F476199

General Info

Members Datasets Scaffolds Average Seq Length
702 254 1404 88

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100779626|Ga0070690_1007796262
Length 100
Sequence MVWQLVLPERSNDMGNTINQRQSLVSKLDSLSETELQEVLDYVSMIESLRRPKGSAVIEEELLVALADAHENRRARQAFEWESVRRKAERRATVRATNHF

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
212 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
215 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
216 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
217 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
218 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
219 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
220 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
223 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
224 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
225 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
226 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
227 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
228 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
231 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
232 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
233 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
234 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
235 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
236 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
237 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
238 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
239 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
240 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
241 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
242 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
243 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
244 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.56
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 39.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100779626 3300005330 Bacteria 740
2 SwRhRL2b_contig_1180576 2162886007 Bacteria 1294
3 SwRhRL2b_contig_858736 2162886007 Bacteria 1252
4 MRS1b_contig_2665146 2162886011 Bacteria 1277
5 MBSR1b_contig_10732066 2162886012 Bacteria 1190
6 CNAas_1001037 3300000532 Bacteria 2564
7 JGI25406J46586_10004686 3300003203 Bacteria 6363
8 rootH1_10116221 3300003316 Bacteria 1374
9 Ga0065714_10064469 3300005288 Bacteria 61986
10 Ga0065704_10132086 3300005289 Bacteria 1616
11 Ga0065704_10227211 3300005289 Bacteria 1055
12 Ga0065712_10000127 3300005290 Bacteria 117106
13 Ga0065712_10073065 3300005290 Bacteria 4514
14 Ga0065712_10095724 3300005290 Bacteria 2195
15 Ga0065715_10003383 3300005293 Bacteria 4451
16 Ga0065715_10010224 3300005293 Bacteria 2627
17 Ga0065715_10059994 3300005293 Unclassified 745
18 Ga0065715_10089915 3300005293 Bacteria 8144
19 Ga0065715_10195111 3300005293 Bacteria 1392
20 Ga0065715_10214709 3300005293 Bacteria 1298
21 Ga0065715_10251952 3300005293 Unclassified 1163
22 Ga0065715_10611210 3300005293 Unclassified 701
23 Ga0065715_10774008 3300005293 Bacteria 585
24 Ga0065707_10022770 3300005295 Unclassified 1382
25 Ga0065707_10046589 3300005295 Bacteria 928
26 Ga0065707_10092069 3300005295 Bacteria 3832
27 Ga0065707_10094820 3300005295 Bacteria 3449
28 Ga0065707_10246404 3300005295 Unclassified 1139
29 Ga0070676_10584956 3300005328 Bacteria 803
30 Ga0070676_10749521 3300005328 Unclassified 717
31 Ga0070683_100662601 3300005329 Unclassified 999
32 Ga0070690_100014691 3300005330 Unclassified 4649
33 Ga0070690_100033178 3300005330 Bacteria 3229
34 Ga0070690_100186456 3300005330 Bacteria 1436
35 Ga0070670_100177057 3300005331 Bacteria 1851
36 Ga0070670_100436315 3300005331 Bacteria 1159
37 Ga0068869_100063021 3300005334 Bacteria 2722
38 Ga0068869_100113181 3300005334 Bacteria 2066
39 Ga0068869_100201903 3300005334 Unclassified 1568
40 Ga0068869_100363006 3300005334 Unclassified 1183
41 Ga0068869_100377077 3300005334 Bacteria 1162
42 Ga0068869_101848775 3300005334 Bacteria 541
43 Ga0068869_102005076 3300005334 Unclassified 519
44 Ga0068869_102017625 3300005334 Unclassified 518
45 Ga0070666_10071275 3300005335 Bacteria 2365
46 Ga0070666_10456126 3300005335 Bacteria 923
47 Ga0070666_10868004 3300005335 Bacteria 666
48 Ga0070680_100018133 3300005336 Bacteria 5561
49 Ga0070680_100263495 3300005336 Unclassified 1458
50 Ga0070680_100353134 3300005336 Bacteria 1250
51 Ga0070682_101103491 3300005337 Unclassified 664
52 Ga0068868_100071815 3300005338 Bacteria 2761
53 Ga0068868_100076234 3300005338 Bacteria 2681
54 Ga0070660_100178757 3300005339 Bacteria 1716
55 Ga0070660_100340664 3300005339 Bacteria 1234
56 Ga0070660_101561547 3300005339 Unclassified 561
57 Ga0070689_100281633 3300005340 Bacteria 1379
58 Ga0070687_100008341 3300005343 Bacteria 4382
59 Ga0070687_100063043 3300005343 Bacteria 1964
60 Ga0070687_100176340 3300005343 Unclassified 1277
61 Ga0070661_100232674 3300005344 Bacteria 1417
62 Ga0070692_10095860 3300005345 Bacteria 1620
63 Ga0070692_10171147 3300005345 Unclassified 1252
64 Ga0070692_10351304 3300005345 Unclassified 916
65 Ga0070692_10848765 3300005345 Unclassified 627
66 Ga0070692_11173971 3300005345 Unclassified 545
67 Ga0070692_11391236 3300005345 Unclassified 506
68 Ga0070669_100034434 3300005353 Bacteria 3666
69 Ga0070675_100025557 3300005354 Unclassified 4734
70 Ga0070671_100041021 3300005355 Bacteria 3846
71 Ga0070674_100145466 3300005356 Bacteria 1784
72 Ga0070674_100202914 3300005356 Bacteria 1532
73 Ga0070674_100299531 3300005356 Bacteria 1281
74 Ga0070674_102025453 3300005356 Bacteria 524
75 Ga0070673_100069575 3300005364 Bacteria 2821
76 Ga0070673_100243588 3300005364 Bacteria 1564
77 Ga0070673_100326175 3300005364 Bacteria 1357
78 Ga0070673_101233740 3300005364 Unclassified 701
79 Ga0070673_101821172 3300005364 Unclassified 577
80 Ga0070673_101932771 3300005364 Unclassified 560
81 Ga0070688_100872965 3300005365 Unclassified 708
82 Ga0070659_100078773 3300005366 Bacteria 2629
83 Ga0070659_100689395 3300005366 Bacteria 883
84 Ga0070659_100811565 3300005366 Bacteria 814
85 Ga0070659_100953233 3300005366 Unclassified 752
86 Ga0070667_100171259 3300005367 Bacteria 1917
87 Ga0070667_101309336 3300005367 Bacteria 679
88 Ga0070703_10375006 3300005406 Unclassified 613
89 Ga0070701_10066043 3300005438 Bacteria 1921
90 Ga0070701_10205016 3300005438 Bacteria 1168
91 Ga0070701_10424372 3300005438 Bacteria 848
92 Ga0070701_11064203 3300005438 Unclassified 567
93 Ga0070705_100369548 3300005440 Bacteria 1052
94 Ga0070705_100730651 3300005440 Unclassified 781
95 Ga0070705_101192052 3300005440 Unclassified 627
96 Ga0070705_101565561 3300005440 Bacteria 554
