0068852_101776192 | |||
| 904 | Ga0068852_102258172 | |||
| 905 | Ga0068859_100049402 | |||
| 906 | Ga0068859_100069862 | |||
| 907 | Ga0068859_100310235 | |||
| 908 | Ga0068859_100330478 | |||
| 909 | Ga0068859_100402529 | |||
| 910 | Ga0068859_100536526 | |||
| 911 | Ga0068859_100592983 | |||
| 912 | Ga0068859_100642276 | |||
| 913 | Ga0068859_100754296 | |||
| 914 | Ga0068859_101082407 | |||
| 915 | Ga0068859_101587354 | |||
| 916 | Ga0068859_102512910 | |||
| 917 | Ga0068864_100011143 | |||
| 918 | Ga0068864_100016406 | |||
| 919 | Ga0068864_100196491 | |||
| 920 | Ga0068864_100226445 | |||
| 921 | Ga0068864_100258676 | |||
| 922 | Ga0068864_101368813 | |||
| 923 | Ga0068864_101476703 | |||
| 924 | Ga0068864_102655776 | |||
| 925 | Ga0068866_10007393 | |||
| 926 | Ga0068866_10236648 | |||
| 927 | Ga0068861_100032292 | |||
| 928 | Ga0068861_100084626 | |||
| 929 | Ga0068861_100576777 | |||
| 930 | Ga0068861_100796350 | |||
| 931 | Ga0068861_100870994 | |||
| 932 | Ga0068861_101401323 | |||
| 933 | Ga0068870_10038462 | |||
| 934 | Ga0068870_10043528 | |||
| 935 | Ga0068870_10066001 | |||
| 936 | Ga0068870_10555741 | |||
| 937 | Ga0068870_11104368 | |||
| 938 | Ga0068863_100043379 | |||
| 939 | Ga0068863_100783218 | |||
| 940 | Ga0068863_101438851 | |||
| 941 | Ga0068858_100159102 | |||
| 942 | Ga0068858_100382148 | |||
| 943 | Ga0068858_100477165 | |||
| 944 | Ga0068858_100536235 | |||
| 945 | Ga0068858_100952007 | |||
| 946 | Ga0068858_101245272 | |||
| 947 | Ga0068858_101272160 | |||
| 948 | Ga0068858_101694615 | |||
| 949 | Ga0068860_100061190 | |||
| 950 | Ga0068860_100102004 | |||
| 951 | Ga0068860_100102549 | |||
| 952 | Ga0068860_100242409 | |||
| 953 | Ga0068860_100900533 | |||
| 954 | Ga0068860_101861717 | |||
| 955 | Ga0068860_102734761 | |||
| 956 | Ga0068862_100036057 | |||
| 957 | Ga0068862_100176547 | |||
| 958 | Ga0068862_100287623 | |||
| 959 | Ga0081539_10000156 | |||
| 960 | Ga0081539_10001446 | |||
| 961 | Ga0081539_10002820 | |||
| 962 | Ga0081539_10003677 | |||
| 963 | Ga0081539_10459590 | |||
| 964 | Ga0070716_100012283 | |||
| 965 | Ga0097621_100308884 | |||
| 966 | Ga0097621_100387892 | |||
| 967 | Ga0097621_101359971 | |||
| 968 | Ga0068871_100305964 | |||
| 969 | Ga0068871_100777021 | |||
| 970 | Ga0068871_101248763 | |||
| 971 | Ga0075428_100915725 | |||
| 972 | Ga0075428_101274711 | |||
| 973 | Ga0075431_100737283 | |||
| 974 | Ga0075433_10006630 | |||
| 975 | Ga0075433_10123698 | |||
| 976 | Ga0075433_10157491 | |||
| 977 | Ga0075433_10242605 | |||
| 978 | Ga0075433_10403639 | |||
| 979 | Ga0075433_10435738 | |||
| 980 | Ga0075433_11946409 | |||
| 981 | Ga0075434_100043154 | |||
| 982 | Ga0075434_100567173 | |||
| 983 | Ga0075434_101508800 | |||
| 984 | Ga0068865_100026015 | |||
| 985 | Ga0068865_100316999 | |||
| 986 | Ga0068865_101265043 | |||
