F476193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 424 | 558 | 426 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8004025490|8004027737 |
| Length | 468 |
| Sequence | NNTIQLITRAEAERQGTRGRPGRAQESCDDDLAKGPWEFDLAEALAGTPGYGPGASNADTAPVETPRQGQLPQEYKDASDDELTARIMAAKAELGDRVVILGHFYQRDEVVKFADFLGDSFQLANAAKARDAAEAIVFCGVHFMAETADMLSGAHQSVILPNLAAGCSMADMADLPSVEACWAQLEELYGTEPDAAGRVPVIPVTYMNSSAALKAFCGEHGGIVCTSSNAATVLEWAYERGQRVLFFPDQHLGRNTAKAMGIPLEHMPLWNPRLPLGGNTPAAMDNAKVVLWQGFCSVHKRFTTAQIDQARADFPGVRVIVHPECPMEVVDAADESGSTDYILKAVQAAPDGTTFAIGTEINMVNRLAAQYPQHTIFCLDPVICPCSTMYRIHPGYLAWVLEGLVRGEVLNQITVPEATAVHARVALERMLAARPRSVQERAERQAAARDRRGTAGVREPAAAGAPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 5 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 6 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 7 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 8 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 9 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 10 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 11 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 12 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 13 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 14 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 15 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 16 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 17 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 18 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 19 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 20 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 21 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 22 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 23 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 24 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 25 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 26 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 27 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 28 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 29 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 30 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 31 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 32 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 33 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 34 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 35 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 36 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 37 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 38 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 39 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 40 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 41 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 42 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 43 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 44 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 45 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 46 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 47 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 48 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 49 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 50 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 51 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 52 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 53 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 54 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 55 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 56 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 57 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 58 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 59 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 60 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 61 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 62 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 63 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 64 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 65 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 66 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 67 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 68 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 69 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 70 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 71 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 72 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 73 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 74 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 75 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 76 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 77 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 78 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 79 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 80 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 81 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 82 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 83 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 84 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 85 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 86 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 87 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 88 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 89 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 90 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 91 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 92 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 93 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 94 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 95 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 96 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 97 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 98 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 99 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 100 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 101 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 102 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 103 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 104 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 105 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 106 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 107 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 108 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 109 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 110 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 111 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 112 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 113 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 114 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 115 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 116 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 117 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 118 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 119 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 120 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 121 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 122 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 123 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 124 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 125 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 126 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 127 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 128 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 129 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 130 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 131 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 132 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 133 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 134 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 135 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 136 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 137 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 138 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 139 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 140 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 141 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 142 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 143 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 144 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 145 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 146 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 148 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 151 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 152 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 168 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 170 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 171 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 172 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 173 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 174 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 175 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 176 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 177 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 178 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 179 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 181 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 182 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 183 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 184 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 185 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 186 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 187 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 189 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 201 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 206 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 218 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 264 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 266 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 268 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 275 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 276 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 285 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 286 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 287 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 288 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 291 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 292 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 295 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 296 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 297 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 298 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 299 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 300 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 301 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 302 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 303 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 304 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 305 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 308 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 369 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 408 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 412 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 414 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 416 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 417 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 418 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 419 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 420 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 421 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 422 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 423 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 424 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.89 |