97 Ga0070705_101577508 3300005440 Unclassified 552
98 Ga0070700_100578450 3300005441 Unclassified 877
99 Ga0070700_100630555 3300005441 Bacteria 844
100 Ga0070700_101289460 3300005441 Unclassified 613
101 Ga0070694_100060356 3300005444 Bacteria 2586
102 Ga0070694_100118883 3300005444 Unclassified 1894
103 Ga0070694_100209881 3300005444 Bacteria 1456
104 Ga0070694_100263192 3300005444 Bacteria 1309
105 Ga0070694_100264405 3300005444 Bacteria 1306
106 Ga0070694_100332305 3300005444 Unclassified 1173
107 Ga0070694_100453595 3300005444 Bacteria 1013
108 Ga0070694_101484958 3300005444 Bacteria 573
109 Ga0070708_100000123 3300005445 Bacteria 52148
110 Ga0070708_100293073 3300005445 Bacteria 1532
111 Ga0070678_100011993 3300005456 Bacteria 5368
112 Ga0070678_101612980 3300005456 Unclassified 609
113 Ga0070662_100021594 3300005457 Bacteria 4398
114 Ga0070662_100040781 3300005457 Unclassified 3308
115 Ga0070662_100356498 3300005457 Bacteria 1199
116 Ga0070681_10002170 3300005458 Bacteria 17858
117 Ga0070681_10067251 3300005458 Bacteria 3551
118 Ga0068867_100026649 3300005459 Bacteria 4151
119 Ga0068867_100116773 3300005459 Bacteria 2057
120 Ga0068867_100258428 3300005459 Bacteria 1419
121 Ga0068867_100655051 3300005459 Bacteria 922
122 Ga0068867_101126020 3300005459 Unclassified 718
123 Ga0070685_10382197 3300005466 Bacteria 970
124 Ga0070685_10465148 3300005466 Bacteria 889
125 Ga0070685_10595464 3300005466 Unclassified 795
126 Ga0070685_11320044 3300005466 Bacteria 551
127 Ga0070706_100018212 3300005467 Bacteria 6480
128 Ga0070706_100048441 3300005467 Bacteria 3921
129 Ga0070706_100709163 3300005467 Unclassified 933
130 Ga0070706_100884892 3300005467 Unclassified 825
131 Ga0070706_100952194 3300005467 Bacteria 792
132 Ga0070706_101562999 3300005467 Unclassified 602
133 Ga0070707_100081443 3300005468 Bacteria 3125
134 Ga0070707_100176327 3300005468 Bacteria 2083
135 Ga0070707_100365047 3300005468 Bacteria 1403
136 Ga0070707_101096248 3300005468 Bacteria 762
137 Ga0070707_102310250 3300005468 Unclassified 505
138 Ga0070698_100002252 3300005471 Bacteria 21345
139 Ga0070698_100009435 3300005471 Bacteria 10452
140 Ga0070698_100043300 3300005471 Bacteria 4616
141 Ga0070698_101110534 3300005471 Bacteria 739
142 Ga0070699_100001087 3300005518 Bacteria 25323
143 Ga0070699_101054223 3300005518 Unclassified 746
144 Ga0070699_101068338 3300005518 Unclassified 740
145 Ga0070679_100001783 3300005530 Bacteria 19405
146 Ga0070679_101289465 3300005530 Unclassified 676
147 Ga0070684_100032447 3300005535 Bacteria 4451
148 Ga0070697_100005522 3300005536 Bacteria 9749
149 Ga0070697_100453825 3300005536 Bacteria 1117
150 Ga0070697_100608971 3300005536 Unclassified 960
151 Ga0070697_101567762 3300005536 Unclassified 589
152 Ga0068853_100138841 3300005539 Bacteria 2181
153 Ga0068853_100383091 3300005539 Bacteria 1314
154 Ga0068853_100625050 3300005539 Bacteria 1024
155 Ga0068853_100777222 3300005539 Bacteria 916
156 Ga0068853_101113398 3300005539 Bacteria 761
157 Ga0070672_100193601 3300005543 Bacteria 1698
158 Ga0070672_100612570 3300005543 Unclassified 949
159 Ga0070686_100003689 3300005544 Bacteria 8407
160 Ga0070686_100055924 3300005544 Bacteria 2530
161 Ga0070686_100928225 3300005544 Unclassified 710
162 Ga0070686_101053972 3300005544 Bacteria 669
163 Ga0070695_100142806 3300005545 Bacteria 1662
164 Ga0070695_100291685 3300005545 Unclassified 1203
165 Ga0070695_100383065 3300005545 Unclassified 1062
166 Ga0070695_100384612 3300005545 Bacteria 1060
167 Ga0070695_100962100 3300005545 Unclassified 693
168 Ga0070695_101081194 3300005545 Bacteria 656
169 Ga0070695_101226569 3300005545 Unclassified 618
170 Ga0070696_100048370 3300005546 Bacteria 2952
171 Ga0070693_100369017 3300005547 Bacteria 987
172 Ga0070693_100400823 3300005547 Unclassified 951
173 Ga0070693_100514883 3300005547 Unclassified 851
174 Ga0070693_100650467 3300005547 Bacteria 766
175 Ga0070693_101091915 3300005547 Unclassified 608
176 Ga0070665_101848310 3300005548 Unclassified 610
177 Ga0070704_100038318 3300005549 Bacteria 3283
178 Ga0070704_100141525 3300005549 Bacteria 1879
179 Ga0070704_100245502 3300005549 Bacteria 1467
180 Ga0070704_100802374 3300005549 Unclassified 841
181 Ga0068855_100808401 3300005563 Bacteria 996
182 Ga0070664_100003926 3300005564 Bacteria 11993
183 Ga0070664_100166231 3300005564 Bacteria 1955
184 Ga0070664_100888080 3300005564 Bacteria 835
185 Ga0070664_100939406 3300005564 Bacteria 812
186 Ga0070664_101966753 3300005564 Unclassified 555
187 Ga0070664_102104461 3300005564 Bacteria 535
188 Ga0068857_100018451 3300005577 Bacteria 6120
189 Ga0068857_100281950 3300005577 Bacteria 1528
190 Ga0068857_100421218 3300005577 Bacteria 1245
191 Ga0068857_100484510 3300005577 Bacteria 1159
192 Ga0068857_101201463 3300005577 Unclassified 734
193 Ga0068857_102251087 3300005577 Unclassified 535
194 Ga0068857_102417758 3300005577 Unclassified 516
195 Ga0068854_100094284 3300005578 Bacteria 2233
196 Ga0068854_100312889 3300005578 Bacteria 1274
197 Ga0068854_101235499 3300005578 Unclassified 670
198 Ga0070702_100045492 3300005615 Bacteria 2483
199 Ga0070702_101477072 3300005615 Unclassified 558
200 Ga0068852_101004332 3300005616 Bacteria 853
201 Ga0068852_101776192 3300005616 Unclassified 639
202 Ga0068852_102258172 3300005616 Bacteria 565
203 Ga0068859_100049402 3300005617 Unclassified 4224
204 Ga0068859_100069862 3300005617 Bacteria 3548
205 Ga0068859_100310235 3300005617 Bacteria 1671
206 Ga0068859_100330478 3300005617 Unclassified 1618
207 Ga0068859_100402529 3300005617 Bacteria 1465
208 Ga0068859_100536526 3300005617 Unclassified 1265
209 Ga0068859_100592983 3300005617 Bacteria 1201
210 Ga0068859_100642276 3300005617 Bacteria 1153
211 Ga0068859_100754296 3300005617 Unclassified 1062
212 Ga0068859_101082407 3300005617 Unclassified 881
213 Ga0068859_101587354 3300005617 Unclassified 722
214 Ga0068859_102512910 3300005617 Unclassified 567
215 Ga0068864_100011143 3300005618 Bacteria 7432
216 Ga0068864_100016406 3300005618 Bacteria 6166
217 Ga0068864_100196491 3300005618 Bacteria 1851
218 Ga0068864_100226445 3300005618 Bacteria 1727
219 Ga0068864_100258676 3300005618 Bacteria 1618
220 Ga0068864_101368813 3300005618 Unclassified 709
221 Ga0068864_101476703 3300005618 Bacteria 683
222 Ga0068864_102655776 3300005618 Unclassified 506
223 Ga0068866_10007393 3300005718 Bacteria 4597
224 Ga0068866_10236648 3300005718 Unclassified 1110
225 Ga0068861_100032292 3300005719 Bacteria 3853
226 Ga0068861_100084626 3300005719 Bacteria 2490
227 Ga0068861_100576777 3300005719 Bacteria 1029
228 Ga0068861_100796350 3300005719 Unclassified 887
229 Ga0068861_100870994 3300005719 Bacteria 851
230 Ga0068861_101401323 3300005719 Bacteria 683