| 987 | Ga0075436_100046521 | |||
| 988 | Ga0097620_100049405 | |||
| 989 | Ga0097620_100069865 | |||
| 990 | Ga0097620_100310222 | |||
| 991 | Ga0097620_100330464 | |||
| 992 | Ga0097620_100402525 | |||
| 993 | Ga0097620_100536531 | |||
| 994 | Ga0097620_100592950 | |||
| 995 | Ga0097620_100642243 | |||
| 996 | Ga0097620_100754254 | |||
| 997 | Ga0097620_101082420 | |||
| 998 | Ga0097620_101587365 | |||
| 999 | Ga0097620_102512357 | |||
| 1000 | Ga0075435_100065324 | |||
| 1001 | Ga0075435_100415448 | |||
| 1002 | Ga0075435_100481597 | |||
| 1003 | Ga0105251_10302369 | |||
| 1004 | Ga0105244_10456909 | |||
| 1005 | Ga0105240_10261750 | |||
| 1006 | Ga0105240_12096045 | |||
| 1007 | Ga0111539_10232737 | |||
| 1008 | Ga0105245_10424803 | |||
| 1009 | Ga0105245_10983895 | |||
| 1010 | Ga0105245_12984973 | |||
| 1011 | Ga0105247_10004883 | |||
| 1012 | Ga0105247_10587063 | |||
| 1013 | Ga0105247_11342988 | |||
| 1014 | Ga0105247_11571770 | |||
| 1015 | Ga0114129_10002599 | |||
| 1016 | Ga0114129_10005977 | |||
| 1017 | Ga0114129_10022580 | |||
| 1018 | Ga0114129_10086674 | |||
| 1019 | Ga0114129_10117502 | |||
| 1020 | Ga0114129_10558729 | |||
| 1021 | Ga0114129_10877597 | |||
| 1022 | Ga0114129_11569622 | |||
| 1023 | Ga0114129_11591939 | |||
| 1024 | Ga0114129_12872928 | |||
| 1025 | Ga0105243_10006910 | |||
| 1026 | Ga0105243_10446846 | |||
| 1027 | Ga0105243_10527569 | |||
| 1028 | Ga0105243_10593086 | |||
| 1029 | Ga0105243_10642931 | |||
| 1030 | Ga0105243_10693858 | |||
| 1031 | Ga0105243_10815564 | |||
| 1032 | Ga0105243_10872085 | |||
| 1033 | Ga0105243_10893473 | |||
| 1034 | Ga0105243_11171184 | |||
| 1035 | Ga0105241_10089919 | |||
| 1036 | Ga0105241_10116401 | |||
| 1037 | Ga0105241_11895606 | |||
| 1038 | Ga0105241_12399417 | |||
| 1039 | Ga0105242_10004059 | |||
| 1040 | Ga0105242_10434920 | |||
| 1041 | Ga0105242_10852121 | |||
| 1042 | Ga0105242_11642277 | |||
| 1043 | Ga0105248_10007166 | |||
| 1044 | Ga0105248_10090612 | |||
| 1045 | Ga0105248_10191997 | |||
| 1046 | Ga0105248_10299372 | |||
| 1047 | Ga0105248_10846155 | |||
| 1048 | Ga0105237_11112574 | |||
| 1049 | Ga0105238_10993301 | |||
| 1050 | Ga0105249_10010812 | |||
| 1051 | Ga0105249_10914180 | |||
| 1052 | Ga0105239_10067080 | |||
| 1053 | Ga0105239_10295944 | |||
| 1054 | Ga0105239_10702224 | |||
| 1055 | Ga0105239_11273376 | |||
| 1056 | Ga0105246_10131817 | |||
| 1057 | Ga0105246_10621268 | |||
| 1058 | Ga0105246_11024809 | |||
| 1059 | Ga0105246_11698256 | |||
| 1060 | Ga0157373_10016306 | |||
| 1061 | Ga0157373_10272414 | |||
| 1062 | Ga0157373_10810098 | |||
| 1063 | Ga0157373_11356878 | |||
| 1064 | Ga0157371_10266233 | |||
| 1065 | Ga0157371_10719536 | |||
| 1066 | Ga0157374_10175645 | |||
| 1067 | Ga0157374_11010121 | |||
| 1068 | Ga0157374_12420942 | |||
| 1069 | Ga0157378_10005652 | |||
| 1070 | Ga0157378_10012103 | |||