| Metatranscriptomes | 0.71 |
| Isolates | 20.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 6.7 |
| Nodule | 0 |
| Rhizoplane | 5.71 |
| Rhizosphere | 66.33 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 20.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001176 | 3300000549 | Bacteria | 3945 |
| 2 | LJQas_1001543 | 3300000549 | Bacteria | 3420 |
| 3 | JGI24735J21928_10004077 | 3300002067 | Bacteria | 4930 |
| 4 | JGI25164J39214_1000715 | 3300002772 | Bacteria | 12633 |
| 5 | JGI25152J39213_1000340 | 3300002773 | Bacteria | 29707 |
| 6 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 7 | Ga0006562J51391_1021236 | 3300003578 | Bacteria | 11150 |
| 8 | Ga0006562J51391_1021238 | 3300003578 | Bacteria | 6500 |
| 9 | Ga0006562J51391_1025429 | 3300003578 | Bacteria | 5360 |
| 10 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 11 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 12 | Ga0055525_1000448 | 3300003759 | Bacteria | 23663 |
| 13 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 14 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 15 | JGI25405J52794_10016594 | 3300003911 | Bacteria | 1456 |
| 16 | Ga0070658_10013058 | 3300005327 | Bacteria | 6665 |
| 17 | Ga0070658_10069686 | 3300005327 | Bacteria | 2877 |
| 18 | Ga0070690_100003272 | 3300005330 | Bacteria | 8849 |
| 19 | Ga0070670_100013984 | 3300005331 | Bacteria | 6882 |
| 20 | Ga0070666_10016070 | 3300005335 | Bacteria | 4783 |
| 21 | Ga0070666_10079576 | 3300005335 | Bacteria | 2238 |
| 22 | Ga0070682_100123451 | 3300005337 | Bacteria | 1742 |
| 23 | Ga0070682_100183884 | 3300005337 | Bacteria | 1462 |
| 24 | Ga0068868_100001212 | 3300005338 | Bacteria | 17721 |
| 25 | Ga0070661_100021256 | 3300005344 | Bacteria | 4632 |
| 26 | Ga0070669_100186226 | 3300005353 | Bacteria | 1626 |
| 27 | Ga0070675_100006328 | 3300005354 | Bacteria | 9090 |
| 28 | Ga0070671_100022499 | 3300005355 | Bacteria | 5147 |
| 29 | Ga0070673_100010708 | 3300005364 | Bacteria | 6219 |
| 30 | Ga0070673_100083033 | 3300005364 | Bacteria | 2602 |
| 31 | Ga0070659_100036145 | 3300005366 | Bacteria | 3849 |
| 32 | Ga0070667_100007165 | 3300005367 | Bacteria | 9265 |
| 33 | Ga0070667_100232059 | 3300005367 | Bacteria | 1646 |
| 34 | Ga0070701_10031813 | 3300005438 | Bacteria | 2621 |
| 35 | Ga0070694_100071616 | 3300005444 | Bacteria | 2390 |
| 36 | Ga0070708_100130154 | 3300005445 | Bacteria | 2328 |
| 37 | Ga0070708_100161004 | 3300005445 | Bacteria | 2091 |
| 38 | Ga0070706_100004869 | 3300005467 | Bacteria | 12857 |
| 39 | Ga0070707_100047526 | 3300005468 | Bacteria | 4108 |
| 40 | Ga0070698_100107316 | 3300005471 | Bacteria | 2760 |
| 41 | Ga0070679_100009934 | 3300005530 | Bacteria | 9009 |
| 42 | Ga0070672_100005502 | 3300005543 | Bacteria | 8399 |
| 43 | Ga0070672_100010765 | 3300005543 | Bacteria | 6356 |
| 44 | Ga0068855_100038542 | 3300005563 | Bacteria | 5678 |
| 45 | Ga0068855_100049349 | 3300005563 | Bacteria | 4964 |
| 46 | Ga0068855_100049744 | 3300005563 | Bacteria | 4943 |
| 47 | Ga0070664_100043756 | 3300005564 | Bacteria | 3779 |
| 48 | Ga0068856_100060428 | 3300005614 | Bacteria | 3744 |
| 49 | Ga0068859_100002872 | 3300005617 | Bacteria | 17487 |
| 50 | Ga0068859_100123820 | 3300005617 | Bacteria | 2653 |
| 51 | Ga0068864_100023613 | 3300005618 | Bacteria | 5165 |
| 52 | Ga0068863_100124717 | 3300005841 | Bacteria | 2457 |
| 53 | Ga0068858_100066703 | 3300005842 | Bacteria | 3332 |
| 54 | Ga0081455_10000782 | 3300005937 | Bacteria | 40906 |
| 55 | Ga0075365_10006565 | 3300006038 | Bacteria | 6415 |
| 56 | Ga0075364_10008865 | 3300006051 | Bacteria | 6022 |
| 57 | Ga0075364_10105985 | 3300006051 | Bacteria | 1873 |
| 58 | Ga0075367_10025044 | 3300006178 | Bacteria | 3370 |
| 59 | Ga0075369_10005259 | 3300006186 | Bacteria | 4825 |
| 60 | Ga0097621_100088328 | 3300006237 | Bacteria | 2590 |
| 61 | Ga0075370_10042559 | 3300006353 | Bacteria | 2566 |
| 62 | Ga0075428_100083529 | 3300006844 | Bacteria | 3484 |
| 63 | Ga0075431_100014659 | 3300006847 | Bacteria | 7931 |
| 64 | Ga0075433_10059542 | 3300006852 | Bacteria | 3341 |
| 65 | Ga0075433_10061030 | 3300006852 | Bacteria | 3302 |
| 66 | Ga0075434_100034045 | 3300006871 | Bacteria | 5029 |
| 67 | Ga0075429_100021046 | 3300006880 | Bacteria | 5659 |
| 68 | Ga0075429_100143057 | 3300006880 | Bacteria | 2093 |
| 69 | Ga0075436_100036914 | 3300006914 | Bacteria | 3373 |
| 70 | Ga0097620_100002873 | 3300006931 | Bacteria | 17487 |
| 71 | Ga0097620_100123819 | 3300006931 | Bacteria | 2653 |
| 72 | Ga0075435_100019802 | 3300007076 | Bacteria | 5147 |
| 73 | Ga0105251_10005243 | 3300009011 | Bacteria | 8543 |
| 74 | Ga0105244_10000369 | 3300009036 | Bacteria | 41682 |
| 75 | Ga0105244_10027522 | 3300009036 | Bacteria | 3062 |
| 76 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 77 | Ga0105240_10018700 | 3300009093 | Bacteria | 9284 |
| 78 | Ga0105240_10224424 | 3300009093 | Bacteria | 2187 |
| 79 | Ga0105240_10259554 | 3300009093 | Bacteria | 2005 |
| 80 | Ga0114129_10038998 | 3300009147 | Bacteria | 6696 |
| 81 | Ga0114129_10111055 | 3300009147 | Bacteria | 3783 |
| 82 | Ga0114129_10296087 | 3300009147 | Bacteria | 2158 |
| 83 | Ga0114129_10480721 | 3300009147 | Bacteria | 1625 |
| 84 | Ga0105243_10065273 | 3300009148 | Bacteria | 2923 |
| 85 | Ga0105238_10054911 | 3300009551 | Bacteria | 4000 |
| 86 | Ga0105238_10066652 | 3300009551 | Bacteria | 3601 |
| 87 | Ga0105246_10001082 | 3300011119 | Bacteria | 15755 |
| 88 | Ga0105246_10008792 | 3300011119 | Bacteria | 6214 |
| 89 | Ga0157373_10010716 | 3300013100 | Bacteria | 6744 |
| 90 | Ga0157371_10091947 | 3300013102 | Bacteria | 2149 |
| 91 | Ga0157371_10149067 | 3300013102 | Bacteria | 1668 |
| 92 | Ga0157370_10028300 | 3300013104 | Bacteria | 5515 |
| 93 | Ga0157370_10031122 | 3300013104 | Bacteria | 5223 |
| 94 | Ga0157370_10096537 | 3300013104 | Bacteria | 2773 |
| 95 | Ga0157369_10002372 | 3300013105 | Bacteria | 22630 |
| 96 | Ga0157369_10027730 | 3300013105 | Bacteria | 6274 |
| 97 | Ga0157369_10045421 | 3300013105 | Bacteria | 4777 |
| 98 | Ga0157369_10062076 | 3300013105 | Bacteria | 4028 |
| 99 | Ga0157369_10132438 | 3300013105 | Bacteria | 2641 |
| 100 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 101 | Ga0163162_10001824 | 3300013306 | Bacteria | 20033 |
| 102 | Ga0163162_10076851 | 3300013306 | Bacteria | 3401 |
| 103 | Ga0157372_10003426 | 3300013307 | Bacteria | 17114 |
| 104 | Ga0157372_10119418 | 3300013307 | Bacteria | 3026 |
| 105 | Ga0157375_10005856 | 3300013308 | Bacteria | 10698 |
| 106 | Ga0157380_10025332 | 3300014326 | Bacteria | 4498 |
| 107 | Ga0182008_10017196 | 3300014497 | Bacteria | 3753 |
| 108 | Ga0157376_10456597 | 3300014969 | Bacteria | 1247 |
| 109 | Ga0197907_11096321 | 3300020069 | Bacteria | 1776 |
| 110 | Ga0206353_11327476 | 3300020082 | Bacteria | 4350 |
| 111 | Ga0209566_100105 | 3300025225 | Bacteria | 125766 |
| 112 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 113 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 114 | Ga0209147_104138 | 3300025229 | Bacteria | 2509 |
| 115 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 116 | Ga0209563_100404 | 3300025230 | Bacteria | 15438 |
| 117 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 118 | Ga0209437_100550 | 3300025233 | Bacteria | 25143 |
| 119 | Ga0207425_1007182 | 3300025245 | Bacteria | 2968 |
| 120 | Ga0209646_1000092 | 3300025246 | Bacteria | 185930 |
| 121 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 122 | Ga0209677_101020 | 3300025253 | Bacteria | 13368 |
| 123 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 124 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 125 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 126 | Ga0209233_1006487 | 3300025261 | Bacteria | 3764 |
| 127 | Ga0209233_1007871 | 3300025261 | Bacteria | 3340 |
| 128 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 129 | Ga0209455_1000938 | 3300025272 | Bacteria | 14930 |
| 130 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 131 | Ga0209051_1009666 | 3300025303 | Bacteria | 4948 |
| 132 | Ga0207697_10008295 | 3300025315 | Bacteria | 4558 |
| 133 | Ga0207697_10012277 | 3300025315 | Bacteria | 3596 |
| 134 | Ga0207655_1026654 | 3300025728 | Bacteria | 2771 |
| 135 | Ga0207655_1037570 | 3300025728 | Bacteria | 2131 |
| 136 | Ga0207682_10014997 | 3300025893 | Bacteria | 3017 |
| 137 | Ga0207680_10014740 | 3300025903 | Bacteria | 4058 |
| 138 | Ga0207680_10019631 | 3300025903 | Bacteria | 3618 |
| 139 | Ga0207647_10054086 | 3300025904 | Bacteria | 2471 |
| 140 | Ga0207645_10007271 | 3300025907 | Bacteria | 7831 |
| 141 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 142 | Ga0207705_10047308 | 3300025909 | Bacteria | 3093 |
| 143 | Ga0207684_10002651 | 3300025910 | Bacteria | 17908 |
| 144 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 145 | Ga0207695_10000858 | 3300025913 | Bacteria | 55649 |
| 146 | Ga0207652_10006097 | 3300025921 | Bacteria | 9753 |
| 147 | Ga0207646_10056703 | 3300025922 | Bacteria | 3501 |
| 148 | Ga0207650_10006763 | 3300025925 | Bacteria | 7819 |
| 149 | Ga0207664_10076048 | 3300025929 | Bacteria | 2716 |
| 150 | Ga0207644_10012665 | 3300025931 | Bacteria | 5605 |
| 151 | Ga0207690_10046340 | 3300025932 | Bacteria | 2879 |
| 152 | Ga0207709_10027799 | 3300025935 | Bacteria | 3263 |
| 153 | Ga0207670_10122370 | 3300025936 | Bacteria | 1894 |
| 154 | Ga0207691_10001302 | 3300025940 | Bacteria | 24902 |
| 155 | Ga0207679_10004813 | 3300025945 | Bacteria | 8413 |
| 156 | Ga0207651_10013358 | 3300025960 | Bacteria | 4698 |
| 157 | Ga0207651_10131448 | 3300025960 | Bacteria | 1917 |
| 158 | Ga0207677_10034188 | 3300026023 | Bacteria | 3289 |
| 159 | Ga0207703_10041460 | 3300026035 | Bacteria | 3688 |
| 160 | Ga0207678_10027738 | 3300026067 | Bacteria | 4943 |
| 161 | Ga0207678_10144102 | 3300026067 | Bacteria | 2033 |
| 162 | Ga0207708_10044731 | 3300026075 | Bacteria | 3374 |
| 163 | Ga0207702_10060974 | 3300026078 | Bacteria | 3216 |
| 164 | Ga0207702_10197522 | 3300026078 | Bacteria | 1863 |
| 165 | Ga0207676_10011408 | 3300026095 | Bacteria | 6351 |
| 166 | Ga0207683_10002085 | 3300026121 | Bacteria | 17641 |
| 167 | Ga0209983_1004597 | 3300027665 | Bacteria | 2896 |
| 168 | Ga0209588_1004585 | 3300027671 | Bacteria | 3909 |
| 169 | Ga0209971_1010420 | 3300027682 | Bacteria | 2201 |
| 170 | Ga0209974_10001964 | 3300027876 | Bacteria | 7510 |
| 171 | Ga0268265_10018400 | 3300028380 | Bacteria | 4841 |
| 172 | Ga0265338_10023633 | 3300028800 | Bacteria | 6310 |
| 173 | Ga0265325_10004001 | 3300031241 | Bacteria | 9416 |
| 174 | Ga0265325_10005116 | 3300031241 | Bacteria | 8160 |
| 175 | Ga0265339_10002295 | 3300031249 | Bacteria | 13806 |
| 176 | Ga0265331_10000443 | 3300031250 | Bacteria | 40772 |
| 177 | Ga0307408_100002055 | 3300031548 | Bacteria | 14486 |
| 178 | Ga0307408_100023125 | 3300031548 | Bacteria | 4230 |
| 179 | Ga0307408_100040291 | 3300031548 | Bacteria | 3307 |
| 180 | Ga0307408_100091475 | 3300031548 | Bacteria | 2297 |
| 181 | Ga0307408_100155820 | 3300031548 | Bacteria | 1808 |
| 182 | Ga0265313_10000994 | 3300031595 | Bacteria | 27844 |
| 183 | Ga0307514_10013636 | 3300031649 | Bacteria | 6739 |
| 184 | Ga0265314_10000302 | 3300031711 | Bacteria | 70785 |
| 185 | Ga0265342_10002672 | 3300031712 | Bacteria | 15178 |
| 186 | Ga0307405_10005658 | 3300031731 | Bacteria | 6057 |
| 187 | Ga0307405_10052027 | 3300031731 | Bacteria | 2544 |
| 188 | Ga0307413_10021820 | 3300031824 | Bacteria | 3437 |
| 189 | Ga0307413_10224004 | 3300031824 | Bacteria | 1376 |
| 190 | Ga0307410_10006673 | 3300031852 | Bacteria | 6248 |
| 191 | Ga0307410_10023189 | 3300031852 | Bacteria | 3853 |
| 192 | Ga0307410_10041954 | 3300031852 | Bacteria | 3020 |
| 193 | Ga0307410_10052163 | 3300031852 | Bacteria | 2761 |
| 194 | Ga0307410_10056293 | 3300031852 | Bacteria | 2673 |
| 195 | Ga0307410_10062070 | 3300031852 | Bacteria | 2559 |
| 196 | Ga0307406_10000134 | 3300031901 | Bacteria | 44054 |
| 197 | Ga0307406_10001972 | 3300031901 | Bacteria | 11209 |