231 Ga0068870_10038462 3300005840 Bacteria 2471
232 Ga0068870_10043528 3300005840 Bacteria 2342
233 Ga0068870_10066001 3300005840 Bacteria 1959
234 Ga0068870_10555741 3300005840 Unclassified 773
235 Ga0068870_11104368 3300005840 Unclassified 570
236 Ga0068863_100043379 3300005841 Bacteria 4270
237 Ga0068863_100783218 3300005841 Unclassified 950
238 Ga0068863_101438851 3300005841 Bacteria 697
239 Ga0068858_100159102 3300005842 Bacteria 2126
240 Ga0068858_100382148 3300005842 Bacteria 1351
241 Ga0068858_100477165 3300005842 Bacteria 1203
242 Ga0068858_100536235 3300005842 Bacteria 1132
243 Ga0068858_100952007 3300005842 Unclassified 840
244 Ga0068858_101245272 3300005842 Unclassified 732
245 Ga0068858_101272160 3300005842 Unclassified 724
246 Ga0068858_101694615 3300005842 Bacteria 624
247 Ga0068860_100061190 3300005843 Unclassified 3577
248 Ga0068860_100102004 3300005843 Bacteria 2738
249 Ga0068860_100102549 3300005843 Unclassified 2730
250 Ga0068860_100242409 3300005843 Unclassified 1754
251 Ga0068860_100900533 3300005843 Bacteria 901
252 Ga0068860_101861717 3300005843 Bacteria 623
253 Ga0068860_102734761 3300005843 Bacteria 512
254 Ga0068862_100036057 3300005844 Bacteria 4190
255 Ga0068862_100176547 3300005844 Bacteria 1915
256 Ga0068862_100287623 3300005844 Bacteria 1509
257 Ga0081539_10000156 3300005985 Bacteria 158871
258 Ga0081539_10001446 3300005985 Bacteria 40634
259 Ga0081539_10002820 3300005985 Bacteria 23219
260 Ga0081539_10003677 3300005985 Bacteria 18372
261 Ga0081539_10459590 3300005985 Unclassified 527
262 Ga0070716_100012283 3300006173 Bacteria 4338
263 Ga0097621_100308884 3300006237 Bacteria 1398
264 Ga0097621_100387892 3300006237 Unclassified 1248
265 Ga0097621_101359971 3300006237 Unclassified 672
266 Ga0068871_100305964 3300006358 Bacteria 1396
267 Ga0068871_100777021 3300006358 Bacteria 882
268 Ga0068871_101248763 3300006358 Unclassified 698
269 Ga0075428_100915725 3300006844 Unclassified 930
270 Ga0075428_101274711 3300006844 Unclassified 773
271 Ga0075431_100737283 3300006847 Unclassified 961
272 Ga0075433_10006630 3300006852 Bacteria 9163
273 Ga0075433_10123698 3300006852 Unclassified 2298
274 Ga0075433_10157491 3300006852 Unclassified 2021
275 Ga0075433_10242605 3300006852 Unclassified 1599
276 Ga0075433_10403639 3300006852 Bacteria 1206
277 Ga0075433_10435738 3300006852 Bacteria 1156
278 Ga0075433_11946409 3300006852 Unclassified 504
279 Ga0075434_100043154 3300006871 Bacteria 4471
280 Ga0075434_100567173 3300006871 Unclassified 1155
281 Ga0075434_101508800 3300006871 Bacteria 681
282 Ga0068865_100026015 3300006881 Bacteria 3854
283 Ga0068865_100316999 3300006881 Unclassified 1253
284 Ga0068865_101265043 3300006881 Unclassified 655
285 Ga0075436_100046521 3300006914 Unclassified 2992
286 Ga0097620_100049405 3300006931 Unclassified 4224
287 Ga0097620_100069865 3300006931 Bacteria 3548
288 Ga0097620_100310222 3300006931 Bacteria 1671
289 Ga0097620_100330464 3300006931 Unclassified 1618
290 Ga0097620_100402525 3300006931 Bacteria 1465
291 Ga0097620_100536531 3300006931 Unclassified 1265
292 Ga0097620_100592950 3300006931 Bacteria 1201
293 Ga0097620_100642243 3300006931 Bacteria 1153
294 Ga0097620_100754254 3300006931 Unclassified 1062
295 Ga0097620_101082420 3300006931 Unclassified 881
296 Ga0097620_101587365 3300006931 Unclassified 722
297 Ga0097620_102512357 3300006931 Unclassified 567
298 Ga0075435_100065324 3300007076 Bacteria 2958
299 Ga0075435_100415448 3300007076 Unclassified 1158
300 Ga0075435_100481597 3300007076 Bacteria 1072
301 Ga0105251_10302369 3300009011 Unclassified 725
302 Ga0105244_10456909 3300009036 Bacteria 587
303 Ga0105240_10261750 3300009093 Unclassified 1995
304 Ga0105240_12096045 3300009093 Unclassified 587
305 Ga0111539_10232737 3300009094 Bacteria 2145
306 Ga0105245_10424803 3300009098 Bacteria 1333
307 Ga0105245_10983895 3300009098 Bacteria 887
308 Ga0105245_12984973 3300009098 Unclassified 524
309 Ga0105247_10004883 3300009101 Bacteria 8531
310 Ga0105247_10587063 3300009101 Unclassified 824
311 Ga0105247_11342988 3300009101 Unclassified 576
312 Ga0105247_11571770 3300009101 Unclassified 539
313 Ga0114129_10002599 3300009147 Bacteria 25103
314 Ga0114129_10005977 3300009147 Bacteria 17238
315 Ga0114129_10022580 3300009147 Bacteria 8925
316 Ga0114129_10086674 3300009147 Unclassified 4343
317 Ga0114129_10117502 3300009147 Bacteria 3664
318 Ga0114129_10558729 3300009147 Bacteria 1487
319 Ga0114129_10877597 3300009147 Unclassified 1138
320 Ga0114129_11569622 3300009147 Unclassified 807
321 Ga0114129_11591939 3300009147 Bacteria 800
322 Ga0114129_12872928 3300009147 Unclassified 570
323 Ga0105243_10006910 3300009148 Bacteria 8745
324 Ga0105243_10446846 3300009148 Unclassified 1212
325 Ga0105243_10527569 3300009148 Bacteria 1124
326 Ga0105243_10593086 3300009148 Bacteria 1065
327 Ga0105243_10642931 3300009148 Bacteria 1027
328 Ga0105243_10693858 3300009148 Unclassified 991
329 Ga0105243_10815564 3300009148 Bacteria 921
330 Ga0105243_10872085 3300009148 Unclassified 893
331 Ga0105243_10893473 3300009148 Bacteria 883
332 Ga0105243_11171184 3300009148 Unclassified 780
333 Ga0105241_10089919 3300009174 Unclassified 2420
334 Ga0105241_10116401 3300009174 Bacteria 2147
335 Ga0105241_11895606 3300009174 Unclassified 584
336 Ga0105241_12399417 3300009174 Unclassified 526
337 Ga0105242_10004059 3300009176 Bacteria 11376
338 Ga0105242_10434920 3300009176 Unclassified 1233
339 Ga0105242_10852121 3300009176 Unclassified 907
340 Ga0105242_11642277 3300009176 Unclassified 677
341 Ga0105248_10007166 3300009177 Bacteria 12233
342 Ga0105248_10090612 3300009177 Bacteria 3443
343 Ga0105248_10191997 3300009177 Unclassified 2301
344 Ga0105248_10299372 3300009177 Bacteria 1811
345 Ga0105248_10846155 3300009177 Bacteria 1033
346 Ga0105237_11112574 3300009545 Bacteria 797
347 Ga0105238_10993301 3300009551 Unclassified 860
348 Ga0105249_10010812 3300009553 Bacteria 8023
349 Ga0105249_10914180 3300009553 Bacteria 945
350 Ga0105239_10067080 3300010375 Bacteria 3941
351 Ga0105239_10295944 3300010375 Bacteria 1822
352 Ga0105239_10702224 3300010375 Bacteria 1156
353 Ga0105239_11273376 3300010375 Bacteria 848
354 Ga0105246_10131817 3300011119 Bacteria 1868
355 Ga0105246_10621268 3300011119 Unclassified 936
356 Ga0105246_11024809 3300011119 Bacteria 749
357 Ga0105246_11698256 3300011119 Bacteria 600
358 Ga0157373_10016306 3300013100 Bacteria 5421
359 Ga0157373_10272414 3300013100 Bacteria 1198
360 Ga0157373_10810098 3300013100 Unclassified 691
361 Ga0157373_11356878 3300013100 Bacteria 540
362 Ga0157371_10266233 3300013102 Bacteria 1236
363 Ga0157371_10719536 3300013102 Unclassified 748
364 Ga0157374_10175645 3300013296 Bacteria 2091