| 1071 | Ga0157378_10529042 | |||
| 1072 | Ga0163162_10003591 | |||
| 1073 | Ga0163162_10162131 | |||
| 1074 | Ga0163162_10664349 | |||
| 1075 | Ga0163162_10725523 | |||
| 1076 | Ga0163162_12733895 | |||
| 1077 | Ga0157372_10038536 | |||
| 1078 | Ga0157372_11703360 | |||
| 1079 | Ga0157372_11844287 | |||
| 1080 | Ga0157375_10003843 | |||
| 1081 | Ga0157375_10331388 | |||
| 1082 | Ga0157375_10397268 | |||
| 1083 | Ga0157375_10768766 | |||
| 1084 | Ga0157375_10799215 | |||
| 1085 | Ga0157375_11281177 | |||
| 1086 | Ga0157375_11464247 | |||
| 1087 | Ga0163163_10050560 | |||
| 1088 | Ga0163163_10263891 | |||
| 1089 | Ga0163163_10332202 | |||
| 1090 | Ga0163163_10366352 | |||
| 1091 | Ga0163163_10969160 | |||
| 1092 | Ga0163163_12237213 | |||
| 1093 | Ga0157380_10003054 | |||
| 1094 | Ga0157380_10333689 | |||
| 1095 | Ga0157380_11371978 | |||
| 1096 | Ga0157377_10019746 | |||
| 1097 | Ga0157379_10142123 | |||
| 1098 | Ga0157379_10288336 | |||
| 1099 | Ga0157379_11053373 | |||
| 1100 | Ga0157379_11962749 | |||
| 1101 | Ga0157379_11985510 | |||
| 1102 | Ga0157376_10408468 | |||
| 1103 | Ga0182007_10279700 | |||
| 1104 | Ga0182005_1201175 | |||
| 1105 | Ga0163161_10016710 | |||
| 1106 | Ga0163161_10241195 | |||
| 1107 | Ga0213876_10000600 | |||
| 1108 | Ga0213876_10011599 | |||
| 1109 | Ga0213876_10148167 | |||
| 1110 | Ga0207697_10148832 | |||
| 1111 | Ga0207642_10052463 | |||
| 1112 | Ga0207642_10187836 | |||
| 1113 | Ga0207642_10463411 | |||
| 1114 | Ga0207710_10006543 | |||
| 1115 | Ga0207710_10083274 | |||
| 1116 | Ga0207710_10101088 | |||
| 1117 | Ga0207688_10021806 | |||
| 1118 | Ga0207647_10101781 | |||
| 1119 | Ga0207647_10461828 | |||
| 1120 | Ga0207645_10042206 | |||
| 1121 | Ga0207645_10359980 | |||
| 1122 | Ga0207645_10647759 | |||
| 1123 | Ga0207645_11089503 | |||
| 1124 | Ga0207643_10047380 | |||
| 1125 | Ga0207643_10107388 | |||
| 1126 | Ga0207643_10141287 | |||
| 1127 | Ga0207643_10168058 | |||
| 1128 | Ga0207643_10504479 | |||
| 1129 | Ga0207684_10017479 | |||
| 1130 | Ga0207684_10451783 | |||
| 1131 | Ga0207684_10823646 | |||
| 1132 | Ga0207654_10064791 | |||
| 1133 | Ga0207707_10011879 | |||
| 1134 | Ga0207707_10195636 | |||
| 1135 | Ga0207707_10403712 | |||
| 1136 | Ga0207693_10359577 | |||
| 1137 | Ga0207660_10095717 | |||
| 1138 | Ga0207660_10588215 | |||
| 1139 | Ga0207662_10001422 | |||
| 1140 | Ga0207662_10087703 | |||
| 1141 | Ga0207662_10101312 | |||
| 1142 | Ga0207657_10160162 | |||
| 1143 | Ga0207649_10059398 | |||
| 1144 | Ga0207646_10088724 | |||
| 1145 | Ga0207646_10161131 | |||
| 1146 | Ga0207646_10191717 | |||
| 1147 | Ga0207681_10112594 | |||
| 1148 | Ga0207681_10179535 | |||
| 1149 | Ga0207681_11304705 | |||
| 1150 | Ga0207650_10147943 | |||
| 1151 | Ga0207650_10450886 | |||
| 1152 | Ga0207659_10274748 | |||
| 1153 | Ga0207644_11187382 | |||