| 198 | Ga0307406_10039843 | 3300031901 | Bacteria | 2917 |
| 199 | Ga0307406_10053391 | 3300031901 | Bacteria | 2574 |
| 200 | Ga0307406_10064180 | 3300031901 | Bacteria | 2382 |
| 201 | Ga0307406_10133833 | 3300031901 | Bacteria | 1744 |
| 202 | Ga0307407_10031593 | 3300031903 | Bacteria | 2869 |
| 203 | Ga0307407_10151088 | 3300031903 | Bacteria | 1509 |
| 204 | Ga0307412_10000416 | 3300031911 | Bacteria | 26032 |
| 205 | Ga0307412_10005951 | 3300031911 | Bacteria | 6875 |
| 206 | Ga0307412_10063214 | 3300031911 | Bacteria | 2496 |
| 207 | Ga0307409_100071648 | 3300031995 | Bacteria | 2756 |
| 208 | Ga0307416_100020987 | 3300032002 | Bacteria | 4676 |
| 209 | Ga0307416_100054098 | 3300032002 | Bacteria | 3225 |
| 210 | Ga0307416_100062031 | 3300032002 | Bacteria | 3054 |
| 211 | Ga0307416_100067357 | 3300032002 | Bacteria | 2952 |
| 212 | Ga0307416_100165893 | 3300032002 | Bacteria | 2048 |
| 213 | Ga0307416_100187327 | 3300032002 | Bacteria | 1947 |
| 214 | Ga0307416_100214805 | 3300032002 | Bacteria | 1838 |
| 215 | Ga0307414_10009861 | 3300032004 | Bacteria | 5507 |
| 216 | Ga0307414_10080613 | 3300032004 | Bacteria | 2381 |
| 217 | Ga0307411_10030583 | 3300032005 | Bacteria | 3302 |
| 218 | Ga0307411_10032279 | 3300032005 | Bacteria | 3233 |
| 219 | Ga0307415_100014105 | 3300032126 | Bacteria | 4685 |
| 220 | Ga0307415_100060998 | 3300032126 | Bacteria | 2609 |
| 221 | Ga0373953_0099992 | 3300035117 | Bacteria | 1220 |
| 222 | Ga0373937_0067011 | 3300036401 | Bacteria | 3307 |
| 223 | Ga0373937_0151798 | 3300036401 | Bacteria | 2170 |
| 224 | Ga0395899_0014141 | 3300037312 | Bacteria | 6091 |
| 225 | Ga0395899_0027010 | 3300037312 | Bacteria | 4329 |
| 226 | Ga0395899_0029311 | 3300037312 | Bacteria | 4140 |
| 227 | Ga0395899_0039949 | 3300037312 | Bacteria | 3510 |
| 228 | Ga0395899_0050049 | 3300037312 | Bacteria | 3103 |
| 229 | Ga0395899_0070412 | 3300037312 | Bacteria | 2560 |
| 230 | Ga0395899_0103261 | 3300037312 | Bacteria | 2056 |
| 231 | Ga0395900_0006021 | 3300037418 | Bacteria | 12649 |
| 232 | Ga0395900_0013950 | 3300037418 | Bacteria | 8201 |
| 233 | Ga0395900_0019535 | 3300037418 | Bacteria | 6908 |
| 234 | Ga0395900_0031457 | 3300037418 | Bacteria | 5453 |
| 235 | Ga0395900_0044352 | 3300037418 | Bacteria | 4582 |
| 236 | Ga0395900_0234170 | 3300037418 | Bacteria | 1845 |
| 237 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 238 | Ga0395898_0012998 | 3300037466 | Bacteria | 8581 |
| 239 | Ga0395898_0024438 | 3300037466 | Bacteria | 6095 |
| 240 | Ga0395898_0027106 | 3300037466 | Bacteria | 5756 |
| 241 | Ga0395898_0039526 | 3300037466 | Bacteria | 4670 |
| 242 | Ga0395898_0047410 | 3300037466 | Bacteria | 4217 |
| 243 | Ga0395898_0182519 | 3300037466 | Bacteria | 2005 |
| 244 | Ga0395905_0027168 | 3300037471 | Bacteria | 5398 |
| 245 | Ga0395905_0037583 | 3300037471 | Bacteria | 4545 |
| 246 | Ga0395901_0003822 | 3300038443 | Bacteria | 15180 |
| 247 | Ga0395901_0004201 | 3300038443 | Bacteria | 14520 |
| 248 | Ga0395901_0035125 | 3300038443 | Bacteria | 5180 |
| 249 | Ga0395901_0141094 | 3300038443 | Bacteria | 2532 |
| 250 | Ga0395901_0194540 | 3300038443 | Bacteria | 2126 |
| 251 | Ga0395901_0248137 | 3300038443 | Bacteria | 1855 |
| 252 | Ga0439436_0001061 | 3300041404 | Bacteria | 7745 |
| 253 | Ga0439436_0004255 | 3300041404 | Bacteria | 4389 |
| 254 | Ga0439436_0037508 | 3300041404 | Bacteria | 1396 |
| 255 | Ga0439438_025643 | 3300041405 | Bacteria | 1604 |
| 256 | Ga0439439_0000152 | 3300041406 | Bacteria | 10092 |
| 257 | Ga0439439_0007244 | 3300041406 | Bacteria | 2590 |
| 258 | Ga0439466_0027612 | 3300041411 | Bacteria | 1965 |
| 259 | Ga0451791_0094464 | 3300041451 | Bacteria | 4627 |
| 260 | Ga0451797_0002931 | 3300041453 | Bacteria | 2917 |
| 261 | Ga0451797_0450600 | 3300041453 | Bacteria | 2038 |
| 262 | Ga0451833_0507753 | 3300041491 | Bacteria | 5542 |
| 263 | Ga0451839_1651811 | 3300041496 | Bacteria | 2386 |
| 264 | Ga0451843_0677430 | 3300041509 | Bacteria | 2650 |
| 265 | Ga0451853_1438192 | 3300041512 | Bacteria | 2349 |
| 266 | Ga0439433_0000164 | 3300041999 | Bacteria | 10319 |
| 267 | Ga0439442_000014 | 3300042002 | Bacteria | 47589 |
| 268 | Ga0439442_000199 | 3300042002 | Bacteria | 15302 |
| 269 | Ga0439442_004090 | 3300042002 | Bacteria | 2893 |
| 270 | Ga0439448_0014332 | 3300042005 | Bacteria | 2390 |
| 271 | Ga0439432_022467 | 3300042006 | Bacteria | 2083 |
| 272 | Ga0439449_0005694 | 3300042007 | Bacteria | 4763 |
| 273 | Ga0439449_0016133 | 3300042007 | Bacteria | 2808 |
| 274 | Ga0439457_007651 | 3300042014 | Bacteria | 2587 |
| 275 | Ga0439462_0013530 | 3300042015 | Bacteria | 2091 |
| 276 | Ga0439462_0029856 | 3300042015 | Bacteria | 1442 |
| 277 | Ga0450920_000301 | 3300042122 | Bacteria | 7490 |
| 278 | Ga0450920_001565 | 3300042122 | Bacteria | 3808 |
| 279 | Ga0450907_000405 | 3300042146 | Bacteria | 13011 |
| 280 | Ga0439446_0008797 | 3300042156 | Bacteria | 2691 |
| 281 | Ga0450918_000068 | 3300042531 | Bacteria | 21289 |
| 282 | Ga0466972_0011621 | 3300044658 | Bacteria | 4421 |
| 283 | Ga0453683_0031786 | 3300044673 | Bacteria | 3334 |
| 284 | Ga0466965_0000007 | 3300044683 | Bacteria | 131940 |
| 285 | Ga0466965_0010906 | 3300044683 | Bacteria | 4250 |
| 286 | Ga0466965_0031277 | 3300044683 | Bacteria | 2595 |
| 287 | Ga0466966_0042464 | 3300044684 | Bacteria | 2918 |
| 288 | Ga0466970_0000020 | 3300044765 | Bacteria | 61048 |
| 289 | Ga0466970_0005133 | 3300044765 | Bacteria | 6471 |
| 290 | Ga0466970_0006045 | 3300044765 | Bacteria | 6036 |
| 291 | Ga0466970_0012171 | 3300044765 | Bacteria | 4393 |
| 292 | Ga0466970_0102280 | 3300044765 | Bacteria | 1561 |
| 293 | Ga0466957_0052740 | 3300044842 | Bacteria | 2477 |
| 294 | Ga0466957_0148434 | 3300044842 | Bacteria | 1515 |
| 295 | Ga0466960_0015895 | 3300044901 | Bacteria | 3252 |
| 296 | Ga0466960_0025422 | 3300044901 | Bacteria | 2679 |
| 297 | Ga0466960_0044180 | 3300044901 | Bacteria | 2123 |
| 298 | Ga0466959_0014049 | 3300045049 | Bacteria | 5813 |
| 299 | Ga0466959_0039428 | 3300045049 | Bacteria | 3490 |
| 300 | Ga0451576_0042480 | 3300045051 | Bacteria | 4799 |
| 301 | Ga0495627_002690 | 3300046453 | Bacteria | 8330 |
| 302 | Ga0495592_0007708 | 3300046454 | Bacteria | 8059 |
| 303 | Ga0495638_0067098 | 3300046460 | Bacteria | 2203 |
| 304 | Ga0495650_0039734 | 3300046471 | Bacteria | 2028 |
| 305 | Ga0495580_0002034 | 3300046472 | Bacteria | 17790 |
| 306 | Ga0495639_0012044 | 3300046475 | Bacteria | 3729 |
| 307 | Ga0495662_0024550 | 3300046476 | Bacteria | 2908 |
| 308 | Ga0495664_0035517 | 3300046477 | Bacteria | 2935 |
| 309 | Ga0495583_0058631 | 3300046506 | Bacteria | 1728 |
| 310 | Ga0495628_0053749 | 3300046516 | Bacteria | 3177 |
| 311 | Ga0495630_0055775 | 3300046517 | Bacteria | 2961 |
| 312 | Ga0495630_0126343 | 3300046517 | Bacteria | 1941 |
| 313 | Ga0495631_0023658 | 3300046518 | Bacteria | 2845 |
| 314 | Ga0495642_0006419 | 3300046528 | Bacteria | 4512 |
| 315 | Ga0495654_0008971 | 3300046530 | Bacteria | 5493 |
| 316 | Ga0495665_0013444 | 3300046531 | Bacteria | 4426 |
| 317 | Ga0495665_0029836 | 3300046531 | Bacteria | 2920 |
| 318 | Ga0495586_0000519 | 3300046535 | Bacteria | 22758 |
| 319 | Ga0495586_0089181 | 3300046535 | Bacteria | 1701 |
| 320 | Ga0495645_0002953 | 3300046543 | Bacteria | 11522 |
| 321 | Ga0495645_0014215 | 3300046543 | Bacteria | 5645 |
| 322 | Ga0495667_0000329 | 3300046559 | Bacteria | 29958 |
| 323 | Ga0495656_0003955 | 3300046615 | Bacteria | 5034 |
| 324 | Ga0495588_0008706 | 3300046674 | Bacteria | 4664 |
| 325 | Ga0495588_0020286 | 3300046674 | Bacteria | 3264 |
| 326 | Ga0495657_0005291 | 3300046675 | Bacteria | 10215 |
| 327 | Ga0495623_0013446 | 3300046679 | Bacteria | 5307 |
| 328 | Ga0495646_0009936 | 3300046680 | Bacteria | 6047 |
| 329 | Ga0495670_0007588 | 3300046691 | Bacteria | 5333 |
| 330 | Ga0495600_0003993 | 3300046809 | Bacteria | 8769 |
| 331 | Ga0495600_0118465 | 3300046809 | Bacteria | 1722 |
| 332 | Ga0495581_0000105 | 3300047315 | Bacteria | 35206 |
| 333 | Ga0495604_0006250 | 3300047317 | Bacteria | 9448 |
| 334 | Ga0495636_0008791 | 3300047318 | Bacteria | 3982 |
| 335 | Ga0495675_0051389 | 3300047444 | Bacteria | 2617 |
| 336 | Ga0495677_0026271 | 3300047445 | Bacteria | 2112 |
| 337 | Ga0495681_0056261 | 3300047470 | Bacteria | 1831 |
| 338 | Ga0495684_0085673 | 3300047471 | Bacteria | 2389 |
| 339 | Ga0495686_0000031 | 3300047472 | Bacteria | 350171 |
| 340 | Ga0495686_0005147 | 3300047472 | Bacteria | 10421 |
| 341 | Ga0495686_0071903 | 3300047472 | Bacteria | 2128 |
| 342 | Ga0496101_0014615 | 3300048904 | Bacteria | 5279 |
| 343 | Ga0496101_0031975 | 3300048904 | Bacteria | 3701 |
| 344 | Ga0496102_0109109 | 3300048905 | Bacteria | 2578 |
| 345 | Ga0496102_0170375 | 3300048905 | Bacteria | 2050 |
| 346 | Ga0496102_0197234 | 3300048905 | Bacteria | 1897 |
| 347 | Ga0496102_0220572 | 3300048905 | Bacteria | 1787 |
| 348 | Ga0496103_0033243 | 3300048906 | Bacteria | 3151 |
| 349 | Ga0496103_0132667 | 3300048906 | Bacteria | 1591 |
| 350 | Ga0496104_0000068 | 3300048907 | Bacteria | 107801 |
| 351 | Ga0496104_0182421 | 3300048907 | Bacteria | 2009 |
| 352 | Ga0496104_0299781 | 3300048907 | Bacteria | 1519 |
| 353 | Ga0496105_0012241 | 3300048908 | Bacteria | 6792 |
| 354 | Ga0496105_0016403 | 3300048908 | Bacteria | 5914 |
| 355 | Ga0496105_0058587 | 3300048908 | Bacteria | 3179 |
| 356 | Ga0496105_0081913 | 3300048908 | Bacteria | 2665 |
| 357 | Ga0496105_0220007 | 3300048908 | Bacteria | 1546 |
| 358 | Ga0496106_0158377 | 3300048909 | Bacteria | 1789 |
| 359 | Ga0496107_0024168 | 3300048910 | Bacteria | 4298 |
| 360 | Ga0496107_0055552 | 3300048910 | Bacteria | 2859 |
| 361 | Ga0496109_0023037 | 3300048912 | Bacteria | 5522 |
| 362 | Ga0496110_0148066 | 3300048913 | Bacteria | 2124 |
| 363 | Ga0496110_0154930 | 3300048913 | Bacteria | 2075 |
| 364 | Ga0496111_0140631 | 3300048914 | Bacteria | 1788 |
| 365 | Ga0496111_0145586 | 3300048914 | Bacteria | 1756 |
| 366 | Ga0496112_0016287 | 3300048915 | Bacteria | 6960 |
| 367 | Ga0496112_0161213 | 3300048915 | Bacteria | 2209 |
| 368 | Ga0496112_0231970 | 3300048915 | Bacteria | 1800 |
| 369 | Ga0496112_0306807 | 3300048915 | Bacteria | 1532 |
| 370 | Ga0496113_0034968 | 3300048916 | Bacteria | 3671 |
| 371 | Ga0496113_0058490 | 3300048916 | Bacteria | 2900 |
| 372 | Ga0496113_0105541 | 3300048916 | Bacteria | 2187 |
| 373 | Ga0496114_0024056 | 3300048917 | Bacteria | 4970 |
| 374 | Ga0496114_0083770 | 3300048917 | Bacteria | 2698 |
| 375 | Ga0496114_0223202 | 3300048917 | Bacteria | 1654 |
| 376 | Ga0496115_0027610 | 3300048918 | Bacteria | 4442 |
| 377 | Ga0496115_0054647 | 3300048918 | Bacteria | 3207 |
| 378 | Ga0496115_0056830 | 3300048918 | Bacteria | 3145 |
| 379 | Ga0496117_0000063 | 3300048920 | Bacteria | 254446 |
| 380 | Ga0496117_0000174 | 3300048920 | Bacteria | 132648 |
| 381 | Ga0496117_0001554 | 3300048920 | Bacteria | 32603 |
| 382 | Ga0496117_0001880 | 3300048920 | Bacteria | 28246 |
| 383 | Ga0496117_0002376 | 3300048920 | Bacteria | 23997 |
| 384 | Ga0496117_0012311 | 3300048920 | Bacteria | 7561 |
| 385 | Ga0496117_0039654 | 3300048920 | Bacteria | 3472 |
| 386 | Ga0496117_0042167 | 3300048920 | Bacteria | 3333 |
| 387 | Ga0496118_0000243 | 3300048921 | Bacteria | 96384 |
| 388 | Ga0496118_0015499 | 3300048921 | Bacteria | 7052 |
| 389 | Ga0496118_0046062 | 3300048921 | Bacteria | 3397 |
| 390 | Ga0496119_0000852 | 3300048922 | Bacteria | 40223 |
| 391 | Ga0496119_0003502 | 3300048922 | Bacteria | 16238 |
| 392 | Ga0496119_0008669 | 3300048922 | Bacteria | 8892 |
| 393 | Ga0496119_0013519 | 3300048922 | Bacteria | 6491 |
| 394 | Ga0496119_0018367 | 3300048922 | Bacteria | 5208 |
| 395 | Ga0496119_0022903 | 3300048922 | Bacteria | 4451 |
| 396 | Ga0496119_0030887 | 3300048922 | Bacteria | 3603 |
| 397 | Ga0496119_0038767 | 3300048922 | Bacteria | 3074 |
| 398 | Ga0496119_0054435 | 3300048922 | Bacteria | 2436 |
| 399 | Ga0496119_0070082 | 3300048922 | Bacteria | 2058 |
| 400 | Ga0496119_0106614 | 3300048922 | Bacteria | 1563 |
| 401 | Ga0496120_0000717 | 3300048923 | Bacteria | 48597 |
| 402 | Ga0496120_0002055 | 3300048923 | Bacteria | 21739 |
| 403 | Ga0496120_0005909 | 3300048923 | Bacteria | 9547 |