365 Ga0157374_11010121 3300013296 Bacteria 851
366 Ga0157374_12420942 3300013296 Bacteria 552
367 Ga0157378_10005652 3300013297 Bacteria 10947
368 Ga0157378_10012103 3300013297 Bacteria 7558
369 Ga0157378_10529042 3300013297 Bacteria 1181
370 Ga0163162_10003591 3300013306 Bacteria 14849
371 Ga0163162_10162131 3300013306 Bacteria 2358
372 Ga0163162_10664349 3300013306 Bacteria 1165
373 Ga0163162_10725523 3300013306 Bacteria 1114
374 Ga0163162_12733895 3300013306 Bacteria 568
375 Ga0157372_10038536 3300013307 Bacteria 5275
376 Ga0157372_11703360 3300013307 Bacteria 725
377 Ga0157372_11844287 3300013307 Bacteria 695
378 Ga0157375_10003843 3300013308 Bacteria 13030
379 Ga0157375_10331388 3300013308 Bacteria 1687
380 Ga0157375_10397268 3300013308 Bacteria 1545
381 Ga0157375_10768766 3300013308 Bacteria 1113
382 Ga0157375_10799215 3300013308 Unclassified 1092
383 Ga0157375_11281177 3300013308 Unclassified 861
384 Ga0157375_11464247 3300013308 Unclassified 805
385 Ga0163163_10050560 3300014325 Bacteria 4093
386 Ga0163163_10263891 3300014325 Bacteria 1773
387 Ga0163163_10332202 3300014325 Bacteria 1575
388 Ga0163163_10366352 3300014325 Bacteria 1498
389 Ga0163163_10969160 3300014325 Unclassified 914
390 Ga0163163_12237213 3300014325 Unclassified 606
391 Ga0157380_10003054 3300014326 Bacteria 11411
392 Ga0157380_10333689 3300014326 Bacteria 1411
393 Ga0157380_11371978 3300014326 Bacteria 756
394 Ga0157377_10019746 3300014745 Unclassified 3524
395 Ga0157379_10142123 3300014968 Unclassified 2164
396 Ga0157379_10288336 3300014968 Bacteria 1495
397 Ga0157379_11053373 3300014968 Unclassified 777
398 Ga0157379_11962749 3300014968 Bacteria 578
399 Ga0157379_11985510 3300014968 Bacteria 575
400 Ga0157376_10408468 3300014969 Bacteria 1315
401 Ga0182007_10279700 3300015262 Bacteria 607
402 Ga0182005_1201175 3300015265 Bacteria 599
403 Ga0163161_10016710 3300017792 Bacteria 5128
404 Ga0163161_10241195 3300017792 Bacteria 1406
405 Ga0213876_10000600 3300021384 Bacteria 26721
406 Ga0213876_10011599 3300021384 Bacteria 4703
407 Ga0213876_10148167 3300021384 Bacteria 1248
408 Ga0207697_10148832 3300025315 Bacteria 1018
409 Ga0207642_10052463 3300025899 Unclassified 1850
410 Ga0207642_10187836 3300025899 Bacteria 1131
411 Ga0207642_10463411 3300025899 Unclassified 770
412 Ga0207710_10006543 3300025900 Bacteria 4965
413 Ga0207710_10083274 3300025900 Unclassified 1487
414 Ga0207710_10101088 3300025900 Unclassified 1360
415 Ga0207688_10021806 3300025901 Bacteria 3502
416 Ga0207647_10101781 3300025904 Bacteria 1704
417 Ga0207647_10461828 3300025904 Unclassified 711
418 Ga0207645_10042206 3300025907 Bacteria 2918
419 Ga0207645_10359980 3300025907 Unclassified 974
420 Ga0207645_10647759 3300025907 Unclassified 718
421 Ga0207645_11089503 3300025907 Unclassified 539
422 Ga0207643_10047380 3300025908 Bacteria 2432
423 Ga0207643_10107388 3300025908 Bacteria 1641
424 Ga0207643_10141287 3300025908 Bacteria 1438
425 Ga0207643_10168058 3300025908 Bacteria 1322
426 Ga0207643_10504479 3300025908 Unclassified 773
427 Ga0207684_10017479 3300025910 Bacteria 6152
428 Ga0207684_10451783 3300025910 Unclassified 1103
429 Ga0207684_10823646 3300025910 Unclassified 784
430 Ga0207654_10064791 3300025911 Bacteria 2150
431 Ga0207707_10011879 3300025912 Bacteria 7576
432 Ga0207707_10195636 3300025912 Unclassified 1764
433 Ga0207707_10403712 3300025912 Bacteria 1173
434 Ga0207693_10359577 3300025915 Bacteria 1139
435 Ga0207660_10095717 3300025917 Bacteria 2209
436 Ga0207660_10588215 3300025917 Unclassified 906
437 Ga0207662_10001422 3300025918 Bacteria 11605
438 Ga0207662_10087703 3300025918 Bacteria 1909
439 Ga0207662_10101312 3300025918 Bacteria 1784
440 Ga0207657_10160162 3300025919 Bacteria 1828
441 Ga0207649_10059398 3300025920 Bacteria 2399
442 Ga0207646_10088724 3300025922 Unclassified 2767
443 Ga0207646_10161131 3300025922 Bacteria 2024
444 Ga0207646_10191717 3300025922 Bacteria 1846
445 Ga0207681_10112594 3300025923 Bacteria 1982
446 Ga0207681_10179535 3300025923 Bacteria 1611
447 Ga0207681_11304705 3300025923 Bacteria 610
448 Ga0207650_10147943 3300025925 Bacteria 1851
449 Ga0207650_10450886 3300025925 Bacteria 1071
450 Ga0207659_10274748 3300025926 Bacteria 1375
451 Ga0207644_11187382 3300025931 Unclassified 641
452 Ga0207690_10081620 3300025932 Bacteria 2260
453 Ga0207690_10408431 3300025932 Unclassified 1084
454 Ga0207706_10037674 3300025933 Bacteria 4292
455 Ga0207706_10083380 3300025933 Bacteria 2810
456 Ga0207706_10179276 3300025933 Bacteria 1861
457 Ga0207706_10313988 3300025933 Bacteria 1364
458 Ga0207686_10362669 3300025934 Bacteria 1094
459 Ga0207686_11376328 3300025934 Unclassified 580
460 Ga0207709_10290548 3300025935 Bacteria 1211
461 Ga0207709_10760367 3300025935 Unclassified 780
462 Ga0207709_10900871 3300025935 Unclassified 719
463 Ga0207709_10903719 3300025935 Unclassified 718
464 Ga0207670_10222590 3300025936 Unclassified 1445
465 Ga0207670_10880101 3300025936 Bacteria 749
466 Ga0207669_10240688 3300025937 Bacteria 1341
467 Ga0207669_10408783 3300025937 Bacteria 1065
468 Ga0207704_10410584 3300025938 Bacteria 1071
469 Ga0207665_10075122 3300025939 Bacteria 2314
470 Ga0207691_10003051 3300025940 Bacteria 16337
471 Ga0207691_10686525 3300025940 Unclassified 864
472 Ga0207711_10013079 3300025941 Bacteria 6894
473 Ga0207711_10091934 3300025941 Unclassified 2669
474 Ga0207711_10119444 3300025941 Unclassified 2352
475 Ga0207711_10282664 3300025941 Unclassified 1528
476 Ga0207711_10476304 3300025941 Bacteria 1163
477 Ga0207711_11182680 3300025941 Bacteria 706
478 Ga0207711_11737266 3300025941 Unclassified 567
479 Ga0207711_11922900 3300025941 Unclassified 534
480 Ga0207689_10045159 3300025942 Bacteria 3644
481 Ga0207689_10083689 3300025942 Bacteria 2623
482 Ga0207689_10225854 3300025942 Unclassified 1547
483 Ga0207689_10532354 3300025942 Bacteria 986
484 Ga0207689_10993276 3300025942 Unclassified 708
485 Ga0207689_11055346 3300025942 Bacteria 685
486 Ga0207689_11191023 3300025942 Bacteria 641
487 Ga0207679_10189554 3300025945 Bacteria 1708
488 Ga0207679_10194615 3300025945 Bacteria 1689
489 Ga0207679_10332163 3300025945 Bacteria 1320
490 Ga0207679_10701976 3300025945 Bacteria 918
491 Ga0207679_11624995 3300025945 Bacteria 592
492 Ga0207667_10500262 3300025949 Bacteria 1233
493 Ga0207667_11200958 3300025949 Bacteria 738
494 Ga0207651_10014231 3300025960 Bacteria 4586
495 Ga0207651_10082894 3300025960 Unclassified 2317
496 Ga0207651_10374672 3300025960 Bacteria 1205
497 Ga0207712_10115704 3300025961 Bacteria 2019
498 Ga0207712_10154087 3300025961 Unclassified 1778
499 Ga0207712_11451258 3300025961 Bacteria 614
500 Ga0207712_11896855 3300025961 Unclassified 534
501 Ga0207640_10104047 3300025981 Unclassified 1997