| 1154 | Ga0207690_10081620 | |||
| 1155 | Ga0207690_10408431 | |||
| 1156 | Ga0207706_10037674 | |||
| 1157 | Ga0207706_10083380 | |||
| 1158 | Ga0207706_10179276 | |||
| 1159 | Ga0207706_10313988 | |||
| 1160 | Ga0207686_10362669 | |||
| 1161 | Ga0207686_11376328 | |||
| 1162 | Ga0207709_10290548 | |||
| 1163 | Ga0207709_10760367 | |||
| 1164 | Ga0207709_10900871 | |||
| 1165 | Ga0207709_10903719 | |||
| 1166 | Ga0207670_10222590 | |||
| 1167 | Ga0207670_10880101 | |||
| 1168 | Ga0207669_10240688 | |||
| 1169 | Ga0207669_10408783 | |||
| 1170 | Ga0207704_10410584 | |||
| 1171 | Ga0207665_10075122 | |||
| 1172 | Ga0207691_10003051 | |||
| 1173 | Ga0207691_10686525 | |||
| 1174 | Ga0207711_10013079 | |||
| 1175 | Ga0207711_10091934 | |||
| 1176 | Ga0207711_10119444 | |||
| 1177 | Ga0207711_10282664 | |||
| 1178 | Ga0207711_10476304 | |||
| 1179 | Ga0207711_11182680 | |||
| 1180 | Ga0207711_11737266 | |||
| 1181 | Ga0207711_11922900 | |||
| 1182 | Ga0207689_10045159 | |||
| 1183 | Ga0207689_10083689 | |||
| 1184 | Ga0207689_10225854 | |||
| 1185 | Ga0207689_10532354 | |||
| 1186 | Ga0207689_10993276 | |||
| 1187 | Ga0207689_11055346 | |||
| 1188 | Ga0207689_11191023 | |||
| 1189 | Ga0207679_10189554 | |||
| 1190 | Ga0207679_10194615 | |||
| 1191 | Ga0207679_10332163 | |||
| 1192 | Ga0207679_10701976 | |||
| 1193 | Ga0207679_11624995 | |||
| 1194 | Ga0207667_10500262 | |||
| 1195 | Ga0207667_11200958 | |||
| 1196 | Ga0207651_10014231 | |||
| 1197 | Ga0207651_10082894 | |||
| 1198 | Ga0207651_10374672 | |||
| 1199 | Ga0207712_10115704 | |||
| 1200 | Ga0207712_10154087 | |||
| 1201 | Ga0207712_11451258 | |||
| 1202 | Ga0207712_11896855 | |||
| 1203 | Ga0207640_10104047 | |||
| 1204 | Ga0207640_10454765 | |||
| 1205 | Ga0207640_10698099 | |||
| 1206 | Ga0207640_11634956 | |||
| 1207 | Ga0207658_10081116 | |||
| 1208 | Ga0207677_10059407 | |||
| 1209 | Ga0207677_10389610 | |||
| 1210 | Ga0207703_10308030 | |||
| 1211 | Ga0207703_10349653 | |||
| 1212 | Ga0207703_10352198 | |||
| 1213 | Ga0207703_11149528 | |||
| 1214 | Ga0207703_11540701 | |||
| 1215 | Ga0207703_12233203 | |||
| 1216 | Ga0207639_10022120 | |||
| 1217 | Ga0207639_10497022 | |||
| 1218 | Ga0207639_12245908 | |||
| 1219 | Ga0207678_11682325 | |||
| 1220 | Ga0207708_10015015 | |||
| 1221 | Ga0207708_10029243 | |||
| 1222 | Ga0207708_10069910 | |||
| 1223 | Ga0207708_10482713 | |||
| 1224 | Ga0207702_10718893 | |||
| 1225 | Ga0207641_10139838 | |||
| 1226 | Ga0207641_11522280 | |||
| 1227 | Ga0207641_11618722 | |||
| 1228 | Ga0207641_12313796 | |||
| 1229 | Ga0207648_10010405 | |||
| 1230 | Ga0207648_10072413 | |||
| 1231 | Ga0207648_10285464 | |||
| 1232 | Ga0207676_10021086 | |||
| 1233 | Ga0207676_10030876 | |||
| 1234 | Ga0207676_10032368 | |||
| 1235 | Ga0207676_10165471 | |||
| 1236 | Ga0207676_11816009 | |||
| 1237 | Ga0207676_11951350 | |||
| 1238 | Ga0207676_12201389 | |||
| 1239 | Ga0207676_12540444 | |||
| 1240 | Ga0207674_10000198 | |||
| 1241 | Ga0207674_10231592 | |||
| 1242 | Ga0207674_10552824 | |||
| 1243 | Ga0207674_11323650 | |||
| 1244 | Ga0207674_11554201 | |||
| 1245 | Ga0207674_11965250 | |||
| 1246 | Ga0207675_100006518 | |||
| 1247 | Ga0207675_100059926 | |||
| 1248 | Ga0207675_100168255 | |||
| 1249 | Ga0207675_100251502 | |||
| 1250 | Ga0207675_100803679 | |||
| 1251 | Ga0207675_100870313 | |||
| 1252 | Ga0207675_101098919 | |||
| 1253 | Ga0207683_10168653 | |||
| 1254 | Ga0207698_11347614 | |||
| 1255 | Ga0207428_10307428 | |||
| 1256 | Ga0207428_10898755 | |||
| 1257 | Ga0268265_10350711 | |||
| 1258 | Ga0268265_11064672 | |||
| 1259 | Ga0268264_10039551 | |||
| 1260 | Ga0268264_10072273 | |||
| 1261 | Ga0268264_10097485 | |||
| 1262 | Ga0268264_10493518 | |||
| 1263 | Ga0268264_10821320 | |||
| 1264 | Ga0316176_1073199 | |||
| 1265 | Ga0307513_10000792 | |||
| 1266 | Ga0307408_100860936 | |||
| 1267 | Ga0307405_11951838 | |||
| 1268 | Ga0307407_11638733 | |||
| 1269 | Ga0307412_12292685 | |||
| 1270 | Ga0307412_12310592 | |||
| 1271 | Ga0307409_100091196 | |||
| 1272 | Ga0307409_102194234 | |||
| 1273 | Ga0307416_100286465 | |||
| 1274 | Ga0307416_100888022 | |||
| 1275 | Ga0307414_11025015 | |||
| 1276 | Ga0307411_10097445 | |||
| 1277 | Ga0307411_10353650 | |||
| 1278 | Ga0307411_10480938 | |||
| 1279 | Ga0307415_100047183 | |||
| 1280 | Ga0307415_100600581 | |||
| 1281 | Ga0307415_100971829 | |||
| 1282 | Ga0307415_102262666 | |||
| 1283 | Ga0373952_0202709 | |||
| 1284 | Ga0373941_0052681 | |||
| 1285 | Ga0373942_0001100 | |||
| 1286 | Ga0395900_0498869 | |||
| 1287 | Ga0395900_0531216 | |||
| 1288 | Ga0395900_1399807 | |||
| 1289 | Ga0395898_1244460 | |||
| 1290 | Ga0395898_1514790 | |||
| 1291 | Ga0395905_0013141 | |||
| 1292 | Ga0395905_0370412 | |||
| 1293 | Ga0395905_0925229 | |||
| 1294 | Ga0395905_1006794 | |||
| 1295 | Ga0436364_0092994 | |||
| 1296 | Ga0395901_0117560 | |||
| 1297 | Ga0395901_0210938 | |||
| 1298 | Ga0395901_1086247 | |||
| 1299 | Ga0395901_1128687 | |||
| 1300 | Ga0395901_1163233 | |||
| 1301 | Ga0242420_005078 | |||
| 1302 | Ga0436365_0192215 | |||
| 1303 | Ga0436365_0568464 | |||
| 1304 | Ga0436365_0915988 | |||
| 1305 | Ga0436365_1614537 | |||
| 1306 | Ga0436365_1777818 | |||
| 1307 | Ga0436362_1016805 | |||
| 1308 | Ga0439448_0249737 | |||
| 1309 | Ga0453683_0105666 | |||
| 1310 | Ga0466960_0562203 | |||
| 1311 | Ga0451576_0861771 | |||
| 1312 | Ga0451576_0863034 | |||
| 1313 | Ga0451576_1551116 | |||
| 1314 | Ga0451576_2342173 | |||
| 1315 | Ga0466967_1632914 | |||
| 1316 | Ga0495632_0036488 | |||
| 1317 | Ga0495669_0060182 | |||
| 1318 | Ga0495672_0449971 | |||
| 1319 | Ga0496104_0073453 | |||
| 1320 | Ga0496106_0136910 | |||
| 1321 | Ga0496106_0162244 | |||
| 1322 | Ga0496106_1325667 | |||
| 1323 | Ga0496107_0055101 | |||
| 1324 | Ga0496107_0404477 | |||
| 1325 | Ga0496108_0070033 | |||
| 1326 | Ga0496108_0084040 | |||
| 1327 | Ga0496109_0375126 | |||
| 1328 | Ga0496110_0787687 | |||
| 1329 | Ga0496110_1615653 | |||
| 1330 | Ga0496111_1294877 | |||
| 1331 | Ga0496112_0107804 | |||
| 1332 | Ga0496112_0203029 | |||
| 1333 | Ga0496112_1530491 | |||
| 1334 | Ga0496112_1554559 | |||
| 1335 | Ga0496112_1940893 | |||
| 1336 | Ga0496113_0391750 | |||
| 1337 | Ga0501290_002897 | |||
| 1338 | Ga0501291_002071 | |||
| 1339 | Ga0501292_001602 | |||
| 1340 | Ga0501292_002071 | |||
| 1341 | Ga0501295_006177 | |||
| 1342 | Ga0501296_000336 | |||
| 1343 | Ga0501296_022727 | |||
| 1344 | Ga0501297_007815 | |||
| 1345 | Ga0501298_001169 | |||
| 1346 | Ga0501298_008042 | |||
| 1347 | Ga0501299_010855 | |||
| 1348 | Ga0501300_005781 | |||
| 1349 | Ga0501300_015126 | |||
| 1350 | Ga0501303_003232 | |||
| 1351 | Ga0501048_0336059 | |||
| 1352 | Ga0501198_064252 | |||
| 1353 | Ga0501198_156585 | |||
| 1354 | Ga0501202_004045 | |||
| 1355 | Ga0501202_015782 | |||
| 1356 | Ga0501206_100873 | |||
| 1357 | Ga0501207_005246 | |||
| 1358 | Ga0501211_006241 | |||
| 1359 | Ga0501223_011789 | |||
| 1360 | Ga0501230_144768 | |||
| 1361 | Ga0501233_004307 | |||
| 1362 | Ga0501233_026362 | |||
| 1363 | Ga0501235_002240 | |||
| 1364 | Ga0501243_003807 | |||
| 1365 | Ga0501246_031054 | |||
| 1366 | Ga0501251_002203 | |||
| 1367 | Ga0501252_024616 | |||
| 1368 | Ga0501257_074366 | |||
| 1369 | Ga0501260_005015 | |||
| 1370 | Ga0501260_005682 | |||
| 1371 | Ga0501261_016426 | |||
| 1372 | Ga0501221_119543 | |||
| 1373 | Ga0501225_0008169 | |||
| 1374 | Ga0501225_0141162 | |||
| 1375 | Ga0501234_014514 | |||
| 1376 | Ga0501245_008377 | |||
| 1377 | Ga0501264_022042 | |||
| 1378 | Ga0501272_017953 | |||
| 1379 | Ga0501280_043001 | |||
| 1380 | Ga0501283_000258 | |||
| 1381 | Ga0501212_077369 | |||
| 1382 | nmdc:mga05p37_1381188_c1 | |||
| 1383 | nmdc:mga05p37_1416351_c1 | |||
| 1384 | nmdc:mga05p37_146291_c1 | |||
| 1385 | nmdc:mga05p37_1855341_c1 | |||
| 1386 | nmdc:mga05p37_271315_c1 | |||
| 1387 | nmdc:mga05p37_28059_c1 | |||
| 1388 | nmdc:mga05p37_435734_c1 | |||
| 1389 | nmdc:mga05p37_66912_c1 | |||
| 1390 | nmdc:mga08y16_164908_c1 | |||
| 1391 | nmdc:mga08y16_758695_c1 | |||
| 1392 | nmdc:mga0n895_1067712_c1 | |||
| 1393 | nmdc:mga0n895_1299390_c1 | |||
| 1394 | nmdc:mga0n895_137833_c1 | |||
| 1395 | nmdc:mga0n895_73209_c1 | |||
| 1396 | nmdc:mga0rr50_366248_c1 | |||
| 1397 | nmdc:mga08x19_5549_c1 | |||
| 1398 | nmdc:mga0a205_144721_c1 | |||
| 1399 | nmdc:mga0a205_14543_c1 | |||
| 1400 | nmdc:mga0a205_1579671_c1 | |||
| 1401 | nmdc:mga0a205_2078_c1 | |||
| 1402 | nmdc:mga0a205_823422_c1 | |||
| 1403 | Ga0500616_0002252 | |||
| 1404 | Ga0587072_183377 |