| 404 | Ga0496120_0026910 | 3300048923 | Bacteria | 3546 |
| 405 | Ga0496120_0033460 | 3300048923 | Bacteria | 3089 |
| 406 | Ga0496121_0000277 | 3300048924 | Bacteria | 107014 |
| 407 | Ga0496121_0099439 | 3300048924 | Bacteria | 2248 |
| 408 | Ga0496121_0130278 | 3300048924 | Bacteria | 1884 |
| 409 | Ga0496121_0194718 | 3300048924 | Bacteria | 1450 |
| 410 | Ga0496122_0000036 | 3300048925 | Bacteria | 312598 |
| 411 | Ga0496122_0000059 | 3300048925 | Bacteria | 247170 |
| 412 | Ga0496122_0002117 | 3300048925 | Bacteria | 29350 |
| 413 | Ga0496122_0004342 | 3300048925 | Bacteria | 17724 |
| 414 | Ga0496122_0013880 | 3300048925 | Bacteria | 7841 |
| 415 | Ga0496122_0020089 | 3300048925 | Bacteria | 6064 |
| 416 | Ga0496122_0052080 | 3300048925 | Bacteria | 3103 |
| 417 | Ga0496123_0000011 | 3300048926 | Bacteria | 493925 |
| 418 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 419 | Ga0496123_0002417 | 3300048926 | Bacteria | 23290 |
| 420 | Ga0496123_0005485 | 3300048926 | Bacteria | 12755 |
| 421 | Ga0496123_0020410 | 3300048926 | Bacteria | 5184 |
| 422 | Ga0496123_0050962 | 3300048926 | Bacteria | 2761 |
| 423 | Ga0496123_0093458 | 3300048926 | Bacteria | 1776 |
| 424 | Ga0496124_0000040 | 3300048927 | Bacteria | 307061 |
| 425 | Ga0496124_0001451 | 3300048927 | Bacteria | 34959 |
| 426 | Ga0496124_0017785 | 3300048927 | Bacteria | 6685 |
| 427 | Ga0496124_0019767 | 3300048927 | Bacteria | 6251 |
| 428 | Ga0496124_0025971 | 3300048927 | Bacteria | 5291 |
| 429 | Ga0496124_0108885 | 3300048927 | Bacteria | 2234 |
| 430 | Ga0496125_0000167 | 3300048928 | Bacteria | 147134 |
| 431 | Ga0496125_0001957 | 3300048928 | Bacteria | 28103 |
| 432 | Ga0496125_0004725 | 3300048928 | Bacteria | 15520 |
| 433 | Ga0496125_0011598 | 3300048928 | Bacteria | 8803 |
| 434 | Ga0496125_0019504 | 3300048928 | Bacteria | 6393 |
| 435 | Ga0496125_0048612 | 3300048928 | Bacteria | 3535 |
| 436 | Ga0496125_0075659 | 3300048928 | Bacteria | 2604 |
| 437 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 438 | Ga0496126_0002482 | 3300048929 | Bacteria | 24819 |
| 439 | Ga0496126_0063488 | 3300048929 | Bacteria | 3311 |
| 440 | Ga0496126_0072481 | 3300048929 | Bacteria | 3064 |
| 441 | Ga0496126_0142466 | 3300048929 | Bacteria | 2062 |
| 442 | Ga0496126_0175314 | 3300048929 | Bacteria | 1824 |
| 443 | Ga0501031_0005313 | 3300049568 | Bacteria | 8388 |
| 444 | Ga0501031_0019934 | 3300049568 | Bacteria | 4371 |
| 445 | Ga0501032_0002687 | 3300049569 | Bacteria | 13866 |
| 446 | Ga0501032_0003977 | 3300049569 | Bacteria | 11209 |
| 447 | Ga0501032_0005464 | 3300049569 | Bacteria | 9430 |
| 448 | Ga0501032_0031490 | 3300049569 | Bacteria | 3636 |
| 449 | Ga0501033_0008438 | 3300049570 | Bacteria | 7978 |
| 450 | Ga0501033_0010823 | 3300049570 | Bacteria | 6995 |
| 451 | Ga0501033_0018869 | 3300049570 | Bacteria | 5214 |
| 452 | Ga0501033_0025648 | 3300049570 | Bacteria | 4441 |
| 453 | Ga0501033_0026484 | 3300049570 | Bacteria | 4363 |
| 454 | Ga0501033_0051393 | 3300049570 | Bacteria | 3055 |
| 455 | Ga0501034_0000051 | 3300049571 | Bacteria | 210960 |
| 456 | Ga0501034_0001053 | 3300049571 | Bacteria | 39170 |
| 457 | Ga0501034_0002709 | 3300049571 | Bacteria | 20874 |
| 458 | Ga0501034_0007406 | 3300049571 | Bacteria | 11684 |
| 459 | Ga0501034_0019972 | 3300049571 | Bacteria | 6842 |
| 460 | Ga0501034_0022863 | 3300049571 | Bacteria | 6369 |
| 461 | Ga0501034_0036854 | 3300049571 | Bacteria | 4952 |
| 462 | Ga0501034_0046193 | 3300049571 | Bacteria | 4400 |
| 463 | Ga0501034_0086008 | 3300049571 | Bacteria | 3145 |
| 464 | Ga0501034_0148873 | 3300049571 | Bacteria | 2317 |
| 465 | Ga0501034_0203424 | 3300049571 | Bacteria | 1937 |
| 466 | Ga0501036_0001002 | 3300049572 | Bacteria | 21360 |
| 467 | Ga0501036_0179586 | 3300049572 | Bacteria | 1782 |
| 468 | Ga0501036_0187702 | 3300049572 | Bacteria | 1740 |
| 469 | Ga0501037_0001216 | 3300049573 | Bacteria | 19066 |
| 470 | Ga0501037_0006593 | 3300049573 | Bacteria | 8490 |
| 471 | Ga0501037_0007401 | 3300049573 | Bacteria | 8030 |
| 472 | Ga0501037_0021945 | 3300049573 | Bacteria | 4727 |
| 473 | Ga0501038_0000560 | 3300049574 | Bacteria | 32917 |
| 474 | Ga0501038_0005019 | 3300049574 | Bacteria | 12287 |
| 475 | Ga0501038_0016174 | 3300049574 | Bacteria | 6768 |
| 476 | Ga0501038_0027665 | 3300049574 | Bacteria | 5042 |
| 477 | Ga0501038_0034316 | 3300049574 | Bacteria | 4462 |
| 478 | Ga0501038_0050099 | 3300049574 | Bacteria | 3609 |
| 479 | Ga0501039_0013558 | 3300049575 | Bacteria | 6234 |
| 480 | Ga0501039_0027628 | 3300049575 | Bacteria | 4363 |
| 481 | Ga0501039_0043810 | 3300049575 | Bacteria | 3457 |
| 482 | Ga0501039_0170799 | 3300049575 | Bacteria | 1709 |
| 483 | Ga0501039_0184928 | 3300049575 | Bacteria | 1638 |
| 484 | Ga0501041_0067160 | 3300049577 | Bacteria | 2198 |
| 485 | Ga0501042_0013492 | 3300049578 | Bacteria | 5563 |
| 486 | Ga0501042_0139500 | 3300049578 | Bacteria | 1747 |
| 487 | Ga0501043_0002084 | 3300049579 | Bacteria | 17078 |
| 488 | Ga0501043_0006752 | 3300049579 | Bacteria | 9163 |
| 489 | Ga0501043_0013661 | 3300049579 | Bacteria | 6355 |
| 490 | Ga0501043_0102047 | 3300049579 | Bacteria | 2255 |
| 491 | Ga0501046_0000916 | 3300049580 | Bacteria | 28889 |
| 492 | Ga0501046_0003866 | 3300049580 | Bacteria | 13703 |
| 493 | Ga0501046_0027416 | 3300049580 | Bacteria | 4646 |
| 494 | Ga0501046_0037619 | 3300049580 | Bacteria | 3888 |
| 495 | Ga0501046_0049306 | 3300049580 | Bacteria | 3330 |
| 496 | Ga0501047_0001949 | 3300049581 | Bacteria | 19833 |
| 497 | Ga0501047_0014877 | 3300049581 | Bacteria | 7407 |
| 498 | Ga0501047_0032957 | 3300049581 | Bacteria | 5002 |
| 499 | Ga0501047_0034531 | 3300049581 | Bacteria | 4883 |
| 500 | Ga0501047_0048158 | 3300049581 | Bacteria | 4116 |
| 501 | Ga0501047_0052215 | 3300049581 | Bacteria | 3951 |
| 502 | Ga0501048_0004529 | 3300049582 | Bacteria | 10579 |
| 503 | Ga0501048_0010720 | 3300049582 | Bacteria | 6835 |
| 504 | Ga0501048_0130760 | 3300049582 | Bacteria | 1775 |
| 505 | Ga0501069_0018952 | 3300049585 | Bacteria | 3716 |
| 506 | Ga0501069_0129693 | 3300049585 | Bacteria | 1443 |
| 507 | Ga0501070_0003336 | 3300049586 | Bacteria | 13945 |
| 508 | Ga0501070_0003566 | 3300049586 | Bacteria | 13461 |
| 509 | Ga0501070_0010543 | 3300049586 | Bacteria | 7813 |
| 510 | Ga0501070_0019920 | 3300049586 | Bacteria | 5625 |
| 511 | Ga0501071_0062179 | 3300049587 | Bacteria | 2705 |
| 512 | Ga0501072_0007030 | 3300049588 | Bacteria | 8546 |
| 513 | Ga0501073_0001325 | 3300049589 | Bacteria | 18227 |
| 514 | Ga0501074_0046335 | 3300049590 | Bacteria | 3143 |
| 515 | Ga0501074_0058793 | 3300049590 | Bacteria | 2770 |
| 516 | Ga0501075_0233033 | 3300049591 | Bacteria | 1404 |
| 517 | Ga0501077_0050515 | 3300049593 | Bacteria | 2643 |
| 518 | Ga0501079_0089855 | 3300049741 | Bacteria | 2379 |
| 519 | Ga0501079_0229781 | 3300049741 | Bacteria | 1449 |
| 520 | Ga0501080_0003872 | 3300049742 | Bacteria | 13239 |
| 521 | Ga0501080_0036743 | 3300049742 | Bacteria | 4572 |
| 522 | Ga0501080_0037244 | 3300049742 | Bacteria | 4541 |
| 523 | Ga0501083_0000011 | 3300049744 | Bacteria | 181041 |
| 524 | Ga0501083_0084207 | 3300049744 | Bacteria | 2105 |
| 525 | Ga0501035_0009995 | 3300049822 | Bacteria | 8807 |
| 526 | Ga0501035_0044944 | 3300049822 | Bacteria | 3975 |
| 527 | Ga0501035_0283066 | 3300049822 | Bacteria | 1401 |
| 528 | Ga0501044_0002815 | 3300049823 | Bacteria | 19825 |
| 529 | Ga0501044_0004183 | 3300049823 | Bacteria | 16222 |
| 530 | Ga0501044_0040716 | 3300049823 | Bacteria | 4841 |
| 531 | Ga0501044_0483968 | 3300049823 | Bacteria | 1140 |
| 532 | Ga0501045_0007075 | 3300049824 | Bacteria | 7777 |
| 533 | Ga0501045_0025905 | 3300049824 | Bacteria | 4216 |
| 534 | Ga0501045_0090758 | 3300049824 | Bacteria | 2258 |
| 535 | nmdc:mga0yw44_43230_c1 | 3300050492 | Bacteria | 2689 |
| 536 | nmdc:mga0yw44_8613_c1 | 3300050492 | Bacteria | 5093 |
| 537 | nmdc:mga07m45_74529_c1 | 3300050496 | Bacteria | 1933 |
| 538 | nmdc:mga05p37_376854_c1 | 3300050507 | Bacteria | 1664 |
| 539 | nmdc:mga05p37_51035_c1 | 3300050507 | Bacteria | 5087 |
| 540 | nmdc:mga05p37_89938_c1 | 3300050507 | Bacteria | 3783 |
| 541 | nmdc:mga09592_61699_c1 | 3300050508 | Bacteria | 3171 |
| 542 | nmdc:mga06r32_90298_c1 | 3300050510 | Bacteria | 2992 |
| 543 | nmdc:mga0n895_285439_c1 | 3300050512 | Bacteria | 1673 |
| 544 | nmdc:mga0rr50_263765_c1 | 3300050513 | Bacteria | 1434 |
| 545 | nmdc:mga0a205_100831_c1 | 3300050515 | Bacteria | 2786 |
| 546 | nmdc:mga0a205_165248_c1 | 3300050515 | Bacteria | 2109 |
| 547 | nmdc:mga0a205_79985_c1 | 3300050515 | Bacteria | 3158 |
| 548 | Ga0500635_0000039 | 3300053080 | Bacteria | 93004 |
| 549 | Ga0500643_000334 | 3300053087 | Bacteria | 37718 |
| 550 | Ga0500559_0006651 | 3300053136 | Bacteria | 5199 |
| 551 | Ga0500568_0000026 | 3300053139 | Bacteria | 165582 |
| 552 | Ga0500568_0000172 | 3300053139 | Bacteria | 56463 |
| 553 | Ga0500573_0005544 | 3300053140 | Bacteria | 6765 |
| 554 | Ga0500573_0009461 | 3300053140 | Bacteria | 5408 |
| 555 | Ga0500573_0026648 | 3300053140 | Bacteria | 3323 |
| 556 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 557 | Ga0500645_009652 | 3300053730 | Bacteria | 3234 |
| 558 | Ga0501084_0043225 | 3300054114 | Bacteria | 3770 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_0483968 | Ga0501044_0483968_88_1125 | 334 |
| 2 | 3300026067 | Ga0207678_10144102 | Ga0207678_101441022 | 346 |
| 3 | 3300049593 | Ga0501077_0050515 | Ga0501077_0050515_527_1594 | 349 |
| 4 | 3300049575 | Ga0501039_0043810 | Ga0501039_0043810_1594_2715 | 350 |
| 5 | 3300005530 | Ga0070679_100009934 | Ga0070679_1000099342 | 360 |
| 6 | 3300009093 | Ga0105240_10259554 | Ga0105240_102595542 | 360 |
| 7 | 3300045051 | Ga0451576_0042480 | Ga0451576_0042480_1642_2736 | 360 |
| 8 | 3300005354 | Ga0070675_100006328 | Ga0070675_1000063284 | 361 |
| 9 | 3300005355 | Ga0070671_100022499 | Ga0070671_1000224992 | 361 |
| 10 | 3300005367 | Ga0070667_100007165 | Ga0070667_1000071652 | 361 |
| 11 | 3300005543 | Ga0070672_100005502 | Ga0070672_1000055025 | 361 |
| 12 | 3300005564 | Ga0070664_100043756 | Ga0070664_1000437563 | 361 |
| 13 | 3300005617 | Ga0068859_100123820 | Ga0068859_1001238201 | 361 |
| 14 | 3300005618 | Ga0068864_100023613 | Ga0068864_1000236135 | 361 |
| 15 | 3300005841 | Ga0068863_100124717 | Ga0068863_1001247172 | 361 |
| 16 | 3300005842 | Ga0068858_100066703 | Ga0068858_1000667032 | 361 |
| 17 | 3300006237 | Ga0097621_100088328 | Ga0097621_1000883284 | 361 |
| 18 | 3300006931 | Ga0097620_100123819 | Ga0097620_1001238191 | 361 |
| 19 | 3300009147 | Ga0114129_10296087 | Ga0114129_102960872 | 361 |
| 20 | 3300025903 | Ga0207680_10014740 | Ga0207680_100147404 | 361 |
| 21 | 3300025925 | Ga0207650_10006763 | Ga0207650_100067638 | 361 |
| 22 | 3300025931 | Ga0207644_10012665 | Ga0207644_100126654 | 361 |
| 23 | 3300025945 | Ga0207679_10004813 | Ga0207679_100048135 | 361 |
| 24 | 3300025960 | Ga0207651_10013358 | Ga0207651_100133583 | 361 |
| 25 | 3300026023 | Ga0207677_10034188 | Ga0207677_100341883 | 361 |
| 26 | 3300026035 | Ga0207703_10041460 | Ga0207703_100414605 | 361 |
| 27 | 3300026095 | Ga0207676_10011408 | Ga0207676_100114084 | 361 |
| 28 | 3300005330 | Ga0070690_100003272 | Ga0070690_1000032729 | 362 |
| 29 | 3300005331 | Ga0070670_100013984 | Ga0070670_1000139848 | 362 |
| 30 | 3300005335 | Ga0070666_10016070 | Ga0070666_100160703 | 362 |
| 31 | 3300005338 | Ga0068868_100001212 | Ga0068868_1000012127 | 362 |
| 32 | 3300005344 | Ga0070661_100021256 | Ga0070661_1000212563 | 362 |
| 33 | 3300005364 | Ga0070673_100010708 | Ga0070673_1000107084 | 362 |
| 34 | 3300013306 | Ga0163162_10001824 | Ga0163162_100018249 | 362 |
| 35 | 3300013308 | Ga0157375_10005856 | Ga0157375_100058565 | 362 |
| 36 | 3300014969 | Ga0157376_10456597 | Ga0157376_104565971 | 362 |
| 37 | 3300025936 | Ga0207670_10122370 | Ga0207670_101223703 | 362 |
| 38 | 3300035117 | Ga0373953_0099992 | Ga0373953_0099992_68_1156 | 362 |
| 39 | 3300036401 | Ga0373937_0067011 | Ga0373937_0067011_222_1310 | 362 |
| 40 | 3300036401 | Ga0373937_0151798 | Ga0373937_0151798_457_1545 | 362 |
| 41 | 3300046454 | Ga0495592_0007708 | Ga0495592_0007708_4202_5290 | 362 |