502 Ga0207640_10454765 3300025981 Bacteria 1056
503 Ga0207640_10698099 3300025981 Bacteria 870
504 Ga0207640_11634956 3300025981 Unclassified 581
505 Ga0207658_10081116 3300025986 Unclassified 2487
506 Ga0207677_10059407 3300026023 Bacteria 2637
507 Ga0207677_10389610 3300026023 Bacteria 1178
508 Ga0207703_10308030 3300026035 Unclassified 1447
509 Ga0207703_10349653 3300026035 Unclassified 1360
510 Ga0207703_10352198 3300026035 Bacteria 1356
511 Ga0207703_11149528 3300026035 Unclassified 746
512 Ga0207703_11540701 3300026035 Unclassified 640
513 Ga0207703_12233203 3300026035 Unclassified 523
514 Ga0207639_10022120 3300026041 Bacteria 4578
515 Ga0207639_10497022 3300026041 Bacteria 1114
516 Ga0207639_12245908 3300026041 Unclassified 507
517 Ga0207678_11682325 3300026067 Bacteria 557
518 Ga0207708_10015015 3300026075 Bacteria 5804
519 Ga0207708_10029243 3300026075 Bacteria 4175
520 Ga0207708_10069910 3300026075 Bacteria 2688
521 Ga0207708_10482713 3300026075 Bacteria 1036
522 Ga0207702_10718893 3300026078 Bacteria 985
523 Ga0207641_10139838 3300026088 Bacteria 2183
524 Ga0207641_11522280 3300026088 Unclassified 671
525 Ga0207641_11618722 3300026088 Unclassified 649
526 Ga0207641_12313796 3300026088 Bacteria 537
527 Ga0207648_10010405 3300026089 Bacteria 8818
528 Ga0207648_10072413 3300026089 Bacteria 3003
529 Ga0207648_10285464 3300026089 Bacteria 1477
530 Ga0207676_10021086 3300026095 Unclassified 4777
531 Ga0207676_10030876 3300026095 Unclassified 4025
532 Ga0207676_10032368 3300026095 Unclassified 3939
533 Ga0207676_10165471 3300026095 Bacteria 1921
534 Ga0207676_11816009 3300026095 Unclassified 608
535 Ga0207676_11951350 3300026095 Unclassified 586
536 Ga0207676_12201389 3300026095 Unclassified 549
537 Ga0207676_12540444 3300026095 Unclassified 509
538 Ga0207674_10000198 3300026116 Bacteria 74606
539 Ga0207674_10231592 3300026116 Bacteria 1795
540 Ga0207674_10552824 3300026116 Bacteria 1112
541 Ga0207674_11323650 3300026116 Bacteria 690
542 Ga0207674_11554201 3300026116 Unclassified 630
543 Ga0207674_11965250 3300026116 Unclassified 550
544 Ga0207675_100006518 3300026118 Bacteria 11048
545 Ga0207675_100059926 3300026118 Unclassified 3553
546 Ga0207675_100168255 3300026118 Bacteria 2094
547 Ga0207675_100251502 3300026118 Bacteria 1711
548 Ga0207675_100803679 3300026118 Bacteria 954
549 Ga0207675_100870313 3300026118 Unclassified 916
550 Ga0207675_101098919 3300026118 Bacteria 815
551 Ga0207683_10168653 3300026121 Bacteria 1982
552 Ga0207698_11347614 3300026142 Bacteria 728
553 Ga0207428_10307428 3300027907 Bacteria 1173
554 Ga0207428_10898755 3300027907 Unclassified 626
555 Ga0268265_10350711 3300028380 Bacteria 1347
556 Ga0268265_11064672 3300028380 Unclassified 801
557 Ga0268264_10039551 3300028381 Unclassified 3896
558 Ga0268264_10072273 3300028381 Bacteria 2925
559 Ga0268264_10097485 3300028381 Bacteria 2548
560 Ga0268264_10493518 3300028381 Unclassified 1193
561 Ga0268264_10821320 3300028381 Bacteria 930
562 Ga0316176_1073199 3300030732 Unclassified 502
563 Ga0307513_10000792 3300031456 Bacteria 45967
564 Ga0307408_100860936 3300031548 Unclassified 827
565 Ga0307405_11951838 3300031731 Unclassified 524
566 Ga0307407_11638733 3300031903 Unclassified 511
567 Ga0307412_12292685 3300031911 Unclassified 504
568 Ga0307412_12310592 3300031911 Bacteria 502
569 Ga0307409_100091196 3300031995 Bacteria 2497
570 Ga0307409_102194234 3300031995 Unclassified 582
571 Ga0307416_100286465 3300032002 Bacteria 1628
572 Ga0307416_100888022 3300032002 Unclassified 991
573 Ga0307414_11025015 3300032004 Unclassified 760
574 Ga0307411_10097445 3300032005 Unclassified 2070
575 Ga0307411_10353650 3300032005 Unclassified 1199
576 Ga0307411_10480938 3300032005 Unclassified 1046
577 Ga0307415_100047183 3300032126 Bacteria 2899
578 Ga0307415_100600581 3300032126 Unclassified 979
579 Ga0307415_100971829 3300032126 Bacteria 787
580 Ga0307415_102262666 3300032126 Unclassified 533
581 Ga0373952_0202709 3300035092 Unclassified 582
582 Ga0373941_0052681 3300035115 Bacteria 1299
583 Ga0373942_0001100 3300035207 Bacteria 7222
584 Ga0395900_0498869 3300037418 Unclassified 1168
585 Ga0395900_0531216 3300037418 Unclassified 1123
586 Ga0395900_1399807 3300037418 Unclassified 612
587 Ga0395898_1244460 3300037466 Unclassified 675
588 Ga0395898_1514790 3300037466 Unclassified 596
589 Ga0395905_0013141 3300037471 Bacteria 7948
590 Ga0395905_0370412 3300037471 Unclassified 1326
591 Ga0395905_0925229 3300037471 Unclassified 775
592 Ga0395905_1006794 3300037471 Unclassified 736
593 Ga0436364_0092994 3300037853 Unclassified 2172
594 Ga0395901_0117560 3300038443 Bacteria 2794
595 Ga0395901_0210938 3300038443 Unclassified 2033
596 Ga0395901_1086247 3300038443 Unclassified 771
597 Ga0395901_1128687 3300038443 Unclassified 753
598 Ga0395901_1163233 3300038443 Unclassified 739
599 Ga0242420_005078 3300038996 Unclassified 2021
600 Ga0436365_0192215 3300039437 Unclassified 1499
601 Ga0436365_0568464 3300039437 Bacteria 4696
602 Ga0436365_0915988 3300039437 Bacteria 51495
603 Ga0436365_1614537 3300039437 Bacteria 1422
604 Ga0436365_1777818 3300039437 Bacteria 1234
605 Ga0436362_1016805 3300039453 Bacteria 1157
606 Ga0439448_0249737 3300042005 Unclassified 626
607 Ga0453683_0105666 3300044673 Unclassified 1769
608 Ga0466960_0562203 3300044901 Unclassified 674
609 Ga0451576_0861771 3300045051 Bacteria 951
610 Ga0451576_0863034 3300045051 Unclassified 950
611 Ga0451576_1551116 3300045051 Unclassified 687
612 Ga0451576_2342173 3300045051 Unclassified 547
613 Ga0466967_1632914 3300045976 Bacteria 642
614 Ga0495632_0036488 3300046519 Unclassified 2500
615 Ga0495669_0060182 3300046684 Unclassified 1717
616 Ga0495672_0449971 3300047320 Unclassified 581
617 Ga0496104_0073453 3300048907 Bacteria 3254
618 Ga0496106_0136910 3300048909 Bacteria 1924
619 Ga0496106_0162244 3300048909 Bacteria 1768
620 Ga0496106_1325667 3300048909 Unclassified 558
621 Ga0496107_0055101 3300048910 Bacteria 2872
622 Ga0496107_0404477 3300048910 Unclassified 1015
623 Ga0496108_0070033 3300048911 Bacteria 2960
624 Ga0496108_0084040 3300048911 Bacteria 2701
625 Ga0496109_0375126 3300048912 Unclassified 1344
626 Ga0496110_0787687 3300048913 Bacteria 855
627 Ga0496110_1615653 3300048913 Unclassified 558
628 Ga0496111_1294877 3300048914 Bacteria 514
629 Ga0496112_0107804 3300048915 Unclassified 2756
630 Ga0496112_0203029 3300048915 Bacteria 1941
631 Ga0496112_1530491 3300048915 Unclassified 581
632 Ga0496112_1554559 3300048915 Bacteria 575
633 Ga0496112_1940893 3300048915 Unclassified 500
634 Ga0496113_0391750 3300048916 Unclassified 1115
635 Ga0501290_002897 3300049513 Bacteria 2186
636 Ga0501291_002071 3300049514 Bacteria 2373
637 Ga0501292_001602 3300049515 Bacteria 2808
638 Ga0501292_002071 3300049515 Bacteria 2549
639 Ga0501295_006177 3300049518 Bacteria 1674
640 Ga0501296_000336 3300049519 Bacteria 4773
641 Ga0501296_022727 3300049519 Bacteria 809
642 Ga0501297_007815 3300049520 Unclassified 1168
643 Ga0501298_001169 3300049521 Bacteria 3806
644 Ga0501298_008042 3300049521 Bacteria 1763
645 Ga0501299_010855 3300049522 Unclassified 1528
646 Ga0501300_005781 3300049523 Bacteria 1821
647 Ga0501300_015126 3300049523 Unclassified 1127
648 Ga0501303_003232 3300049526 Bacteria 1297
649 Ga0501048_0336059 3300049582 Bacteria 1077
650 Ga0501198_064252 3300049649 Unclassified 680
651 Ga0501198_156585 3300049649 Unclassified 506
652 Ga0501202_004045 3300049652 Unclassified 2548
653 Ga0501202_015782 3300049652 Bacteria 1458
654 Ga0501206_100873 3300049653 Unclassified 523
655 Ga0501207_005246 3300049654 Bacteria 1788
656 Ga0501211_006241 3300049658 Unclassified 1182
657 Ga0501223_011789 3300049663 Bacteria 1754
658 Ga0501230_144768 3300049667 Unclassified 537
659 Ga0501233_004307 3300049668 Bacteria 2601
660 Ga0501233_026362 3300049668 Unclassified 1283
661 Ga0501235_002240 3300049669 Bacteria 4158
662 Ga0501243_003807 3300049675 Bacteria 2252
663 Ga0501246_031054 3300049676 Unclassified 601
664 Ga0501251_002203 3300049681 Bacteria 1869
665 Ga0501252_024616 3300049682 Unclassified 806
666 Ga0501257_074366 3300049686 Unclassified 871
667 Ga0501260_005015 3300049689 Bacteria 1236
668 Ga0501260_005682 3300049689 Unclassified 1179
669 Ga0501261_016426 3300049690 Unclassified 1027
670 Ga0501221_119543 3300049704 Bacteria 672
671 Ga0501225_0008169 3300049705 Bacteria 3010
672 Ga0501225_0141162 3300049705 Bacteria 728
673 Ga0501234_014514 3300049707 Unclassified 1238
674 Ga0501245_008377 3300049708 Unclassified 1472
675 Ga0501264_022042 3300049761 Unclassified 682
676 Ga0501272_017953 3300049769 Unclassified 835
677 Ga0501280_043001 3300049776 Unclassified 738
678 Ga0501283_000258 3300049779 Bacteria 6988
679 Ga0501212_077369 3300049851 Unclassified 597
680 nmdc:mga05p37_1381188_c1 3300050507 Unclassified 711
681 nmdc:mga05p37_1416351_c1 3300050507 Unclassified 699
682 nmdc:mga05p37_146291_c1 3300050507 Bacteria 2893
683 nmdc:mga05p37_1855341_c1 3300050507 Bacteria 578
684 nmdc:mga05p37_271315_c1 3300050507 Bacteria 2027
685 nmdc:mga05p37_28059_c1 3300050507 Bacteria 6859
686 nmdc:mga05p37_435734_c1 3300050507 Bacteria 1521
687 nmdc:mga05p37_66912_c1 3300050507 Bacteria 4420
688 nmdc:mga08y16_164908_c1 3300050511 Bacteria 2302
689 nmdc:mga08y16_758695_c1 3300050511 Unclassified 966
690 nmdc:mga0n895_1067712_c1 3300050512 Unclassified 786
691 nmdc:mga0n895_1299390_c1 3300050512 Bacteria 698
692 nmdc:mga0n895_137833_c1 3300050512 Bacteria 2467
693 nmdc:mga0n895_73209_c1 3300050512 Bacteria 3401
694 nmdc:mga0rr50_366248_c1 3300050513 Bacteria 1214
695 nmdc:mga08x19_5549_c1 3300050514 Bacteria 7459
696 nmdc:mga0a205_144721_c1 3300050515 Unclassified 2277
697 nmdc:mga0a205_14543_c1 3300050515 Bacteria 7343
698 nmdc:mga0a205_1579671_c1 3300050515 Unclassified 504
699 nmdc:mga0a205_2078_c1 3300050515 Bacteria 17510
700 nmdc:mga0a205_823422_c1 3300050515 Bacteria 776
701 Ga0500616_0002252 3300053153 Bacteria 16437
702 Ga0587072_183377 3300059643 Unclassified 523
703 Ga0070690_100779626
704 SwRhRL2b_contig_1180576
705 SwRhRL2b_contig_858736
706 MRS1b_contig_2665146
707 MBSR1b_contig_10732066
708 CNAas_1001037
709 JGI25406J46586_10004686
710 rootH1_10116221
711 Ga0065714_10064469
712 Ga0065704_10132086
713 Ga0065704_10227211
714 Ga0065712_10000127
715 Ga0065712_10073065
716 Ga0065712_10095724
717 Ga0065715_10003383
718 Ga0065715_10010224
719 Ga0065715_10059994
720 Ga0065715_10089915
721 Ga0065715_10195111
722 Ga0065715_10214709
723 Ga0065715_10251952
724 Ga0065715_10611210
725 Ga0065715_10774008
726 Ga0065707_10022770
727 Ga0065707_10046589
728 Ga0065707_10092069
729 Ga0065707_10094820
730 Ga0065707_10246404
731 Ga0070676_10584956
732 Ga0070676_10749521
733 Ga0070683_100662601
734 Ga0070690_100014691
735 Ga0070690_100033178
736 Ga0070690_100186456
737 Ga0070670_100177057
738 Ga0070670_100436315
739 Ga0068869_100063021
740 Ga0068869_100113181
741 Ga0068869_100201903
742 Ga0068869_100363006
743 Ga0068869_100377077
744 Ga0068869_101848775
745 Ga0068869_102005076
746 Ga0068869_102017625
747 Ga0070666_10071275
748 Ga0070666_10456126
749 Ga0070666_10868004
750 Ga0070680_100018133
751 Ga0070680_100263495
752 Ga0070680_100353134
753 Ga0070682_101103491
754 Ga0068868_100071815
755 Ga0068868_100076234
756 Ga0070660_100178757
757 Ga0070660_100340664
758 Ga0070660_101561547
759 Ga0070689_100281633
760 Ga0070687_100008341
761 Ga0070687_100063043
762 Ga0070687_100176340
763 Ga0070661_100232674
764 Ga0070692_10095860
765 Ga0070692_10171147
766 Ga0070692_10351304
767 Ga0070692_10848765
768 Ga0070692_11173971
769 Ga0070692_11391236
770 Ga0070669_100034434
771 Ga0070675_100025557
772 Ga0070671_100041021
773 Ga0070674_100145466
774 Ga0070674_100202914
775 Ga0070674_100299531
776 Ga0070674_102025453
777 Ga0070673_100069575
778 Ga0070673_100243588
779 Ga0070673_100326175
780 Ga0070673_101233740
781 Ga0070673_101821172
782 Ga0070673_101932771
783 Ga0070688_100872965
784 Ga0070659_100078773
785 Ga0070659_100689395
786 Ga0070659_100811565
787 Ga0070659_100953233
788 Ga0070667_100171259
789 Ga0070667_101309336
790 Ga0070703_10375006
791 Ga0070701_10066043
792 Ga0070701_10205016
793 Ga0070701_10424372
794 Ga0070701_11064203
795 Ga0070705_100369548
796 Ga0070705_100730651
797 Ga0070705_101192052
798 Ga0070705_101565561
799 Ga0070705_101577508
800 Ga0070700_100578450
801 Ga0070700_100630555
802 Ga0070700_101289460
803 Ga0070694_100060356
804 Ga0070694_100118883
805 Ga0070694_100209881
806 Ga0070694_100263192
807 Ga0070694_100264405
808 Ga0070694_100332305
809 Ga0070694_100453595
810 Ga0070694_101484958
811 Ga0070708_100000123
812 Ga0070708_100293073
813 Ga0070678_100011993
814 Ga0070678_101612980
815 Ga0070662_100021594
816 Ga0070662_100040781
817 Ga0070662_100356498
818 Ga0070681_10002170
819 Ga0070681_10067251
820 Ga0068867_100026649
821 Ga0068867_100116773
822 Ga0068867_100258428
823 Ga0068867_100655051
824 Ga0068867_101126020
825 Ga0070685_10382197
826 Ga0070685_10465148
827 Ga0070685_10595464
828 Ga0070685_11320044
829 Ga0070706_100018212
830 Ga0070706_100048441
831 Ga0070706_100709163
832 Ga0070706_100884892
833 Ga0070706_100952194
834 Ga0070706_101562999
835 Ga0070707_100081443
836 Ga0070707_100176327
837 Ga0070707_100365047
838 Ga0070707_101096248
839 Ga0070707_102310250
840 Ga0070698_100002252
841 Ga0070698_100009435
842 Ga0070698_100043300
843 Ga0070698_101110534
844 Ga0070699_100001087
845 Ga0070699_101054223
846 Ga0070699_101068338
847 Ga0070679_100001783