| 42 | 3300046559 | Ga0495667_0000329 | Ga0495667_0000329_4321_5409 | 362 |
| 43 | 3300046675 | Ga0495657_0005291 | Ga0495657_0005291_288_1376 | 362 |
| 44 | 3300049571 | Ga0501034_0022863 | Ga0501034_0022863_5047_6186 | 364 |
| 45 | 3300049580 | Ga0501046_0003866 | Ga0501046_0003866_6444_7583 | 364 |
| 46 | 3300049581 | Ga0501047_0014877 | Ga0501047_0014877_4998_6137 | 364 |
| 47 | 3300028800 | Ga0265338_10023633 | Ga0265338_100236332 | 365 |
| 48 | 3300031241 | Ga0265325_10004001 | Ga0265325_100040013 | 365 |
| 49 | 3300031241 | Ga0265325_10005116 | Ga0265325_100051163 | 365 |
| 50 | 3300031249 | Ga0265339_10002295 | Ga0265339_100022952 | 365 |
| 51 | 3300031250 | Ga0265331_10000443 | Ga0265331_100004436 | 365 |
| 52 | 3300031595 | Ga0265313_10000994 | Ga0265313_1000099410 | 365 |
| 53 | 3300031711 | Ga0265314_10000302 | Ga0265314_1000030210 | 365 |
| 54 | 3300031712 | Ga0265342_10002672 | Ga0265342_100026727 | 365 |
| 55 | 3300049581 | Ga0501047_0032957 | Ga0501047_0032957_2792_3937 | 365 |
| 56 | 3300006880 | Ga0075429_100143057 | Ga0075429_1001430572 | 366 |
| 57 | 3300048918 | Ga0496115_0054647 | Ga0496115_0054647_1463_2611 | 366 |
| 58 | 3300005471 | Ga0070698_100107316 | Ga0070698_1001073162 | 370 |
| 59 | iso_pu_bacteria | 2852677369 | 2852678074 | 375 |
| 60 | 3300009093 | Ga0105240_10224424 | Ga0105240_102244241 | 376 |
| 61 | 3300046471 | Ga0495650_0039734 | Ga0495650_0039734_25_1221 | 379 |
| 62 | 3300048914 | Ga0496111_0145586 | Ga0496111_0145586_58_1203 | 379 |
| 63 | 3300048922 | Ga0496119_0070082 | Ga0496119_0070082_827_1990 | 379 |
| 64 | 3300048924 | Ga0496121_0194718 | Ga0496121_0194718_201_1376 | 379 |
| 65 | 3300048925 | Ga0496122_0004342 | Ga0496122_0004342_52_1197 | 379 |
| 66 | 3300053087 | Ga0500643_000334 | Ga0500643_000334_25896_27041 | 379 |
| 67 | iso_pu_bacteria | 8055034563 | 8055036750 | 381 |
| 68 | 3300006844 | Ga0075428_100083529 | Ga0075428_1000835292 | 382 |
| 69 | 3300006847 | Ga0075431_100014659 | Ga0075431_1000146594 | 382 |
| 70 | 3300006871 | Ga0075434_100034045 | Ga0075434_1000340452 | 382 |
| 71 | 3300007076 | Ga0075435_100019802 | Ga0075435_1000198022 | 382 |
| 72 | 3300013102 | Ga0157371_10091947 | Ga0157371_100919472 | 383 |
| 73 | 3300006914 | Ga0075436_100036914 | Ga0075436_1000369142 | 384 |
| 74 | 3300049571 | Ga0501034_0019972 | Ga0501034_0019972_1712_2917 | 384 |
| 75 | 3300049572 | Ga0501036_0187702 | Ga0501036_0187702_564_1721 | 384 |
| 76 | 3300049579 | Ga0501043_0002084 | Ga0501043_0002084_13969_15174 | 384 |
| 77 | 3300049581 | Ga0501047_0052215 | Ga0501047_0052215_1627_2832 | 384 |
| 78 | 3300049585 | Ga0501069_0129693 | Ga0501069_0129693_24_1229 | 384 |
| 79 | 3300049742 | Ga0501080_0036743 | Ga0501080_0036743_709_1914 | 384 |
| 80 | 3300027665 | Ga0209983_1004597 | Ga0209983_10045974 | 386 |
| 81 | 3300027682 | Ga0209971_1010420 | Ga0209971_10104203 | 386 |
| 82 | 3300027876 | Ga0209974_10001964 | Ga0209974_100019648 | 386 |
| 83 | 3300049572 | Ga0501036_0179586 | Ga0501036_0179586_293_1495 | 386 |
| 84 | 3300049582 | Ga0501048_0130760 | Ga0501048_0130760_314_1516 | 386 |
| 85 | 3300049590 | Ga0501074_0058793 | Ga0501074_0058793_505_1707 | 386 |
| 86 | 3300049741 | Ga0501079_0229781 | Ga0501079_0229781_95_1297 | 386 |
| 87 | 3300049822 | Ga0501035_0283066 | Ga0501035_0283066_94_1296 | 386 |
| 88 | 3300044901 | Ga0466960_0044180 | Ga0466960_0044180_705_2057 | 387 |
| 89 | 3300047472 | Ga0495686_0071903 | Ga0495686_0071903_19_1314 | 387 |
| 90 | 3300048922 | Ga0496119_0000852 | Ga0496119_0000852_32310_33662 | 387 |
| 91 | 3300005337 | Ga0070682_100123451 | Ga0070682_1001234512 | 389 |
| 92 | 3300005563 | Ga0068855_100049349 | Ga0068855_1000493493 | 389 |
| 93 | 3300013104 | Ga0157370_10028300 | Ga0157370_100283002 | 389 |
| 94 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006213 | 389 |
| 95 | 3300025932 | Ga0207690_10046340 | Ga0207690_100463402 | 389 |
| 96 | 3300026067 | Ga0207678_10027738 | Ga0207678_100277384 | 389 |
| 97 | 3300050513 | nmdc:mga0rr50_263765_c1 | nmdc:mga0rr50_263765_c1_59_1264 | 390 |
| 98 | 3300006852 | Ga0075433_10061030 | Ga0075433_100610302 | 391 |
| 99 | 3300050507 | nmdc:mga05p37_51035_c1 | nmdc:mga05p37_51035_c1_3355_4644 | 391 |
| 100 | 3300050515 | nmdc:mga0a205_100831_c1 | nmdc:mga0a205_100831_c1_939_2228 | 391 |
| 101 | 3300047472 | Ga0495686_0005147 | Ga0495686_0005147_5122_6417 | 392 |
| 102 | 3300048929 | Ga0496126_0142466 | Ga0496126_0142466_54_1295 | 393 |
| 103 | 3300049575 | Ga0501039_0013558 | Ga0501039_0013558_4957_6156 | 393 |
| 104 | 3300049571 | Ga0501034_0046193 | Ga0501034_0046193_910_2142 | 396 |
| 105 | 3300048912 | Ga0496109_0023037 | Ga0496109_0023037_141_1490 | 397 |
| 106 | 3300009147 | Ga0114129_10480721 | Ga0114129_104807212 | 399 |
| 107 | 3300041512 | Ga0451853_1438192 | Ga0451853_1438192_282_1550 | 400 |
| 108 | 3300048924 | Ga0496121_0000277 | Ga0496121_0000277_21789_23051 | 400 |
| 109 | 3300013105 | Ga0157369_10027730 | Ga0157369_100277302 | 402 |
| 110 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_204407_205687 | 403 |
| 111 | 3300048920 | Ga0496117_0039654 | Ga0496117_0039654_252_1577 | 404 |
| 112 | 3300048922 | Ga0496119_0003502 | Ga0496119_0003502_12715_14040 | 404 |
| 113 | 3300048923 | Ga0496120_0005909 | Ga0496120_0005909_1369_2694 | 404 |
| 114 | 3300048925 | Ga0496122_0000059 | Ga0496122_0000059_215389_216714 | 404 |
| 115 | 3300048926 | Ga0496123_0000013 | Ga0496123_0000013_360066_361391 | 404 |
| 116 | 3300048927 | Ga0496124_0025971 | Ga0496124_0025971_2199_3524 | 404 |
| 117 | 3300048928 | Ga0496125_0001957 | Ga0496125_0001957_18487_19812 | 404 |
| 118 | iso_pu_bacteria | 2747842429 | 2747955470 | 404 |
| 119 | 3300003578 | Ga0006562J51391_1025429 | Ga0006562J51391_10254294 | 405 |
| 120 | 3300044765 | Ga0466970_0000020 | Ga0466970_0000020_45434_46753 | 405 |
| 121 | 3300044842 | Ga0466957_0148434 | Ga0466957_0148434_155_1492 | 405 |
| 122 | 3300025921 | Ga0207652_10006097 | Ga0207652_100060972 | 408 |
| 123 | 3300009093 | Ga0105240_10000001 | Ga0105240_1000000177 | 409 |
| 124 | 3300025261 | Ga0209233_1006487 | Ga0209233_10064872 | 409 |
| 125 | 3300025913 | Ga0207695_10000001 | Ga0207695_1000000179 | 409 |
| 126 | 3300025261 | Ga0209233_1007871 | Ga0209233_10078713 | 410 |
| 127 | 3300049586 | Ga0501070_0003566 | Ga0501070_0003566_4218_5570 | 412 |
| 128 | 3300003911 | JGI25405J52794_10016594 | JGI25405J52794_100165941 | 413 |
| 129 | 3300005937 | Ga0081455_10000782 | Ga0081455_1000078239 | 413 |
| 130 | 3300050492 | nmdc:mga0yw44_8613_c1 | nmdc:mga0yw44_8613_c1_3092_4336 | 413 |
| 131 | iso_pu_bacteria | 2643221961 | 2645720274 | 414 |
| 132 | iso_pu_bacteria | 2643221962 | 2645723211 | 414 |
| 133 | iso_pu_bacteria | 2852643534 | 2852645678 | 414 |
| 134 | iso_pu_bacteria | 2857733635 | 2857735874 | 414 |
| 135 | 3300041453 | Ga0451797_0450600 | Ga0451797_0450600_620_1882 | 415 |
| 136 | 3300042006 | Ga0439432_022467 | Ga0439432_022467_71_1339 | 415 |
| 137 | iso_pu_bacteria | 2554235227 | 2555231032 | 415 |
| 138 | iso_pu_bacteria | 2654587600 | 2655032257 | 415 |
| 139 | 3300005438 | Ga0070701_10031813 | Ga0070701_100318132 | 416 |
| 140 | 3300005444 | Ga0070694_100071616 | Ga0070694_1000716162 | 416 |
| 141 | 3300005445 | Ga0070708_100130154 | Ga0070708_1001301542 | 416 |
| 142 | 3300005468 | Ga0070707_100047526 | Ga0070707_1000475263 | 416 |
| 143 | 3300005617 | Ga0068859_100002872 | Ga0068859_10000287213 | 416 |
| 144 | 3300006852 | Ga0075433_10059542 | Ga0075433_100595423 | 416 |
| 145 | 3300006931 | Ga0097620_100002873 | Ga0097620_10000287313 | 416 |
| 146 | 3300009147 | Ga0114129_10111055 | Ga0114129_101110553 | 416 |
| 147 | 3300025922 | Ga0207646_10056703 | Ga0207646_100567032 | 416 |
| 148 | 3300026075 | Ga0207708_10044731 | Ga0207708_100447313 | 416 |
| 149 | 3300027671 | Ga0209588_1004585 | Ga0209588_10045852 | 416 |
| 150 | 3300028380 | Ga0268265_10018400 | Ga0268265_100184002 | 416 |
| 151 | 3300041491 | Ga0451833_0507753 | Ga0451833_0507753_666_1952 | 416 |
| 152 | 3300041496 | Ga0451839_1651811 | Ga0451839_1651811_717_2003 | 416 |
| 153 | 3300049577 | Ga0501041_0067160 | Ga0501041_0067160_344_1669 | 416 |
| 154 | 3300049587 | Ga0501071_0062179 | Ga0501071_0062179_214_1539 | 416 |
| 155 | 3300049588 | Ga0501072_0007030 | Ga0501072_0007030_4420_5745 | 416 |
| 156 | 3300049591 | Ga0501075_0233033 | Ga0501075_0233033_39_1364 | 416 |
| 157 | 3300049741 | Ga0501079_0089855 | Ga0501079_0089855_156_1481 | 416 |
| 158 | 3300049824 | Ga0501045_0090758 | Ga0501045_0090758_471_1796 | 416 |
| 159 | 3300050507 | nmdc:mga05p37_376854_c1 | nmdc:mga05p37_376854_c1_74_1363 | 416 |
| 160 | 3300050507 | nmdc:mga05p37_89938_c1 | nmdc:mga05p37_89938_c1_1056_2342 | 416 |
| 161 | 3300050510 | nmdc:mga06r32_90298_c1 | nmdc:mga06r32_90298_c1_599_1888 | 416 |
| 162 | 3300050515 | nmdc:mga0a205_165248_c1 | nmdc:mga0a205_165248_c1_94_1383 | 416 |
| 163 | iso_pu_bacteria | 2643221635 | 2644199109 | 416 |
| 164 | iso_pu_bacteria | 2687453129 | 2687581178 | 416 |
| 165 | iso_pu_bacteria | 2751185788 | 2753302831 | 416 |
| 166 | iso_pu_bacteria | 2904430863 | 2904431595 | 416 |
| 167 | iso_pu_bacteria | 2904501621 | 2904504113 | 416 |
| 168 | iso_pu_bacteria | 2908674828 | 2908677077 | 416 |
| 169 | iso_pu_bacteria | 2909074476 | 2909076745 | 416 |
| 170 | iso_pu_bacteria | 2919039151 | 2919039357 | 416 |
| 171 | iso_pu_bacteria | 2919042368 | 2919042739 | 416 |
| 172 | iso_pu_bacteria | 2928104781 | 2928105050 | 416 |
| 173 | iso_pu_bacteria | 2928500415 | 2928502220 | 416 |
| 174 | iso_pu_bacteria | 2966921586 | 2966921746 | 416 |
| 175 | iso_pu_bacteria | 2984551494 | 2984554980 | 416 |
| 176 | 3300005337 | Ga0070682_100183884 | Ga0070682_1001838841 | 417 |
| 177 | 3300006880 | Ga0075429_100021046 | Ga0075429_1000210463 | 417 |
| 178 | 3300037418 | Ga0395900_0031457 | Ga0395900_0031457_3794_5158 | 417 |
| 179 | 3300041451 | Ga0451791_0094464 | Ga0451791_0094464_2205_3488 | 417 |
| 180 | 3300041453 | Ga0451797_0002931 | Ga0451797_0002931_1505_2788 | 417 |
| 181 | 3300041509 | Ga0451843_0677430 | Ga0451843_0677430_313_1596 | 417 |
| 182 | 3300044901 | Ga0466960_0015895 | Ga0466960_0015895_1100_2398 | 417 |
| 183 | 3300046518 | Ga0495631_0023658 | Ga0495631_0023658_15_1268 | 417 |
| 184 | 3300048917 | Ga0496114_0223202 | Ga0496114_0223202_133_1404 | 417 |
| 185 | 3300048922 | Ga0496119_0018367 | Ga0496119_0018367_344_1606 | 417 |
| 186 | 3300048923 | Ga0496120_0033460 | Ga0496120_0033460_260_1522 | 417 |
| 187 | 3300048924 | Ga0496121_0099439 | Ga0496121_0099439_780_2042 | 417 |
| 188 | 3300048926 | Ga0496123_0093458 | Ga0496123_0093458_354_1622 | 417 |
| 189 | 3300049568 | Ga0501031_0005313 | Ga0501031_0005313_6493_7794 | 417 |
| 190 | 3300049570 | Ga0501033_0010823 | Ga0501033_0010823_5099_6400 | 417 |
| 191 | 3300049571 | Ga0501034_0148873 | Ga0501034_0148873_163_1416 | 417 |
| 192 | 3300049574 | Ga0501038_0027665 | Ga0501038_0027665_164_1465 | 417 |
| 193 | 3300049575 | Ga0501039_0027628 | Ga0501039_0027628_1626_2927 | 417 |
| 194 | 3300049578 | Ga0501042_0139500 | Ga0501042_0139500_292_1593 | 417 |
| 195 | 3300049580 | Ga0501046_0027416 | Ga0501046_0027416_1617_2918 | 417 |
| 196 | 3300049582 | Ga0501048_0004529 | Ga0501048_0004529_215_1516 | 417 |
| 197 | 3300049585 | Ga0501069_0018952 | Ga0501069_0018952_2195_3496 | 417 |
| 198 | 3300049586 | Ga0501070_0019920 | Ga0501070_0019920_1704_3005 | 417 |
| 199 | 3300049589 | Ga0501073_0001325 | Ga0501073_0001325_9775_11037 | 417 |
| 200 | 3300049590 | Ga0501074_0046335 | Ga0501074_0046335_914_2215 | 417 |
| 201 | 3300049742 | Ga0501080_0003872 | Ga0501080_0003872_11367_12629 | 417 |
| 202 | 3300049742 | Ga0501080_0037244 | Ga0501080_0037244_3064_4365 | 417 |
| 203 | 3300049822 | Ga0501035_0044944 | Ga0501035_0044944_2460_3761 | 417 |
| 204 | 3300049824 | Ga0501045_0025905 | Ga0501045_0025905_469_1770 | 417 |
| 205 | 3300050508 | nmdc:mga09592_61699_c1 | nmdc:mga09592_61699_c1_1669_2940 | 417 |
| 206 | 3300053139 | Ga0500568_0000026 | Ga0500568_0000026_55146_56408 | 417 |
| 207 | 3300054114 | Ga0501084_0043225 | Ga0501084_0043225_989_2290 | 417 |
| 208 | iso_pu_bacteria | 2643221681 | 2644458141 | 417 |
| 209 | iso_pu_bacteria | 2984592036 | 2984595220 | 417 |
| 210 | 3300048926 | Ga0496123_0002417 | Ga0496123_0002417_18754_20016 | 418 |
| 211 | iso_pu_bacteria | 2906799679 | 2906803203 | 418 |
| 212 | iso_pu_bacteria | 2995726249 | 2995727273 | 418 |
| 213 | 3300049570 | Ga0501033_0026484 | Ga0501033_0026484_1934_3244 | 419 |
| 214 | 3300049580 | Ga0501046_0037619 | Ga0501046_0037619_825_2135 | 419 |
| 215 | 3300049581 | Ga0501047_0048158 | Ga0501047_0048158_1106_2416 | 419 |
| 216 | iso_pu_bacteria | 2887443736 | 2887447119 | 419 |
| 217 | iso_pu_bacteria | 2905926851 | 2905927425 | 419 |
| 218 | iso_pu_bacteria | 8046352972 | 8046353363 | 419 |
| 219 | 3300044765 | Ga0466970_0005133 | Ga0466970_0005133_1073_2344 | 420 |
| 220 | 3300048920 | Ga0496117_0002376 | Ga0496117_0002376_17854_19125 | 420 |
| 221 | 3300048920 | Ga0496117_0042167 | Ga0496117_0042167_1251_2564 | 420 |
| 222 | 3300048921 | Ga0496118_0000243 | Ga0496118_0000243_32274_33545 | 420 |
| 223 | 3300048922 | Ga0496119_0013519 | Ga0496119_0013519_4548_5861 | 420 |
| 224 | 3300048922 | Ga0496119_0106614 | Ga0496119_0106614_160_1431 | 420 |
| 225 | 3300048925 | Ga0496122_0000036 | Ga0496122_0000036_112551_113864 | 420 |
| 226 | 3300048926 | Ga0496123_0000011 | Ga0496123_0000011_112627_113940 | 420 |
| 227 | 3300048926 | Ga0496123_0020410 | Ga0496123_0020410_539_1810 | 420 |
| 228 | 3300048926 | Ga0496123_0050962 | Ga0496123_0050962_654_1922 | 420 |
| 229 | 3300048927 | Ga0496124_0000040 | Ga0496124_0000040_105540_106811 | 420 |
| 230 | 3300048927 | Ga0496124_0017785 | Ga0496124_0017785_1559_2872 | 420 |
| 231 | 3300048927 | Ga0496124_0019767 | Ga0496124_0019767_4877_6148 | 420 |
| 232 | 3300048928 | Ga0496125_0075659 | Ga0496125_0075659_1028_2341 | 420 |
| 233 | 3300049570 | Ga0501033_0018869 | Ga0501033_0018869_2056_3348 | 420 |
| 234 | 3300049571 | Ga0501034_0036854 | Ga0501034_0036854_2259_3551 | 420 |
| 235 | 3300049573 | Ga0501037_0021945 | Ga0501037_0021945_746_2038 | 420 |
| 236 | 3300049580 | Ga0501046_0049306 | Ga0501046_0049306_907_2199 | 420 |
| 237 | 3300049823 | Ga0501044_0040716 | Ga0501044_0040716_2418_3710 | 420 |
| 238 | iso_pu_bacteria | 2808606700 | 2810364068 | 420 |
| 239 | iso_pu_bacteria | 2844841374 | 2844842886 | 420 |
| 240 | iso_pu_bacteria | 2919055335 | 2919058859 | 420 |
| 241 | iso_pu_bacteria | 2919523602 | 2919524970 | 420 |
| 242 | iso_pu_bacteria | 2920879853 | 2920880453 | 420 |
| 243 | iso_pu_bacteria | 2928153084 | 2928156833 | 420 |
| 244 | iso_pu_bacteria | 2946003308 | 2946005187 | 420 |
| 245 | 3300000549 | LJQas_1001543 | LJQas_10015433 | 421 |
| 246 | 3300005366 | Ga0070659_100036145 | Ga0070659_1000361452 | 421 |
| 247 | 3300006038 | Ga0075365_10006565 | Ga0075365_100065653 | 421 |
| 248 | 3300006051 | Ga0075364_10008865 | Ga0075364_100088655 | 421 |
| 249 | 3300006051 | Ga0075364_10105985 | Ga0075364_101059851 | 421 |
| 250 | 3300006178 | Ga0075367_10025044 | Ga0075367_100250442 | 421 |
| 251 | 3300006186 | Ga0075369_10005259 | Ga0075369_100052592 | 421 |
| 252 | 3300006353 | Ga0075370_10042559 | Ga0075370_100425592 | 421 |
| 253 | 3300009147 | Ga0114129_10038998 | Ga0114129_100389983 | 421 |
| 254 | 3300009148 | Ga0105243_10065273 | Ga0105243_100652731 | 421 |
| 255 | 3300013104 | Ga0157370_10096537 | Ga0157370_100965373 | 421 |
| 256 | 3300013250 | Ga0171462_1004 | Ga0171462_100428 | 421 |
| 257 | 3300014326 | Ga0157380_10025332 | Ga0157380_100253323 | 421 |
| 258 | 3300025246 | Ga0209646_1000092 | Ga0209646_100009276 | 421 |
| 259 | 3300025904 | Ga0207647_10054086 | Ga0207647_100540862 | 421 |
| 260 | 3300025935 | Ga0207709_10027799 | Ga0207709_100277992 | 421 |
| 261 | 3300031649 | Ga0307514_10013636 | Ga0307514_100136362 | 421 |
| 262 | 3300031901 | Ga0307406_10000134 | Ga0307406_1000013434 | 421 |
| 263 | 3300031901 | Ga0307406_10001972 | Ga0307406_100019724 | 421 |
| 264 | 3300031901 | Ga0307406_10064180 | Ga0307406_100641802 | 421 |
| 265 | 3300037312 | Ga0395899_0070412 | Ga0395899_0070412_140_1441 | 421 |
| 266 | 3300037466 | Ga0395898_0012998 | Ga0395898_0012998_5561_6862 | 421 |
| 267 | 3300038443 | Ga0395901_0004201 | Ga0395901_0004201_5397_6698 | 421 |
| 268 | 3300044765 | Ga0466970_0102280 | Ga0466970_0102280_74_1402 | 421 |
| 269 | 3300046453 | Ga0495627_002690 | Ga0495627_002690_3645_4982 | 421 |
| 270 | 3300046460 | Ga0495638_0067098 | Ga0495638_0067098_116_1519 | 421 |
| 271 | 3300046530 | Ga0495654_0008971 | Ga0495654_0008971_383_1729 | 421 |
| 272 | 3300048904 | Ga0496101_0031975 | Ga0496101_0031975_1629_2942 | 421 |
| 273 | 3300048908 | Ga0496105_0220007 | Ga0496105_0220007_177_1520 | 421 |
| 274 | 3300048915 | Ga0496112_0306807 | Ga0496112_0306807_159_1472 | 421 |
| 275 | 3300048916 | Ga0496113_0058490 | Ga0496113_0058490_687_2000 | 421 |
| 276 | 3300048918 | Ga0496115_0027610 | Ga0496115_0027610_2011_3324 | 421 |
| 277 | 3300048920 | Ga0496117_0000063 | Ga0496117_0000063_220250_221581 | 421 |
| 278 | 3300048920 | Ga0496117_0001554 | Ga0496117_0001554_20571_21932 | 421 |
| 279 | 3300048920 | Ga0496117_0012311 | Ga0496117_0012311_457_1785 | 421 |
| 280 | 3300048922 | Ga0496119_0008669 | Ga0496119_0008669_339_1670 | 421 |
| 281 | 3300048922 | Ga0496119_0022903 | Ga0496119_0022903_295_1626 | 421 |
| 282 | 3300048922 | Ga0496119_0030887 | Ga0496119_0030887_108_1403 | 421 |
| 283 | 3300048922 | Ga0496119_0054435 | Ga0496119_0054435_486_1841 | 421 |
| 284 | 3300048923 | Ga0496120_0000717 | Ga0496120_0000717_7021_8352 | 421 |
| 285 | 3300048923 | Ga0496120_0002055 | Ga0496120_0002055_15276_16607 | 421 |
| 286 | 3300048923 | Ga0496120_0026910 | Ga0496120_0026910_1634_2929 | 421 |
| 287 | 3300048925 | Ga0496122_0013880 | Ga0496122_0013880_2805_4139 | 421 |
| 288 | 3300048925 | Ga0496122_0020089 | Ga0496122_0020089_780_2108 | 421 |
| 289 | 3300048925 | Ga0496122_0052080 | Ga0496122_0052080_297_1628 | 421 |
| 290 | 3300048926 | Ga0496123_0005485 | Ga0496123_0005485_1180_2511 | 421 |
| 291 | 3300048927 | Ga0496124_0001451 | Ga0496124_0001451_26144_27475 | 421 |
| 292 | 3300048927 | Ga0496124_0108885 | Ga0496124_0108885_672_1985 | 421 |
| 293 | 3300048928 | Ga0496125_0000167 | Ga0496125_0000167_143583_144911 | 421 |
| 294 | 3300048928 | Ga0496125_0004725 | Ga0496125_0004725_9938_11269 | 421 |
| 295 | 3300048928 | Ga0496125_0011598 | Ga0496125_0011598_1069_2403 | 421 |
| 296 | 3300048928 | Ga0496125_0019504 | Ga0496125_0019504_83_1444 | 421 |
| 297 | 3300048928 | Ga0496125_0048612 | Ga0496125_0048612_1288_2625 | 421 |
| 298 | 3300048929 | Ga0496126_0063488 | Ga0496126_0063488_906_2267 | 421 |
| 299 | 3300048929 | Ga0496126_0175314 | Ga0496126_0175314_77_1399 | 421 |
| 300 | 3300049571 | Ga0501034_0001053 | Ga0501034_0001053_2293_3621 | 421 |
| 301 | 3300049574 | Ga0501038_0016174 | Ga0501038_0016174_2309_3607 | 421 |
| 302 | 3300049574 | Ga0501038_0034316 | Ga0501038_0034316_243_1541 | 421 |
| 303 | 3300049575 | Ga0501039_0170799 | Ga0501039_0170799_313_1665 | 421 |
| 304 | 3300050492 | nmdc:mga0yw44_43230_c1 | nmdc:mga0yw44_43230_c1_14_1327 | 421 |
| 305 | 3300050496 | nmdc:mga07m45_74529_c1 | nmdc:mga07m45_74529_c1_415_1692 | 421 |
| 306 | 3300050512 | nmdc:mga0n895_285439_c1 | nmdc:mga0n895_285439_c1_110_1414 | 421 |
| 307 | 3300050515 | nmdc:mga0a205_79985_c1 | nmdc:mga0a205_79985_c1_706_2010 | 421 |
| 308 | 3300053136 | Ga0500559_0006651 | Ga0500559_0006651_214_1482 | 421 |
| 309 | 3300053140 | Ga0500573_0005544 | Ga0500573_0005544_3382_4656 | 421 |
| 310 | 3300053140 | Ga0500573_0009461 | Ga0500573_0009461_3746_5221 | 421 |
| 311 | iso_pu_bacteria | 2585428157 | 2588108767 | 421 |
| 312 | iso_pu_bacteria | 2643221542 | 2643732079 | 421 |
| 313 | iso_pu_bacteria | 2643221546 | 2643752862 | 421 |
| 314 | iso_pu_bacteria | 2643221549 | 2643769707 | 421 |
| 315 | iso_pu_bacteria | 2643221553 | 2643785160 | 421 |
| 316 | iso_pu_bacteria | 2643221566 | 2643849282 | 421 |
| 317 | iso_pu_bacteria | 2643221575 | 2643885935 | 421 |
| 318 | iso_pu_bacteria | 2643221597 | 2643995485 | 421 |
| 319 | iso_pu_bacteria | 2643221616 | 2644096938 | 421 |
| 320 | iso_pu_bacteria | 2643221619 | 2644114361 | 421 |
| 321 | iso_pu_bacteria | 2643221630 | 2644170894 | 421 |
| 322 | iso_pu_bacteria | 2643221724 | 2644679487 | 421 |
| 323 | iso_pu_bacteria | 2721755702 | 2723641530 | 421 |
| 324 | iso_pu_bacteria | 2728369276 | 2729905630 | 421 |
| 325 | iso_pu_bacteria | 2728369380 | 2730228995 | 421 |
| 326 | iso_pu_bacteria | 2757320536 | 2758226522 | 421 |
| 327 | iso_pu_bacteria | 2773857758 | 2774379993 | 421 |
| 328 | iso_pu_bacteria | 2773857759 | 2774384106 | 421 |
| 329 | iso_pu_bacteria | 2773857763 | 2774399017 | 421 |
| 330 | iso_pu_bacteria | 2808606306 | 2808630796 | 421 |
| 331 | iso_pu_bacteria | 2808606368 | 2808885996 | 421 |
| 332 | iso_pu_bacteria | 2808606372 | 2808901480 | 421 |
| 333 | iso_pu_bacteria | 2808606447 | 2809227779 | 421 |
| 334 | iso_pu_bacteria | 2811994872 | 2812323702 | 421 |
| 335 | iso_pu_bacteria | 2821268502 | 2821270413 | 421 |
| 336 | iso_pu_bacteria | 2833709550 | 2833711381 | 421 |
| 337 | iso_pu_bacteria | 2852632344 | 2852634535 | 421 |
| 338 | iso_pu_bacteria | 2852646457 | 2852646739 | 421 |
| 339 | iso_pu_bacteria | 2852663356 | 2852664568 | 421 |
| 340 | iso_pu_bacteria | 2857720070 | 2857721984 | 421 |
| 341 | iso_pu_bacteria | 2857723135 | 2857723190 | 421 |
| 342 | iso_pu_bacteria | 2857729791 | 2857730343 | 421 |
| 343 | iso_pu_bacteria | 2870628048 | 2870630750 | 421 |
| 344 | iso_pu_bacteria | 2884763398 | 2884765864 | 421 |
| 345 | iso_pu_bacteria | 2897561785 | 2897562133 | 421 |
| 346 | iso_pu_bacteria | 2904509784 | 2904511601 | 421 |
| 347 | iso_pu_bacteria | 2908678064 | 2908680533 | 421 |
| 348 | iso_pu_bacteria | 2919069694 | 2919071911 | 421 |
| 349 | iso_pu_bacteria | 2919395869 | 2919396020 | 421 |
| 350 | iso_pu_bacteria | 2919443155 | 2919446822 | 421 |
| 351 | iso_pu_bacteria | 2928090899 | 2928091756 | 421 |
| 352 | iso_pu_bacteria | 2928121344 | 2928123558 | 421 |
| 353 | iso_pu_bacteria | 2935409751 | 2935410948 | 421 |
| 354 | iso_pu_bacteria | 2939660829 | 2939662239 | 421 |
| 355 | iso_pu_bacteria | 2945968032 | 2945971170 | 421 |
| 356 | iso_pu_bacteria | 2946033335 | 2946034406 | 421 |
| 357 | iso_pu_bacteria | 2946080515 | 2946081567 | 421 |
| 358 | iso_pu_bacteria | 2974294766 | 2974297573 | 421 |
| 359 | iso_pu_bacteria | 2974324384 | 2974326191 | 421 |
| 360 | iso_pu_bacteria | 2977228692 | 2977231809 | 421 |
| 361 | iso_pu_bacteria | 2977236895 | 2977237167 | 421 |
| 362 | iso_pu_bacteria | 2977251589 | 2977254383 | 421 |
| 363 | iso_pu_bacteria | 2977264416 | 2977267118 | 421 |
| 364 | iso_pu_bacteria | 2984542743 | 2984545044 | 421 |
| 365 | iso_pu_bacteria | 2984580707 | 2984581485 | 421 |
| 366 | iso_pu_bacteria | 8004182704 | 8004183825 | 421 |
| 367 | iso_pu_bacteria | 8016254467 | 8016257161 | 421 |
| 368 | iso_pu_bacteria | 8045830549 | 8045831420 | 421 |
| 369 | 3300002067 | JGI24735J21928_10004077 | JGI24735J21928_100040771 | 422 |
| 370 | 3300002772 | JGI25164J39214_1000715 | JGI25164J39214_10007155 | 422 |
| 371 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004279 | 422 |
| 372 | 3300003578 | Ga0006562J51391_1021236 | Ga0006562J51391_10212365 | 422 |
| 373 | 3300003578 | Ga0006562J51391_1021238 | Ga0006562J51391_10212382 | 422 |
| 374 | 3300003752 | Ga0055539_1000005 | Ga0055539_1000005150 | 422 |
| 375 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011219 | 422 |
| 376 | 3300003759 | Ga0055525_1000448 | Ga0055525_10004489 | 422 |
| 377 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001705 | 422 |
| 378 | 3300003763 | Ga0055529_1000019 | Ga0055529_1000019211 | 422 |
| 379 | 3300005327 | Ga0070658_10069686 | Ga0070658_100696862 | 422 |
| 380 | 3300005445 | Ga0070708_100161004 | Ga0070708_1001610042 | 422 |
| 381 | 3300013105 | Ga0157369_10045421 | Ga0157369_100454213 | 422 |
| 382 | 3300020082 | Ga0206353_11327476 | Ga0206353_113274763 | 422 |
| 383 | 3300025225 | Ga0209566_100105 | Ga0209566_100105110 | 422 |
| 384 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011219 | 422 |
| 385 | 3300025228 | Ga0209672_100006 | Ga0209672_100006270 | 422 |
| 386 | 3300025229 | Ga0209147_104138 | Ga0209147_1041381 | 422 |
| 387 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011219 | 422 |
| 388 | 3300025230 | Ga0209563_100404 | Ga0209563_1004045 | 422 |