848 Ga0070679_101289465
849 Ga0070684_100032447
850 Ga0070697_100005522
851 Ga0070697_100453825
852 Ga0070697_100608971
853 Ga0070697_101567762
854 Ga0068853_100138841
855 Ga0068853_100383091
856 Ga0068853_100625050
857 Ga0068853_100777222
858 Ga0068853_101113398
859 Ga0070672_100193601
860 Ga0070672_100612570
861 Ga0070686_100003689
862 Ga0070686_100055924
863 Ga0070686_100928225
864 Ga0070686_101053972
865 Ga0070695_100142806
866 Ga0070695_100291685
867 Ga0070695_100383065
868 Ga0070695_100384612
869 Ga0070695_100962100
870 Ga0070695_101081194
871 Ga0070695_101226569
872 Ga0070696_100048370
873 Ga0070693_100369017
874 Ga0070693_100400823
875 Ga0070693_100514883
876 Ga0070693_100650467
877 Ga0070693_101091915
878 Ga0070665_101848310
879 Ga0070704_100038318
880 Ga0070704_100141525
881 Ga0070704_100245502
882 Ga0070704_100802374
883 Ga0068855_100808401
884 Ga0070664_100003926
885 Ga0070664_100166231
886 Ga0070664_100888080
887 Ga0070664_100939406
888 Ga0070664_101966753
889 Ga0070664_102104461
890 Ga0068857_100018451
891 Ga0068857_100281950
892 Ga0068857_100421218
893 Ga0068857_100484510
894 Ga0068857_101201463
895 Ga0068857_102251087
896 Ga0068857_102417758
897 Ga0068854_100094284
898 Ga0068854_100312889
899 Ga0068854_101235499
900 Ga0070702_100045492
901 Ga0070702_101477072
902 Ga0068852_101004332
903 Ga0068852_101776192
904 Ga0068852_102258172
905 Ga0068859_100049402
906 Ga0068859_100069862
907 Ga0068859_100310235
908 Ga0068859_100330478
909 Ga0068859_100402529
910 Ga0068859_100536526
911 Ga0068859_100592983
912 Ga0068859_100642276
913 Ga0068859_100754296
914 Ga0068859_101082407
915 Ga0068859_101587354
916 Ga0068859_102512910
917 Ga0068864_100011143
918 Ga0068864_100016406
919 Ga0068864_100196491
920 Ga0068864_100226445
921 Ga0068864_100258676
922 Ga0068864_101368813
923 Ga0068864_101476703
924 Ga0068864_102655776
925 Ga0068866_10007393
926 Ga0068866_10236648
927 Ga0068861_100032292
928 Ga0068861_100084626
929 Ga0068861_100576777
930 Ga0068861_100796350
931 Ga0068861_100870994
932 Ga0068861_101401323
933 Ga0068870_10038462
934 Ga0068870_10043528
935 Ga0068870_10066001
936 Ga0068870_10555741
937 Ga0068870_11104368
938 Ga0068863_100043379
939 Ga0068863_100783218
940 Ga0068863_101438851
941 Ga0068858_100159102
942 Ga0068858_100382148
943 Ga0068858_100477165
944 Ga0068858_100536235
945 Ga0068858_100952007
946 Ga0068858_101245272
947 Ga0068858_101272160
948 Ga0068858_101694615
949 Ga0068860_100061190
950 Ga0068860_100102004
951 Ga0068860_100102549
952 Ga0068860_100242409
953 Ga0068860_100900533
954 Ga0068860_101861717
955 Ga0068860_102734761
956 Ga0068862_100036057
957 Ga0068862_100176547
958 Ga0068862_100287623
959 Ga0081539_10000156
960 Ga0081539_10001446
961 Ga0081539_10002820
962 Ga0081539_10003677
963 Ga0081539_10459590
964 Ga0070716_100012283
965 Ga0097621_100308884
966 Ga0097621_100387892
967 Ga0097621_101359971
968 Ga0068871_100305964
969 Ga0068871_100777021
970 Ga0068871_101248763
971 Ga0075428_100915725
972 Ga0075428_101274711
973 Ga0075431_100737283
974 Ga0075433_10006630
975 Ga0075433_10123698
976 Ga0075433_10157491
977 Ga0075433_10242605
978 Ga0075433_10403639
979 Ga0075433_10435738
980 Ga0075433_11946409
981 Ga0075434_100043154
982 Ga0075434_100567173
983 Ga0075434_101508800
984 Ga0068865_100026015
985 Ga0068865_100316999
986 Ga0068865_101265043
987 Ga0075436_100046521
988 Ga0097620_100049405
989 Ga0097620_100069865
990 Ga0097620_100310222
991 Ga0097620_100330464
992 Ga0097620_100402525
993 Ga0097620_100536531
994 Ga0097620_100592950
995 Ga0097620_100642243
996 Ga0097620_100754254
997 Ga0097620_101082420
998 Ga0097620_101587365
999 Ga0097620_102512357
1000 Ga0075435_100065324
1001 Ga0075435_100415448
1002 Ga0075435_100481597
1003 Ga0105251_10302369
1004 Ga0105244_10456909
1005 Ga0105240_10261750
1006 Ga0105240_12096045
1007 Ga0111539_10232737
1008 Ga0105245_10424803
1009 Ga0105245_10983895
1010 Ga0105245_12984973
1011 Ga0105247_10004883
1012 Ga0105247_10587063
1013 Ga0105247_11342988
1014 Ga0105247_11571770
1015 Ga0114129_10002599
1016 Ga0114129_10005977
1017 Ga0114129_10022580
1018 Ga0114129_10086674
1019 Ga0114129_10117502
1020 Ga0114129_10558729
1021 Ga0114129_10877597
1022 Ga0114129_11569622
1023 Ga0114129_11591939
1024 Ga0114129_12872928
1025 Ga0105243_10006910
1026 Ga0105243_10446846
1027 Ga0105243_10527569
1028 Ga0105243_10593086
1029 Ga0105243_10642931
1030 Ga0105243_10693858
1031 Ga0105243_10815564
1032 Ga0105243_10872085
1033 Ga0105243_10893473
1034 Ga0105243_11171184
1035 Ga0105241_10089919
1036 Ga0105241_10116401
1037 Ga0105241_11895606
1038 Ga0105241_12399417
1039 Ga0105242_10004059
1040 Ga0105242_10434920
1041 Ga0105242_10852121
1042 Ga0105242_11642277
1043 Ga0105248_10007166
1044 Ga0105248_10090612
1045 Ga0105248_10191997
1046 Ga0105248_10299372
1047 Ga0105248_10846155
1048 Ga0105237_11112574
1049 Ga0105238_10993301
1050 Ga0105249_10010812
1051 Ga0105249_10914180
1052 Ga0105239_10067080
1053 Ga0105239_10295944
1054 Ga0105239_10702224
1055 Ga0105239_11273376
1056 Ga0105246_10131817
1057 Ga0105246_10621268
1058 Ga0105246_11024809
1059 Ga0105246_11698256
1060 Ga0157373_10016306
1061 Ga0157373_10272414
1062 Ga0157373_10810098
1063 Ga0157373_11356878
1064 Ga0157371_10266233
1065 Ga0157371_10719536
1066 Ga0157374_10175645
1067 Ga0157374_11010121
1068 Ga0157374_12420942
1069 Ga0157378_10005652
1070 Ga0157378_10012103
1071 Ga0157378_10529042
1072 Ga0163162_10003591
1073 Ga0163162_10162131
1074 Ga0163162_10664349
1075 Ga0163162_10725523
1076 Ga0163162_12733895
1077 Ga0157372_10038536
1078 Ga0157372_11703360
1079 Ga0157372_11844287
1080 Ga0157375_10003843
1081 Ga0157375_10331388
1082 Ga0157375_10397268
1083 Ga0157375_10768766
1084 Ga0157375_10799215
1085 Ga0157375_11281177
1086 Ga0157375_11464247
1087 Ga0163163_10050560
1088 Ga0163163_10263891
1089 Ga0163163_10332202
1090 Ga0163163_10366352
1091 Ga0163163_10969160
1092 Ga0163163_12237213
1093 Ga0157380_10003054
1094 Ga0157380_10333689
1095 Ga0157380_11371978
1096 Ga0157377_10019746
1097 Ga0157379_10142123
1098 Ga0157379_10288336
1099 Ga0157379_11053373
1100 Ga0157379_11962749
1101 Ga0157379_11985510
1102 Ga0157376_10408468
1103 Ga0182007_10279700
1104 Ga0182005_1201175
1105 Ga0163161_10016710
1106 Ga0163161_10241195
1107 Ga0213876_10000600
1108 Ga0213876_10011599
1109 Ga0213876_10148167
1110 Ga0207697_10148832
1111 Ga0207642_10052463
1112 Ga0207642_10187836
1113 Ga0207642_10463411
1114 Ga0207710_10006543
1115 Ga0207710_10083274
1116 Ga0207710_10101088
1117 Ga0207688_10021806
1118 Ga0207647_10101781
1119 Ga0207647_10461828
1120 Ga0207645_10042206
1121 Ga0207645_10359980
1122 Ga0207645_10647759
1123 Ga0207645_11089503
1124 Ga0207643_10047380
1125 Ga0207643_10107388
1126 Ga0207643_10141287
1127 Ga0207643_10168058
1128 Ga0207643_10504479
1129 Ga0207684_10017479
1130 Ga0207684_10451783
1131 Ga0207684_10823646
1132 Ga0207654_10064791
1133 Ga0207707_10011879
1134 Ga0207707_10195636
1135 Ga0207707_10403712
1136 Ga0207693_10359577
1137 Ga0207660_10095717
1138 Ga0207660_10588215
1139 Ga0207662_10001422
1140 Ga0207662_10087703
1141 Ga0207662_10101312
1142 Ga0207657_10160162
1143 Ga0207649_10059398
1144 Ga0207646_10088724
1145 Ga0207646_10161131
1146 Ga0207646_10191717
1147 Ga0207681_10112594
1148 Ga0207681_10179535
1149 Ga0207681_11304705
1150 Ga0207650_10147943
1151 Ga0207650_10450886
1152 Ga0207659_10274748
1153 Ga0207644_11187382
1154 Ga0207690_10081620
1155 Ga0207690_10408431
1156 Ga0207706_10037674
1157 Ga0207706_10083380
1158 Ga0207706_10179276
1159 Ga0207706_10313988
1160 Ga0207686_10362669
1161 Ga0207686_11376328
1162 Ga0207709_10290548
1163 Ga0207709_10760367
1164 Ga0207709_10900871
1165 Ga0207709_10903719
1166 Ga0207670_10222590
1167 Ga0207670_10880101
1168 Ga0207669_10240688
1169 Ga0207669_10408783
1170 Ga0207704_10410584
1171 Ga0207665_10075122
1172 Ga0207691_10003051
1173 Ga0207691_10686525
1174 Ga0207711_10013079
1175 Ga0207711_10091934
1176 Ga0207711_10119444
1177 Ga0207711_10282664
1178 Ga0207711_10476304
1179 Ga0207711_11182680
1180 Ga0207711_11737266
1181 Ga0207711_11922900
1182 Ga0207689_10045159
1183 Ga0207689_10083689
1184 Ga0207689_10225854
1185 Ga0207689_10532354
1186 Ga0207689_10993276
1187 Ga0207689_11055346
1188 Ga0207689_11191023
1189 Ga0207679_10189554
1190 Ga0207679_10194615
1191 Ga0207679_10332163
1192 Ga0207679_10701976
1193 Ga0207679_11624995
1194 Ga0207667_10500262
1195 Ga0207667_11200958
1196 Ga0207651_10014231
1197 Ga0207651_10082894
1198 Ga0207651_10374672
1199 Ga0207712_10115704
1200 Ga0207712_10154087
1201 Ga0207712_11451258
1202 Ga0207712_11896855
1203 Ga0207640_10104047
1204 Ga0207640_10454765
1205 Ga0207640_10698099
1206 Ga0207640_11634956
1207 Ga0207658_10081116
1208 Ga0207677_10059407
1209 Ga0207677_10389610
1210 Ga0207703_10308030
1211 Ga0207703_10349653
1212 Ga0207703_10352198
1213 Ga0207703_11149528
1214 Ga0207703_11540701
1215 Ga0207703_12233203
1216 Ga0207639_10022120
1217 Ga0207639_10497022
1218 Ga0207639_12245908
1219 Ga0207678_11682325
1220 Ga0207708_10015015
1221 Ga0207708_10029243
1222 Ga0207708_10069910
1223 Ga0207708_10482713
1224 Ga0207702_10718893
1225 Ga0207641_10139838
1226 Ga0207641_11522280
1227 Ga0207641_11618722
1228 Ga0207641_12313796
1229 Ga0207648_10010405
1230 Ga0207648_10072413
1231 Ga0207648_10285464
1232 Ga0207676_10021086
1233 Ga0207676_10030876
1234 Ga0207676_10032368
1235 Ga0207676_10165471
1236 Ga0207676_11816009
1237 Ga0207676_11951350
1238 Ga0207676_12201389
1239 Ga0207676_12540444
1240 Ga0207674_10000198
1241 Ga0207674_10231592
1242 Ga0207674_10552824
1243 Ga0207674_11323650
1244 Ga0207674_11554201
1245 Ga0207674_11965250
1246 Ga0207675_100006518
1247 Ga0207675_100059926
1248 Ga0207675_100168255
1249 Ga0207675_100251502
1250 Ga0207675_100803679
1251 Ga0207675_100870313
1252 Ga0207675_101098919
1253 Ga0207683_10168653
1254 Ga0207698_11347614
1255 Ga0207428_10307428
1256 Ga0207428_10898755
1257 Ga0268265_10350711
1258 Ga0268265_11064672
1259 Ga0268264_10039551
1260 Ga0268264_10072273
1261 Ga0268264_10097485
1262 Ga0268264_10493518
1263 Ga0268264_10821320
1264 Ga0316176_1073199
1265 Ga0307513_10000792
1266 Ga0307408_100860936
1267 Ga0307405_11951838
1268 Ga0307407_11638733
1269 Ga0307412_12292685
1270 Ga0307412_12310592
1271 Ga0307409_100091196
1272 Ga0307409_102194234
1273 Ga0307416_100286465
1274 Ga0307416_100888022
1275 Ga0307414_11025015
1276 Ga0307411_10097445
1277 Ga0307411_10353650
1278 Ga0307411_10480938
1279 Ga0307415_100047183
1280 Ga0307415_100600581
1281 Ga0307415_100971829
1282 Ga0307415_102262666
1283 Ga0373952_0202709
1284 Ga0373941_0052681
1285 Ga0373942_0001100
1286 Ga0395900_0498869
1287 Ga0395900_0531216
1288 Ga0395900_1399807
1289 Ga0395898_1244460
1290 Ga0395898_1514790
1291 Ga0395905_0013141
1292 Ga0395905_0370412
1293 Ga0395905_0925229
1294 Ga0395905_1006794
1295 Ga0436364_0092994
1296 Ga0395901_0117560
1297 Ga0395901_0210938
1298 Ga0395901_1086247
1299 Ga0395901_1128687
1300 Ga0395901_1163233
1301 Ga0242420_005078
1302 Ga0436365_0192215
1303 Ga0436365_0568464
1304 Ga0436365_0915988
1305 Ga0436365_1614537
1306 Ga0436365_1777818
1307 Ga0436362_1016805
1308 Ga0439448_0249737
1309 Ga0453683_0105666
1310 Ga0466960_0562203
1311 Ga0451576_0861771
1312 Ga0451576_0863034
1313 Ga0451576_1551116
1314 Ga0451576_2342173
1315 Ga0466967_1632914
1316 Ga0495632_0036488
1317 Ga0495669_0060182
1318 Ga0495672_0449971
1319 Ga0496104_0073453
1320 Ga0496106_0136910
1321 Ga0496106_0162244
1322 Ga0496106_1325667
1323 Ga0496107_0055101
1324 Ga0496107_0404477
1325 Ga0496108_0070033
1326 Ga0496108_0084040
1327 Ga0496109_0375126
1328 Ga0496110_0787687
1329 Ga0496110_1615653
1330 Ga0496111_1294877
1331 Ga0496112_0107804
1332 Ga0496112_0203029
1333 Ga0496112_1530491
1334 Ga0496112_1554559
1335 Ga0496112_1940893
1336 Ga0496113_0391750
1337 Ga0501290_002897
1338 Ga0501291_002071
1339 Ga0501292_001602
1340 Ga0501292_002071
1341 Ga0501295_006177
1342 Ga0501296_000336
1343 Ga0501296_022727
1344 Ga0501297_007815
1345 Ga0501298_001169
1346 Ga0501298_008042
1347 Ga0501299_010855
1348 Ga0501300_005781
1349 Ga0501300_015126
1350 Ga0501303_003232
1351 Ga0501048_0336059
1352 Ga0501198_064252
1353 Ga0501198_156585
1354 Ga0501202_004045
1355 Ga0501202_015782
1356 Ga0501206_100873
1357 Ga0501207_005246
1358 Ga0501211_006241
1359 Ga0501223_011789
1360 Ga0501230_144768
1361 Ga0501233_004307
1362 Ga0501233_026362
1363 Ga0501235_002240
1364 Ga0501243_003807
1365 Ga0501246_031054
1366 Ga0501251_002203
1367 Ga0501252_024616
1368 Ga0501257_074366
1369 Ga0501260_005015
1370 Ga0501260_005682
1371 Ga0501261_016426
1372 Ga0501221_119543
1373 Ga0501225_0008169
1374 Ga0501225_0141162
1375 Ga0501234_014514
1376 Ga0501245_008377
1377 Ga0501264_022042
1378 Ga0501272_017953
1379 Ga0501280_043001
1380 Ga0501283_000258
1381 Ga0501212_077369
1382 nmdc:mga05p37_1381188_c1
1383 nmdc:mga05p37_1416351_c1
1384 nmdc:mga05p37_146291_c1
1385 nmdc:mga05p37_1855341_c1
1386 nmdc:mga05p37_271315_c1
1387 nmdc:mga05p37_28059_c1
1388 nmdc:mga05p37_435734_c1
1389 nmdc:mga05p37_66912_c1
1390 nmdc:mga08y16_164908_c1
1391 nmdc:mga08y16_758695_c1
1392 nmdc:mga0n895_1067712_c1
1393 nmdc:mga0n895_1299390_c1
1394 nmdc:mga0n895_137833_c1
1395 nmdc:mga0n895_73209_c1
1396 nmdc:mga0rr50_366248_c1
1397 nmdc:mga08x19_5549_c1
1398 nmdc:mga0a205_144721_c1
1399 nmdc:mga0a205_14543_c1
1400 nmdc:mga0a205_1579671_c1
1401 nmdc:mga0a205_2078_c1
1402 nmdc:mga0a205_823422_c1
1403 Ga0500616_0002252
1404 Ga0587072_183377

MSA Aligner

Family Sequences

Map