| 389 | 3300025231 | Ga0207427_100010 | Ga0207427_100010302 | 422 |
| 390 | 3300025233 | Ga0209437_100550 | Ga0209437_10055018 | 422 |
| 391 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011219 | 422 |
| 392 | 3300025253 | Ga0209677_101020 | Ga0209677_10102011 | 422 |
| 393 | 3300025254 | Ga0209148_1000015 | Ga0209148_1000015114 | 422 |
| 394 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011647 | 422 |
| 395 | 3300025272 | Ga0209455_1000013 | Ga0209455_1000013114 | 422 |
| 396 | 3300025272 | Ga0209455_1000938 | Ga0209455_100093810 | 422 |
| 397 | 3300037312 | Ga0395899_0029311 | Ga0395899_0029311_20_1315 | 422 |
| 398 | 3300037312 | Ga0395899_0050049 | Ga0395899_0050049_874_2169 | 422 |
| 399 | 3300037418 | Ga0395900_0006021 | Ga0395900_0006021_6648_7943 | 422 |
| 400 | 3300037466 | Ga0395898_0000015 | Ga0395898_0000015_271033_272328 | 422 |
| 401 | 3300044658 | Ga0466972_0011621 | Ga0466972_0011621_1113_2408 | 422 |
| 402 | 3300044683 | Ga0466965_0010906 | Ga0466965_0010906_1005_2303 | 422 |
| 403 | 3300044683 | Ga0466965_0031277 | Ga0466965_0031277_309_1631 | 422 |
| 404 | 3300044684 | Ga0466966_0042464 | Ga0466966_0042464_947_2269 | 422 |
| 405 | 3300044765 | Ga0466970_0006045 | Ga0466970_0006045_3355_4650 | 422 |
| 406 | 3300044765 | Ga0466970_0012171 | Ga0466970_0012171_2306_3601 | 422 |
| 407 | 3300044842 | Ga0466957_0052740 | Ga0466957_0052740_632_1954 | 422 |
| 408 | 3300044901 | Ga0466960_0025422 | Ga0466960_0025422_1019_2341 | 422 |
| 409 | 3300045049 | Ga0466959_0014049 | Ga0466959_0014049_3479_4774 | 422 |
| 410 | 3300045049 | Ga0466959_0039428 | Ga0466959_0039428_1306_2628 | 422 |
| 411 | 3300047472 | Ga0495686_0000031 | Ga0495686_0000031_266281_267594 | 422 |
| 412 | 3300048904 | Ga0496101_0014615 | Ga0496101_0014615_3344_4639 | 422 |
| 413 | 3300048905 | Ga0496102_0170375 | Ga0496102_0170375_504_1799 | 422 |
| 414 | 3300048905 | Ga0496102_0197234 | Ga0496102_0197234_319_1617 | 422 |
| 415 | 3300048906 | Ga0496103_0132667 | Ga0496103_0132667_249_1547 | 422 |
| 416 | 3300048907 | Ga0496104_0000068 | Ga0496104_0000068_15821_17134 | 422 |
| 417 | 3300048907 | Ga0496104_0182421 | Ga0496104_0182421_179_1474 | 422 |
| 418 | 3300048907 | Ga0496104_0299781 | Ga0496104_0299781_103_1401 | 422 |
| 419 | 3300048908 | Ga0496105_0012241 | Ga0496105_0012241_498_1793 | 422 |
| 420 | 3300048908 | Ga0496105_0016403 | Ga0496105_0016403_431_1729 | 422 |
| 421 | 3300048908 | Ga0496105_0058587 | Ga0496105_0058587_1533_2831 | 422 |
| 422 | 3300048913 | Ga0496110_0148066 | Ga0496110_0148066_745_2052 | 422 |
| 423 | 3300048917 | Ga0496114_0024056 | Ga0496114_0024056_349_1647 | 422 |
| 424 | 3300048917 | Ga0496114_0083770 | Ga0496114_0083770_148_1443 | 422 |
| 425 | 3300048918 | Ga0496115_0056830 | Ga0496115_0056830_1522_2817 | 422 |
| 426 | 3300048920 | Ga0496117_0000174 | Ga0496117_0000174_13450_14727 | 422 |
| 427 | 3300048920 | Ga0496117_0001880 | Ga0496117_0001880_7168_8463 | 422 |
| 428 | 3300048921 | Ga0496118_0015499 | Ga0496118_0015499_4814_6112 | 422 |
| 429 | 3300048921 | Ga0496118_0046062 | Ga0496118_0046062_1331_2638 | 422 |
| 430 | 3300048924 | Ga0496121_0130278 | Ga0496121_0130278_176_1471 | 422 |
| 431 | 3300048929 | Ga0496126_0002482 | Ga0496126_0002482_12891_14189 | 422 |
| 432 | 3300048929 | Ga0496126_0072481 | Ga0496126_0072481_1634_2932 | 422 |
| 433 | 3300049568 | Ga0501031_0019934 | Ga0501031_0019934_235_1533 | 422 |
| 434 | 3300049569 | Ga0501032_0003977 | Ga0501032_0003977_5826_7124 | 422 |
| 435 | 3300049570 | Ga0501033_0008438 | Ga0501033_0008438_6029_7327 | 422 |
| 436 | 3300049570 | Ga0501033_0025648 | Ga0501033_0025648_2173_3486 | 422 |
| 437 | 3300049570 | Ga0501033_0051393 | Ga0501033_0051393_1501_2826 | 422 |
| 438 | 3300049571 | Ga0501034_0002709 | Ga0501034_0002709_12626_13924 | 422 |
| 439 | 3300049571 | Ga0501034_0007406 | Ga0501034_0007406_6745_8070 | 422 |
| 440 | 3300049572 | Ga0501036_0001002 | Ga0501036_0001002_14951_16249 | 422 |
| 441 | 3300049573 | Ga0501037_0001216 | Ga0501037_0001216_9312_10610 | 422 |
| 442 | 3300049574 | Ga0501038_0000560 | Ga0501038_0000560_14979_16277 | 422 |
| 443 | 3300049578 | Ga0501042_0013492 | Ga0501042_0013492_2299_3612 | 422 |
| 444 | 3300049579 | Ga0501043_0006752 | Ga0501043_0006752_652_1950 | 422 |
| 445 | 3300049579 | Ga0501043_0102047 | Ga0501043_0102047_389_1714 | 422 |
| 446 | 3300049580 | Ga0501046_0000916 | Ga0501046_0000916_24651_25949 | 422 |
| 447 | 3300049581 | Ga0501047_0001949 | Ga0501047_0001949_2054_3352 | 422 |
| 448 | 3300049581 | Ga0501047_0034531 | Ga0501047_0034531_1158_2483 | 422 |
| 449 | 3300049582 | Ga0501048_0010720 | Ga0501048_0010720_528_1826 | 422 |
| 450 | 3300049586 | Ga0501070_0003336 | Ga0501070_0003336_3623_4918 | 422 |
| 451 | 3300049586 | Ga0501070_0010543 | Ga0501070_0010543_6207_7505 | 422 |
| 452 | 3300049744 | Ga0501083_0000011 | Ga0501083_0000011_141120_142433 | 422 |
| 453 | 3300049744 | Ga0501083_0084207 | Ga0501083_0084207_439_1752 | 422 |
| 454 | 3300049822 | Ga0501035_0009995 | Ga0501035_0009995_1028_2326 | 422 |
| 455 | 3300049823 | Ga0501044_0002815 | Ga0501044_0002815_6030_7328 | 422 |
| 456 | 3300049823 | Ga0501044_0004183 | Ga0501044_0004183_8973_10298 | 422 |
| 457 | 3300049824 | Ga0501045_0007075 | Ga0501045_0007075_2504_3802 | 422 |
| 458 | 3300053080 | Ga0500635_0000039 | Ga0500635_0000039_10329_11627 | 422 |
| 459 | 3300053140 | Ga0500573_0026648 | Ga0500573_0026648_94_1368 | 422 |
| 460 | 3300053730 | Ga0500645_009652 | Ga0500645_009652_1605_2882 | 422 |
| 461 | iso_pu_bacteria | 2585428094 | 2587864406 | 422 |
| 462 | iso_pu_bacteria | 2643221572 | 2643875837 | 422 |
| 463 | iso_pu_bacteria | 2643221632 | 2644182842 | 422 |
| 464 | iso_pu_bacteria | 2643221649 | 2644280384 | 422 |
| 465 | iso_pu_bacteria | 2643221669 | 2644382892 | 422 |
| 466 | iso_pu_bacteria | 2848551377 | 2848554586 | 422 |
| 467 | iso_pu_bacteria | 2895660088 | 2895663650 | 422 |
| 468 | iso_pu_bacteria | 8057345674 | 8057346452 | 422 |
| 469 | 3300005467 | Ga0070706_100004869 | Ga0070706_10000486913 | 423 |
| 470 | 3300025910 | Ga0207684_10002651 | Ga0207684_100026513 | 423 |
| 471 | 3300044673 | Ga0453683_0031786 | Ga0453683_0031786_625_1941 | 423 |
| 472 | 3300048925 | Ga0496122_0002117 | Ga0496122_0002117_4467_5762 | 423 |
| 473 | 3300053153 | Ga0500616_0000010 | Ga0500616_0000010_445823_447118 | 423 |
| 474 | iso_pu_bacteria | 2857479173 | 2857480413 | 423 |
| 475 | iso_pu_bacteria | 2857632687 | 2857634256 | 423 |
| 476 | iso_pu_bacteria | 2870801768 | 2870802078 | 423 |
| 477 | iso_pu_bacteria | 2870804320 | 2870806452 | 423 |
| 478 | 3300031824 | Ga0307413_10224004 | Ga0307413_102240041 | 424 |
| 479 | 3300044683 | Ga0466965_0000007 | Ga0466965_0000007_63039_64328 | 424 |
| 480 | 3300049569 | Ga0501032_0005464 | Ga0501032_0005464_6771_8060 | 424 |
| 481 | 3300049569 | Ga0501032_0031490 | Ga0501032_0031490_1239_2528 | 424 |
| 482 | 3300049571 | Ga0501034_0086008 | Ga0501034_0086008_673_1962 | 424 |
| 483 | 3300049571 | Ga0501034_0203424 | Ga0501034_0203424_547_1836 | 424 |
| 484 | 3300049574 | Ga0501038_0005019 | Ga0501038_0005019_6755_8044 | 424 |
| 485 | 3300053139 | Ga0500568_0000172 | Ga0500568_0000172_53259_54548 | 424 |
| 486 | iso_pu_bacteria | 2537561592 | 2537899640 | 424 |
| 487 | iso_pu_bacteria | 2844852863 | 2844853480 | 424 |
| 488 | iso_pu_bacteria | 8056037122 | 8056038783 | 424 |
| 489 | 3300005614 | Ga0068856_100060428 | Ga0068856_1000604283 | 425 |
| 490 | 3300013105 | Ga0157369_10002372 | Ga0157369_1000237216 | 425 |
| 491 | 3300013307 | Ga0157372_10003426 | Ga0157372_100034262 | 425 |
| 492 | 3300014497 | Ga0182008_10017196 | Ga0182008_100171963 | 425 |
| 493 | 3300026078 | Ga0207702_10197522 | Ga0207702_101975222 | 425 |
| 494 | 3300046516 | Ga0495628_0053749 | Ga0495628_0053749_1718_3079 | 425 |
| 495 | 3300046543 | Ga0495645_0002953 | Ga0495645_0002953_4591_5952 | 425 |
| 496 | 3300046680 | Ga0495646_0009936 | Ga0495646_0009936_3693_5051 | 425 |
| 497 | 3300046809 | Ga0495600_0003993 | Ga0495600_0003993_2845_4185 | 425 |
| 498 | 3300047317 | Ga0495604_0006250 | Ga0495604_0006250_300_1658 | 425 |
| 499 | 3300005327 | Ga0070658_10013058 | Ga0070658_100130582 | 426 |
| 500 | 3300005563 | Ga0068855_100038542 | Ga0068855_1000385422 | 426 |
| 501 | 3300005563 | Ga0068855_100049744 | Ga0068855_1000497442 | 426 |
| 502 | 3300009093 | Ga0105240_10018700 | Ga0105240_100187002 | 426 |
| 503 | 3300009551 | Ga0105238_10054911 | Ga0105238_100549112 | 426 |
| 504 | 3300009551 | Ga0105238_10066652 | Ga0105238_100666522 | 426 |
| 505 | 3300013105 | Ga0157369_10062076 | Ga0157369_100620762 | 426 |
| 506 | 3300013105 | Ga0157369_10132438 | Ga0157369_101324382 | 426 |
| 507 | 3300013307 | Ga0157372_10119418 | Ga0157372_101194182 | 426 |
| 508 | 3300020069 | Ga0197907_11096321 | Ga0197907_110963212 | 426 |
| 509 | 3300025909 | Ga0207705_10047308 | Ga0207705_100473082 | 426 |
| 510 | 3300025913 | Ga0207695_10000858 | Ga0207695_1000085849 | 426 |
| 511 | 3300025929 | Ga0207664_10076048 | Ga0207664_100760482 | 426 |
| 512 | 3300026078 | Ga0207702_10060974 | Ga0207702_100609742 | 426 |
| 513 | 3300042005 | Ga0439448_0014332 | Ga0439448_0014332_206_1507 | 426 |
| 514 | iso_pu_bacteria | 2919051321 | 2919055293 | 427 |
| 515 | 3300031852 | Ga0307410_10052163 | Ga0307410_100521631 | 428 |
| 516 | 3300031852 | Ga0307410_10062070 | Ga0307410_100620702 | 428 |
| 517 | 3300032002 | Ga0307416_100054098 | Ga0307416_1000540982 | 428 |
| 518 | iso_pu_bacteria | 2775506735 | 2775655239 | 429 |
| 519 | iso_pu_bacteria | 2974302888 | 2974306486 | 429 |
| 520 | 3300031548 | Ga0307408_100040291 | Ga0307408_1000402913 | 430 |
| 521 | 3300031852 | Ga0307410_10041954 | Ga0307410_100419542 | 430 |
| 522 | 3300031995 | Ga0307409_100071648 | Ga0307409_1000716482 | 430 |
| 523 | 3300032002 | Ga0307416_100020987 | Ga0307416_1000209874 | 430 |
| 524 | 3300032004 | Ga0307414_10080613 | Ga0307414_100806132 | 430 |
| 525 | 3300032126 | Ga0307415_100060998 | Ga0307415_1000609982 | 430 |
| 526 | iso_pu_bacteria | 2690315906 | 2691514431 | 430 |
| 527 | iso_pu_bacteria | 2808606357 | 2808827513 | 430 |
| 528 | iso_pu_bacteria | 2808606360 | 2808852880 | 430 |
| 529 | iso_pu_bacteria | 2808606366 | 2808878671 | 430 |
| 530 | iso_pu_bacteria | 2808606370 | 2808891750 | 430 |
| 531 | iso_pu_bacteria | 2808606371 | 2808896877 | 430 |
| 532 | iso_pu_bacteria | 2811994871 | 2812320702 | 430 |
| 533 | iso_pu_bacteria | 2844849076 | 2844849373 | 430 |
| 534 | iso_pu_bacteria | 2857740372 | 2857741503 | 430 |
| 535 | iso_pu_bacteria | 2904497146 | 2904500034 | 430 |
| 536 | iso_pu_bacteria | 2904776348 | 2904776452 | 430 |
| 537 | iso_pu_bacteria | 2910809715 | 2910810526 | 430 |
| 538 | iso_pu_bacteria | 2919034639 | 2919037581 | 430 |
| 539 | iso_pu_bacteria | 2919059106 | 2919061870 | 430 |
| 540 | iso_pu_bacteria | 2919538618 | 2919541968 | 430 |
| 541 | iso_pu_bacteria | 2932426870 | 2932429070 | 430 |
| 542 | iso_pu_bacteria | 2933418574 | 2933421185 | 430 |
| 543 | iso_pu_bacteria | 2939598168 | 2939598485 | 430 |
| 544 | iso_pu_bacteria | 2939647034 | 2939649044 | 430 |
| 545 | iso_pu_bacteria | 2939674588 | 2939676237 | 430 |
| 546 | iso_pu_bacteria | 2945916053 | 2945918462 | 430 |
| 547 | iso_pu_bacteria | 2945920336 | 2945921256 | 430 |
| 548 | iso_pu_bacteria | 2946059875 | 2946062320 | 430 |
| 549 | iso_pu_bacteria | 2953998280 | 2953999775 | 430 |
| 550 | 3300037312 | Ga0395899_0014141 | Ga0395899_0014141_1522_2817 | 431 |
| 551 | 3300037418 | Ga0395900_0013950 | Ga0395900_0013950_5937_7232 | 431 |
| 552 | 3300037471 | Ga0395905_0037583 | Ga0395905_0037583_2862_4157 | 431 |
| 553 | 3300038443 | Ga0395901_0194540 | Ga0395901_0194540_304_1599 | 431 |
| 554 | 3300048910 | Ga0496107_0055552 | Ga0496107_0055552_1288_2583 | 431 |
| 555 | iso_pu_bacteria | 2919391150 | 2919391257 | 431 |
| 556 | iso_pu_bacteria | 2945956166 | 2945959675 | 431 |
| 557 | iso_pu_bacteria | 8004021418 | 8004021899 | 431 |
| 558 | iso_pu_bacteria | 8004025490 | 8004027737 | 431 |
| 559 | 3300037418 | Ga0395900_0044352 | Ga0395900_0044352_2356_3654 | 432 |
| 560 | 3300037466 | Ga0395898_0024438 | Ga0395898_0024438_462_1760 | 432 |
| 561 | 3300037466 | Ga0395898_0182519 | Ga0395898_0182519_560_1858 | 432 |
| 562 | 3300037471 | Ga0395905_0027168 | Ga0395905_0027168_1742_3040 | 432 |
| 563 | 3300038443 | Ga0395901_0003822 | Ga0395901_0003822_1837_3135 | 432 |
| 564 | iso_pu_bacteria | 8054107350 | 8054111197 | 432 |
| 565 | 3300031852 | Ga0307410_10056293 | Ga0307410_100562931 | 433 |
| 566 | 3300032004 | Ga0307414_10009861 | Ga0307414_100098615 | 433 |
| 567 | 3300048905 | Ga0496102_0109109 | Ga0496102_0109109_668_1969 | 433 |
| 568 | iso_pu_bacteria | 2945941187 | 2945942574 | 433 |
| 569 | iso_pu_bacteria | 2946024296 | 2946026253 | 433 |
| 570 | 3300002773 | JGI25152J39213_1000340 | JGI25152J39213_100034011 | 434 |
| 571 | 3300009036 | Ga0105244_10000369 | Ga0105244_1000036923 | 434 |
| 572 | 3300009036 | Ga0105244_10027522 | Ga0105244_100275222 | 434 |
| 573 | 3300011119 | Ga0105246_10001082 | Ga0105246_1000108211 | 434 |
| 574 | 3300011119 | Ga0105246_10008792 | Ga0105246_100087923 | 434 |
| 575 | 3300025245 | Ga0207425_1007182 | Ga0207425_10071822 | 434 |
| 576 | 3300025258 | Ga0209129_1000028 | Ga0209129_1000028142 | 434 |
| 577 | 3300025294 | Ga0209025_1000112 | Ga0209025_100011250 | 434 |
| 578 | 3300025303 | Ga0209051_1009666 | Ga0209051_10096664 | 434 |
| 579 | 3300025315 | Ga0207697_10008295 | Ga0207697_100082954 | 434 |
| 580 | 3300025728 | Ga0207655_1037570 | Ga0207655_10375702 | 434 |
| 581 | 3300031548 | Ga0307408_100002055 | Ga0307408_10000205510 | 434 |
| 582 | 3300031548 | Ga0307408_100023125 | Ga0307408_1000231253 | 434 |
| 583 | 3300031548 | Ga0307408_100091475 | Ga0307408_1000914752 | 434 |
| 584 | 3300031548 | Ga0307408_100155820 | Ga0307408_1001558202 | 434 |
| 585 | 3300031731 | Ga0307405_10005658 | Ga0307405_100056584 | 434 |
| 586 | 3300031731 | Ga0307405_10052027 | Ga0307405_100520272 | 434 |
| 587 | 3300031824 | Ga0307413_10021820 | Ga0307413_100218202 | 434 |
| 588 | 3300031852 | Ga0307410_10006673 | Ga0307410_100066734 | 434 |
| 589 | 3300031901 | Ga0307406_10039843 | Ga0307406_100398432 | 434 |
| 590 | 3300031901 | Ga0307406_10053391 | Ga0307406_100533912 | 434 |
| 591 | 3300031903 | Ga0307407_10031593 | Ga0307407_100315932 | 434 |
| 592 | 3300031903 | Ga0307407_10151088 | Ga0307407_101510881 | 434 |
| 593 | 3300031911 | Ga0307412_10000416 | Ga0307412_1000041619 | 434 |
| 594 | 3300031911 | Ga0307412_10005951 | Ga0307412_100059514 | 434 |
| 595 | 3300031911 | Ga0307412_10063214 | Ga0307412_100632142 | 434 |
| 596 | 3300032002 | Ga0307416_100062031 | Ga0307416_1000620313 | 434 |
| 597 | 3300032002 | Ga0307416_100165893 | Ga0307416_1001658932 | 434 |
| 598 | 3300032002 | Ga0307416_100187327 | Ga0307416_1001873272 | 434 |
| 599 | 3300032002 | Ga0307416_100214805 | Ga0307416_1002148052 | 434 |
| 600 | 3300032005 | Ga0307411_10030583 | Ga0307411_100305832 | 434 |
| 601 | 3300032005 | Ga0307411_10032279 | Ga0307411_100322791 | 434 |
| 602 | 3300032126 | Ga0307415_100014105 | Ga0307415_1000141053 | 434 |
| 603 | 3300037312 | Ga0395899_0039949 | Ga0395899_0039949_730_2034 | 434 |
| 604 | 3300037312 | Ga0395899_0103261 | Ga0395899_0103261_112_1416 | 434 |
| 605 | 3300037418 | Ga0395900_0019535 | Ga0395900_0019535_4901_6208 | 434 |
| 606 | 3300037466 | Ga0395898_0039526 | Ga0395898_0039526_760_2064 | 434 |
| 607 | 3300038443 | Ga0395901_0035125 | Ga0395901_0035125_2557_3861 | 434 |
| 608 | 3300038443 | Ga0395901_0141094 | Ga0395901_0141094_1161_2465 | 434 |
| 609 | 3300041404 | Ga0439436_0037508 | Ga0439436_0037508_68_1375 | 434 |
| 610 | 3300041406 | Ga0439439_0000152 | Ga0439439_0000152_7921_9228 | 434 |
| 611 | 3300041999 | Ga0439433_0000164 | Ga0439433_0000164_5406_6713 | 434 |
| 612 | 3300042002 | Ga0439442_004090 | Ga0439442_004090_262_1569 | 434 |
| 613 | 3300042007 | Ga0439449_0005694 | Ga0439449_0005694_262_1569 | 434 |
| 614 | 3300042015 | Ga0439462_0013530 | Ga0439462_0013530_228_1535 | 434 |
| 615 | 3300042156 | Ga0439446_0008797 | Ga0439446_0008797_908_2215 | 434 |
| 616 | 3300046472 | Ga0495580_0002034 | Ga0495580_0002034_13123_14430 | 434 |
| 617 | 3300046476 | Ga0495662_0024550 | Ga0495662_0024550_403_1707 | 434 |
| 618 | 3300046477 | Ga0495664_0035517 | Ga0495664_0035517_336_1640 | 434 |
| 619 | 3300046517 | Ga0495630_0126343 | Ga0495630_0126343_61_1365 | 434 |
| 620 | 3300046531 | Ga0495665_0029836 | Ga0495665_0029836_1177_2481 | 434 |
| 621 | 3300046535 | Ga0495586_0089181 | Ga0495586_0089181_387_1691 | 434 |
| 622 | 3300046543 | Ga0495645_0014215 | Ga0495645_0014215_2941_4245 | 434 |
| 623 | 3300046679 | Ga0495623_0013446 | Ga0495623_0013446_203_1507 | 434 |
| 624 | 3300046809 | Ga0495600_0118465 | Ga0495600_0118465_105_1409 | 434 |
| 625 | 3300047444 | Ga0495675_0051389 | Ga0495675_0051389_1000_2304 | 434 |
| 626 | 3300047471 | Ga0495684_0085673 | Ga0495684_0085673_10_1314 | 434 |
| 627 | 3300048906 | Ga0496103_0033243 | Ga0496103_0033243_519_1826 | 434 |
| 628 | 3300048915 | Ga0496112_0016287 | Ga0496112_0016287_151_1458 | 434 |
| 629 | 3300048915 | Ga0496112_0231970 | Ga0496112_0231970_451_1755 | 434 |
| 630 | 3300048916 | Ga0496113_0034968 | Ga0496113_0034968_634_1938 | 434 |
| 631 | 3300049569 | Ga0501032_0002687 | Ga0501032_0002687_9731_11035 | 434 |
| 632 | 3300049571 | Ga0501034_0000051 | Ga0501034_0000051_4023_5330 | 434 |
| 633 | 3300049573 | Ga0501037_0006593 | Ga0501037_0006593_4248_5555 | 434 |
| 634 | 3300049573 | Ga0501037_0007401 | Ga0501037_0007401_5065_6369 | 434 |
| 635 | 3300049574 | Ga0501038_0050099 | Ga0501038_0050099_180_1484 | 434 |
| 636 | 3300049575 | Ga0501039_0184928 | Ga0501039_0184928_270_1574 | 434 |
| 637 | 3300049579 | Ga0501043_0013661 | Ga0501043_0013661_1166_2473 | 434 |
| 638 | 3300005335 | Ga0070666_10079576 | Ga0070666_100795762 | 435 |
| 639 | 3300005353 | Ga0070669_100186226 | Ga0070669_1001862262 | 435 |
| 640 | 3300005364 | Ga0070673_100083033 | Ga0070673_1000830332 | 435 |
| 641 | 3300005367 | Ga0070667_100232059 | Ga0070667_1002320592 | 435 |
| 642 | 3300005543 | Ga0070672_100010765 | Ga0070672_1000107652 | 435 |
| 643 | 3300009011 | Ga0105251_10005243 | Ga0105251_100052433 | 435 |
| 644 | 3300013100 | Ga0157373_10010716 | Ga0157373_100107162 | 435 |
| 645 | 3300013102 | Ga0157371_10149067 | Ga0157371_101490671 | 435 |
| 646 | 3300013104 | Ga0157370_10031122 | Ga0157370_100311224 | 435 |
| 647 | 3300013306 | Ga0163162_10076851 | Ga0163162_100768514 | 435 |
| 648 | 3300025315 | Ga0207697_10012277 | Ga0207697_100122772 | 435 |
| 649 | 3300025728 | Ga0207655_1026654 | Ga0207655_10266542 | 435 |
| 650 | 3300025893 | Ga0207682_10014997 | Ga0207682_100149972 | 435 |
| 651 | 3300025903 | Ga0207680_10019631 | Ga0207680_100196312 | 435 |
| 652 | 3300025907 | Ga0207645_10007271 | Ga0207645_100072714 | 435 |
| 653 | 3300025940 | Ga0207691_10001302 | Ga0207691_1000130213 | 435 |
| 654 | 3300025960 | Ga0207651_10131448 | Ga0207651_101314482 | 435 |
| 655 | 3300026121 | Ga0207683_10002085 | Ga0207683_100020859 | 435 |
| 656 | 3300037312 | Ga0395899_0027010 | Ga0395899_0027010_2402_3712 | 435 |
| 657 | 3300037418 | Ga0395900_0234170 | Ga0395900_0234170_278_1588 | 435 |
| 658 | 3300037466 | Ga0395898_0027106 | Ga0395898_0027106_1396_2706 | 435 |
| 659 | 3300037466 | Ga0395898_0047410 | Ga0395898_0047410_908_2218 | 435 |
| 660 | 3300038443 | Ga0395901_0248137 | Ga0395901_0248137_529_1839 | 435 |
| 661 | 3300046475 | Ga0495639_0012044 | Ga0495639_0012044_2032_3339 | 435 |
| 662 | 3300046506 | Ga0495583_0058631 | Ga0495583_0058631_79_1386 | 435 |
| 663 | 3300046517 | Ga0495630_0055775 | Ga0495630_0055775_641_1948 | 435 |
| 664 | 3300046528 | Ga0495642_0006419 | Ga0495642_0006419_2658_3965 | 435 |
| 665 | 3300046531 | Ga0495665_0013444 | Ga0495665_0013444_195_1502 | 435 |
| 666 | 3300046535 | Ga0495586_0000519 | Ga0495586_0000519_13998_15305 | 435 |
| 667 | 3300046615 | Ga0495656_0003955 | Ga0495656_0003955_276_1583 | 435 |
| 668 | 3300046674 | Ga0495588_0008706 | Ga0495588_0008706_566_1873 | 435 |
| 669 | 3300046674 | Ga0495588_0020286 | Ga0495588_0020286_91_1398 | 435 |
| 670 | 3300046691 | Ga0495670_0007588 | Ga0495670_0007588_3208_4515 | 435 |
| 671 | 3300047315 | Ga0495581_0000105 | Ga0495581_0000105_8194_9501 | 435 |
| 672 | 3300047318 | Ga0495636_0008791 | Ga0495636_0008791_2389_3696 | 435 |
| 673 | 3300047445 | Ga0495677_0026271 | Ga0495677_0026271_44_1351 | 435 |
| 674 | 3300047470 | Ga0495681_0056261 | Ga0495681_0056261_196_1503 | 435 |
| 675 | 3300048905 | Ga0496102_0220572 | Ga0496102_0220572_242_1549 | 435 |
| 676 | 3300048908 | Ga0496105_0081913 | Ga0496105_0081913_848_2155 | 435 |
| 677 | 3300048909 | Ga0496106_0158377 | Ga0496106_0158377_51_1358 | 435 |
| 678 | 3300048910 | Ga0496107_0024168 | Ga0496107_0024168_967_2274 | 435 |
| 679 | 3300048913 | Ga0496110_0154930 | Ga0496110_0154930_307_1614 | 435 |
| 680 | 3300048914 | Ga0496111_0140631 | Ga0496111_0140631_32_1339 | 435 |
| 681 | 3300048915 | Ga0496112_0161213 | Ga0496112_0161213_395_1702 | 435 |
| 682 | 3300048916 | Ga0496113_0105541 | Ga0496113_0105541_824_2131 | 435 |
| 683 | 3300048922 | Ga0496119_0038767 | Ga0496119_0038767_1012_2319 | 435 |
| 684 | 3300031852 | Ga0307410_10023189 | Ga0307410_100231892 | 437 |
| 685 | 3300031901 | Ga0307406_10133833 | Ga0307406_101338331 | 437 |
| 686 | 3300032002 | Ga0307416_100067357 | Ga0307416_1000673574 | 437 |
| 687 | 3300041404 | Ga0439436_0004255 | Ga0439436_0004255_1178_2491 | 437 |
| 688 | 3300042002 | Ga0439442_000014 | Ga0439442_000014_16455_17774 | 437 |
| 689 | 3300042002 | Ga0439442_000199 | Ga0439442_000199_8308_9621 | 437 |
| 690 | 3300042015 | Ga0439462_0029856 | Ga0439462_0029856_75_1388 | 437 |
| 691 | 3300042122 | Ga0450920_000301 | Ga0450920_000301_2531_3844 | 437 |
| 692 | 3300042122 | Ga0450920_001565 | Ga0450920_001565_111_1424 | 437 |
| 693 | 3300042146 | Ga0450907_000405 | Ga0450907_000405_1392_2705 | 437 |
| 694 | 3300042531 | Ga0450918_000068 | Ga0450918_000068_13709_15022 | 437 |
| 695 | 3300041404 | Ga0439436_0001061 | Ga0439436_0001061_617_1933 | 438 |
| 696 | 3300041405 | Ga0439438_025643 | Ga0439438_025643_195_1511 | 438 |
| 697 | 3300041406 | Ga0439439_0007244 | Ga0439439_0007244_1197_2513 | 438 |
| 698 | 3300041411 | Ga0439466_0027612 | Ga0439466_0027612_590_1906 | 438 |
| 699 | 3300042007 | Ga0439449_0016133 | Ga0439449_0016133_159_1475 | 438 |
| 700 | 3300042014 | Ga0439457_007651 | Ga0439457_007651_645_1961 | 438 |
| 701 | 3300000549 | LJQas_1001176 | LJQas_10011764 | 439 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f4l-assembly1.cif.gz_A | structure of quinolinate synthase with inhibitor-derived quinolinate | 0.9295 | 83 | 439 |
| 7p4p-assembly1.cif.gz_A | structure of the quinolinate synthase a84l variant complexed with citrate | 0.928 | 84 | 437 |
| 6f4l-assembly1.cif.gz_A | structure of quinolinate synthase with inhibitor-derived quinolinate | 0.9266 | 83 | 439 |
| 7p4m-assembly1.cif.gz_A | structure of the quinolinate synthase y107f variant in an empty open form | 0.9231 | 84 | 437 |
| 5lqm-assembly1.cif.gz_A | structure of quinolinate synthase y21f mutant in complex with citrate | 0.9228 | 86 | 437 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ktnA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9132 | 87 | 165 | 3.40.50.10800 |
| 5ktoA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.904 | 302 | 383 | 3.40.50.10800 |
| 2qs0A03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9025 | 300 | 376 | 3.40.50.10800 |
| 4p3xA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.902 | 300 | 384 | 3.40.50.10800 |
| af_Q57850_5_79_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.8861 | 90 | 165 | 3.40.50.10800 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9W3J2-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9986 | 109 | 439 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A7C6X941-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9948 | 139 | 438 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A7V0UCT4-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9934 | 72 | 439 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A3B9W3J2-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9926 | 109 | 439 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A7V8SZD3-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 0.992 | 206 | 438 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar