F476091

General Info

Members Datasets Scaffolds Average Seq Length
700 259 698 251

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10091226|Ga0207705_100912262
Length 292
Sequence LQNGFNLIFLFPGYFYFFQKNKKIFDRTNLISIFGLNKLVTMSLAGQNLKYLRKLRGWTQEEFAAKLRIKRSLIGAYEEERADPRLEVLETISQIFKVTLDELLLQDMSVVTGSSYLAKRRQMKMMNADRNVIHFVPVKAAAGYLAGYADSEFIDELNTFTLPMLSGGSYRAFEIIGDSMMPTPSGSVIVGEKIENMDSVKNNATYIVVSKSEGIVYKRVVKNNKNKNKLTLVSDNPSFQPYQVQMADVLEMWQAQAVINKVTQHQRWDVDSLVNLVSNLQDQVSSLKKKMN

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
235 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 0.43
Rhizosphere 91.71
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1004410 3300000545 Unclassified 993
2 JGI24740J21852_10033782 3300001979 Bacteria 1618
3 JGI24033J26618_1009290 3300002155 Bacteria 1142
4 JGI25406J46586_10001082 3300003203 Bacteria 12780
5 rootH1_10012510 3300003316 Bacteria 8478
6 rootH2_10008764 3300003320 Bacteria 25286
7 rootH2_10022558 3300003320 Bacteria 3001
8 rootH2_10077251 3300003320 Bacteria 5116
9 rootH2_10241788 3300003320 Bacteria 1318
10 rootH2_10265827 3300003320 Bacteria 2346
11 rootL2_10035418 3300003322 Bacteria 2424
12 rootL2_10047293 3300003322 Bacteria 2836
13 rootL2_10184333 3300003322 Bacteria 2560
14 rootL2_10252239 3300003322 Bacteria 2215
15 rootH1_10033150 3300003323 Bacteria 4234
16 rootH1_10033151 3300003323 Bacteria 22992
17 JGI25160J50197_1000265 3300003354 Bacteria 39530
18 Ga0065714_10142125 3300005288 Bacteria 1164
19 Ga0065712_10007433 3300005290 Bacteria 2398
20 Ga0065712_10009117 3300005290 Bacteria 3822
21 Ga0065712_10013245 3300005290 Bacteria 3298
22 Ga0065712_10104013 3300005290 Bacteria 1971
23 Ga0065715_10004611 3300005293 Bacteria 4272
24 Ga0065715_10034333 3300005293 Bacteria 1859
25 Ga0065715_10212873 3300005293 Bacteria 1283
26 Ga0065715_10396081 3300005293 Unclassified 888
27 Ga0065707_10010710 3300005295 Bacteria 6212
28 Ga0065707_10324906 3300005295 Unclassified 949
29 Ga0070658_10018351 3300005327 Bacteria 5601
30 Ga0070658_10040671 3300005327 Bacteria 3751
31 Ga0070658_10056084 3300005327 Bacteria 3201
32 Ga0070658_10078815 3300005327 Bacteria 2704
33 Ga0070658_10185797 3300005327 Bacteria 1750
34 Ga0070676_10003200 3300005328 Bacteria 8493
35 Ga0070676_10045907 3300005328 Unclassified 2546
36 Ga0070683_100006418 3300005329 Bacteria 9863
37 Ga0070683_100033650 3300005329 Bacteria 4675
38 Ga0070683_100354476 3300005329 Bacteria 1397
39 Ga0070683_100359807 3300005329 Unclassified 1386
40 Ga0070690_100048040 3300005330 Bacteria 2717
41 Ga0070690_100097057 3300005330 Bacteria 1949
42 Ga0070670_100242799 3300005331 Bacteria 1568
43 Ga0070677_10102586 3300005333 Bacteria 1264
44 Ga0068869_100005681 3300005334 Bacteria 7866
45 Ga0068869_100011037 3300005334 Bacteria 5917
46 Ga0068869_100074809 3300005334 Bacteria 2515
47 Ga0068869_100100089 3300005334 Bacteria 2191
48 Ga0068869_100207709 3300005334 Unclassified 1547
49 Ga0068869_100369350 3300005334 Bacteria 1173
50 Ga0070666_10000108 3300005335 Bacteria 56931
51 Ga0070666_10005443 3300005335 Bacteria 7806
52 Ga0070680_100004884 3300005336 Bacteria 10095
53 Ga0070680_100005000 3300005336 Bacteria 9990
54 Ga0070680_100006348 3300005336 Bacteria 8976
55 Ga0070680_100065505 3300005336 Bacteria 2977
56 Ga0070680_100174801 3300005336 Bacteria 1808
57 Ga0070682_100000044 3300005337 Bacteria 133653
58 Ga0070682_100030518 3300005337 Unclassified 3255
59 Ga0070682_100065804 3300005337 Unclassified 2304
60 Ga0070682_100281747 3300005337 Bacteria 1212
61 Ga0068868_100016265 3300005338 Bacteria 5520
62 Ga0070660_100001860 3300005339 Bacteria 14529
63 Ga0070660_100052194 3300005339 Bacteria 3151
64 Ga0070660_100062334 3300005339 Bacteria 2896
65 Ga0070660_100111324 3300005339 Unclassified 2178
66 Ga0070689_100027434 3300005340 Unclassified 4293
67 Ga0070689_100126179 3300005340 Bacteria 2048
68 Ga0070687_100026323 3300005343 Unclassified 2800
69 Ga0070687_100070111 3300005343 Unclassified 1879
70 Ga0070687_100328840 3300005343 Bacteria 979
71 Ga0070687_100426268 3300005343 Bacteria 876
72 Ga0070661_100579417 3300005344 Bacteria 905
73 Ga0070668_100023358 3300005347 Bacteria 4677
74 Ga0070668_100095877 3300005347 Unclassified 2344
75 Ga0070668_100245019 3300005347 Bacteria 1486
76 Ga0070668_100298307 3300005347 Bacteria 1351
77 Ga0070669_100003025 3300005353 Bacteria 12090
78 Ga0070669_100006016 3300005353 Bacteria 8750
79 Ga0070669_100019749 3300005353 Bacteria 4814
80 Ga0070669_100106011 3300005353 Unclassified 2127
81 Ga0070669_100197503 3300005353 Unclassified 1581
82 Ga0070669_100248187 3300005353 Bacteria 1417
83 Ga0070675_100005755 3300005354 Bacteria 9482
84 Ga0070675_100022774 3300005354 Bacteria 5005
85 Ga0070675_100229698 3300005354 Bacteria 1618
86 Ga0070671_100183300 3300005355 Bacteria 1773
87 Ga0070671_100282748 3300005355 Bacteria 1411
88 Ga0070674_100025842 3300005356 Bacteria 3827
89 Ga0070674_100418666 3300005356 Bacteria 1098
90 Ga0070673_100020510 3300005364 Bacteria 4768
91 Ga0070673_100029789 3300005364 Bacteria 4075
92 Ga0070673_100030274 3300005364 Bacteria 4047
93 Ga0070673_100037299 3300005364 Bacteria 3702
94 Ga0070673_100046319 3300005364 Bacteria 3377
95 Ga0070673_100110690 3300005364 Unclassified 2277
96 Ga0070688_100097292 3300005365 Bacteria 1934
97 Ga0070688_100205700 3300005365 Bacteria 1379
98 Ga0070688_100330992 3300005365 Bacteria 1109
99 Ga0070659_100011028 3300005366 Bacteria 6675
100 Ga0070659_100018722 3300005366 Bacteria 5228
101 Ga0070659_100052418 3300005366 Unclassified 3209
102 Ga0070667_100689315 3300005367 Bacteria 945
103 Ga0070667_100694800 3300005367 Bacteria 941
104 Ga0070663_100008886 3300005455 Bacteria 6203
105 Ga0070678_100007906 3300005456 Bacteria 6330
106 Ga0070678_100524434 3300005456 Bacteria 1048
107 Ga0070662_100010256 3300005457 Bacteria 6142
108 Ga0070681_10012148 3300005458 Bacteria 8541
109 Ga0070681_10042870 3300005458 Bacteria 4534
110 Ga0068867_100167406 3300005459 Unclassified 1738
111 Ga0070685_10253042 3300005466 Bacteria 1168
112 Ga0070698_100002094 3300005471 Bacteria 22141
113 Ga0070698_100006624 3300005471 Bacteria 12560
114 Ga0070698_100024951 3300005471 Bacteria 6231
115 Ga0070698_100089771 3300005471 Bacteria 3057
116 Ga0070699_100262423 3300005518 Bacteria 1545
117 Ga0070699_100529154 3300005518 Bacteria 1072
118 Ga0070679_100000634 3300005530 Bacteria 29900
119 Ga0070679_100016556 3300005530 Bacteria 7117
120 Ga0070679_100036052 3300005530 Unclassified 4908
121 Ga0070679_100056862 3300005530 Bacteria 3898
122 Ga0070679_100084605 3300005530 Bacteria 3160
123 Ga0068853_100000245 3300005539 Bacteria 38110
124 Ga0068853_100035695 3300005539 Unclassified 4224
125 Ga0068853_100091375 3300005539 Bacteria 2677
126 Ga0068853_100218982 3300005539 Bacteria 1738
127 Ga0068853_100275596 3300005539 Bacteria 1550
128 Ga0068853_100353874 3300005539 Bacteria 1367
129 Ga0068853_100379252 3300005539 Bacteria 1320
130 Ga0070672_100008700 3300005543 Bacteria 6963
131 Ga0070672_100296941 3300005543 Bacteria 1369
132 Ga0070672_100609170 3300005543 Unclassified 952
133 Ga0070693_100428876 3300005547 Bacteria 923
134 Ga0070704_100365544 3300005549 Bacteria 1222
135 Ga0068855_100011433 3300005563 Bacteria 10723
136 Ga0068855_100027170 3300005563 Bacteria 6847
137 Ga0068855_100037472 3300005563 Bacteria 5765
138 Ga0068855_100074116 3300005563 Bacteria 3954
139 Ga0068855_100089553 3300005563 Bacteria 3552
140 Ga0068855_100158566 3300005563 Bacteria 2569
141 Ga0070664_100135290 3300005564 Unclassified 2167
142 Ga0070664_100802129 3300005564 Bacteria 880
143 Ga0068857_100039907 3300005577 Unclassified 4161
144 Ga0068857_100203049 3300005577 Bacteria 1807
145 Ga0068857_100247614 3300005577 Unclassified 1633
146 Ga0068854_100206141 3300005578 Bacteria 1548
147 Ga0068854_100403259 3300005578 Bacteria 1132
148 Ga0068854_100425054 3300005578 Unclassified 1104
149 Ga0068856_100006856 3300005614 Bacteria 11140
150 Ga0068856_100100400 3300005614 Bacteria 2886
151 Ga0068856_100119384 3300005614 Bacteria 2638
152 Ga0068856_100745300 3300005614 Bacteria 999
153 Ga0070702_100251574 3300005615 Bacteria 1198
154 Ga0068852_100032072 3300005616 Bacteria 4346
155 Ga0068852_100186643 3300005616 Bacteria 1953
156 Ga0068852_100302781 3300005616 Bacteria 1548
157 Ga0068852_100420885 3300005616 Bacteria 1318
158 Ga0068852_100431596 3300005616 Unclassified 1301
159 Ga0068859_100000029 3300005617 Bacteria 178422
160 Ga0068859_100007565 3300005617 Bacteria 11034
161 Ga0068859_100018315 3300005617 Bacteria 7040
162 Ga0068859_100027468 3300005617 Bacteria 5707
163 Ga0068859_100039091 3300005617 Bacteria 4759
164 Ga0068859_100058782 3300005617 Bacteria 3873
165 Ga0068859_100073894 3300005617 Bacteria 3448
166 Ga0068859_100262553 3300005617 Unclassified 1818
167 Ga0068864_100009388 3300005618 Bacteria 8069
168 Ga0068864_100026182 3300005618 Unclassified 4917
169 Ga0068864_100117451 3300005618 Bacteria 2374
170 Ga0068864_100399788 3300005618 Bacteria 1305
171 Ga0068864_100549346 3300005618 Bacteria 1116
172 Ga0068864_100960300 3300005618 Bacteria 846
173 Ga0068866_10063525 3300005718 Bacteria 1925
174 Ga0068861_100008514 3300005719 Bacteria 7062
175 Ga0068861_100016996 3300005719 Bacteria 5159
176 Ga0068861_100055850 3300005719 Bacteria 3012
177 Ga0068861_100222400 3300005719 Bacteria 1596
178 Ga0068851_10163188 3300005834 Bacteria 1225
179 Ga0068870_10002573 3300005840 Bacteria 7587
180 Ga0068870_10002679 3300005840 Bacteria 7457
181 Ga0068870_10036841 3300005840 Unclassified 2518
182 Ga0068863_100033403 3300005841 Bacteria 4901
183 Ga0068863_100134632 3300005841 Bacteria 2361
184 Ga0068863_100321371 3300005841 Bacteria 1503
185 Ga0068863_100733818 3300005841 Bacteria 983
186 Ga0068858_100011366 3300005842 Bacteria 8407
187 Ga0068858_100611731 3300005842 Bacteria 1057
188 Ga0068860_100000888 3300005843 Bacteria 33230
189 Ga0068860_100004943 3300005843 Bacteria 13587
190 Ga0068860_100014679 3300005843 Bacteria 7663
191 Ga0068860_100024627 3300005843 Bacteria 5812
192 Ga0068860_100032340 3300005843 Bacteria 5026
193 Ga0068860_100076873 3300005843 Bacteria 3174
194 Ga0068860_100128907 3300005843 Unclassified 2426
195 Ga0068860_100400647 3300005843 Bacteria 1357
196 Ga0068862_100011687 3300005844 Bacteria 7244
197 Ga0068862_100145587 3300005844 Bacteria 2105
198 Ga0068862_100157435 3300005844 Bacteria 2026
199 Ga0068862_100544408 3300005844 Bacteria 1108
200 Ga0081539_10000223 3300005985 Bacteria 133106
201 Ga0075366_10019311 3300006195 Bacteria 3941
202 Ga0075366_10049342 3300006195 Unclassified 2498
203 Ga0075366_10082030 3300006195 Bacteria 1927
204 Ga0097621_100046624 3300006237 Unclassified 3508
205 Ga0097621_100055899 3300006237 Bacteria 3223
206 Ga0097621_100137766 3300006237 Bacteria 2083
207 Ga0097621_100261178 3300006237 Bacteria 1519
208 Ga0097621_100357386 3300006237 Bacteria 1300
209 Ga0068871_100068956 3300006358 Unclassified 2904
210 Ga0068871_100162204 3300006358 Bacteria 1912
211 Ga0068871_100650571 3300006358 Bacteria 962
212 Ga0075428_100055685 3300006844 Unclassified 4333
213 Ga0075428_100206236 3300006844 Bacteria 2124
214 Ga0075430_100003135 3300006846 Bacteria 13825
215 Ga0075430_100044213 3300006846 Bacteria 3767
216 Ga0075431_100028830 3300006847 Bacteria 5708
217 Ga0075431_100202278 3300006847 Bacteria 2032
218 Ga0075429_100142825 3300006880 Bacteria 2095
219 Ga0075429_100430073 3300006880 Bacteria 1156
220 Ga0068865_100001928 3300006881 Bacteria 12208
221 Ga0068865_100319933 3300006881 Bacteria 1247
222 Ga0097620_100000029 3300006931 Bacteria 178422
223 Ga0097620_100007565 3300006931 Bacteria 11034
224 Ga0097620_100018315 3300006931 Bacteria 7040
225 Ga0097620_100027468 3300006931 Bacteria 5707
226 Ga0097620_100039091 3300006931 Bacteria 4759
227 Ga0097620_100058788 3300006931 Bacteria 3873
228 Ga0097620_100073895 3300006931 Bacteria 3448
229 Ga0097620_100262539 3300006931 Unclassified 1818
230 Ga0105240_10000635 3300009093 Bacteria 64838
231 Ga0105240_10027355 3300009093 Bacteria 7466
232 Ga0105240_10030822 3300009093 Bacteria 6966
233 Ga0105240_10032492 3300009093 Bacteria 6756
234 Ga0111539_10431535 3300009094 Bacteria 1534
235 Ga0111539_10631839 3300009094 Bacteria 1247
236 Ga0111539_10690835 3300009094 Bacteria 1188
237 Ga0105245_10157620 3300009098 Bacteria 2151
238 Ga0105245_10310613 3300009098 Bacteria 1550
239 Ga0105247_10016806 3300009101 Bacteria 4386
240 Ga0105247_10166630 3300009101 Bacteria 1462
241 Ga0114129_10010185 3300009147 Bacteria 13403
242 Ga0114129_10187129 3300009147 Bacteria 2813
243 Ga0105241_10000468 3300009174 Bacteria 30529
244 Ga0105241_10005738 3300009174 Bacteria 9165
245 Ga0105241_10013834 3300009174 Bacteria 5911
246 Ga0105241_10027570 3300009174 Bacteria 4231
247 Ga0105242_10052513 3300009176 Unclassified 3326
248 Ga0105242_10058644 3300009176 Bacteria 3157
249 Ga0105242_10166053 3300009176 Bacteria 1937
250 Ga0105242_10518713 3300009176 Bacteria 1137
251 Ga0105242_10573280 3300009176 Unclassified 1086
252 Ga0105248_10472181 3300009177 Bacteria 1414
253 Ga0105237_10002932 3300009545 Bacteria 20656
254 Ga0105237_10002948 3300009545 Bacteria 20606
255 Ga0105237_10025576 3300009545 Bacteria 6033
256 Ga0105237_10027810 3300009545 Bacteria 5764
257 Ga0105237_10048270 3300009545 Bacteria 4279
258 Ga0105238_10285865 3300009551 Bacteria 1631
259 Ga0105249_10001339 3300009553 Bacteria 21527
260 Ga0105249_10003125 3300009553 Bacteria 14313
261 Ga0105249_10003218 3300009553 Bacteria 14139
262 Ga0105249_10003898 3300009553 Bacteria 12892
263 Ga0105249_10048552 3300009553 Bacteria 3869
264 Ga0105249_10056524 3300009553 Bacteria 3593
265 Ga0105249_10384454 3300009553 Bacteria 1430
266 Ga0105249_10502117 3300009553 Unclassified 1258
267 Ga0105249_10557101 3300009553 Bacteria 1197
268 Ga0105239_10000368 3300010375 Bacteria 66186
269 Ga0105239_10002663 3300010375 Bacteria 22508
270 Ga0105239_10025652 3300010375 Bacteria 6491
271 Ga0105239_10057990 3300010375 Unclassified 4247
272 Ga0105239_10094004 3300010375 Bacteria 3311
273 Ga0105246_10021224 3300011119 Bacteria 4177
274 Ga0157373_10005342 3300013100 Bacteria 9652
275 Ga0157373_10010907 3300013100 Bacteria 6690
276 Ga0157373_10049758 3300013100 Bacteria 2986
277 Ga0157371_10000494 3300013102 Bacteria 47840
278 Ga0157371_10001626 3300013102 Bacteria 22988
279 Ga0157371_10004069 3300013102 Bacteria 12926
280 Ga0157371_10021743 3300013102 Bacteria 4706
281 Ga0157371_10025181 3300013102 Bacteria 4338
282 Ga0157371_10036499 3300013102 Bacteria 3519
283 Ga0157371_10039269 3300013102 Bacteria 3384
284 Ga0157371_10044737 3300013102 Bacteria 3152
285 Ga0157371_10092646 3300013102 Bacteria 2141
286 Ga0157371_10142457 3300013102 Bacteria 1707
287 Ga0157371_10167253 3300013102 Unclassified 1571
288 Ga0157371_10255945 3300013102 Bacteria 1261
289 Ga0157371_10273071 3300013102 Bacteria 1220
290 Ga0157371_10359515 3300013102 Bacteria 1061
291 Ga0157370_10001064 3300013104 Bacteria 34340
292 Ga0157370_10003014 3300013104 Bacteria 20000
293 Ga0157370_10008406 3300013104 Bacteria 11134
294 Ga0157370_10017114 3300013104 Bacteria 7320
295 Ga0157370_10112529 3300013104 Bacteria 2544
296 Ga0157370_10274710 3300013104 Bacteria 1557
297 Ga0157370_10378830 3300013104 Bacteria 1303
298 Ga0157370_10497403 3300013104 Bacteria 1120
299 Ga0157369_10107542 3300013105 Bacteria 2967
300 Ga0157369_10108609 3300013105 Bacteria 2951
301 Ga0157369_10160957 3300013105 Unclassified 2369
302 Ga0157369_10184327 3300013105 Bacteria 2195
303 Ga0157369_10189105 3300013105 Unclassified 2164
304 Ga0157374_10093734 3300013296 Unclassified 2868
305 Ga0157374_10100813 3300013296 Bacteria 2768
306 Ga0157374_10123860 3300013296 Bacteria 2497
307 Ga0157374_10360374 3300013296 Bacteria 1446
308 Ga0157374_10507552 3300013296 Bacteria 1211
309 Ga0157374_10753620 3300013296 Bacteria 988
310 Ga0157378_10048302 3300013297 Bacteria 3784
311 Ga0157378_10059540 3300013297 Bacteria 3408
312 Ga0157378_10152519 3300013297 Bacteria 2154
313 Ga0157378_10186511 3300013297 Bacteria 1954
314 Ga0157378_10430012 3300013297 Bacteria 1306
315 Ga0163162_10009899 3300013306 Bacteria 9271
316 Ga0163162_10016971 3300013306 Bacteria 7123
317 Ga0163162_10055575 3300013306 Bacteria 3986
318 Ga0163162_10145244 3300013306 Bacteria 2488
319 Ga0163162_10179790 3300013306 Bacteria 2241
320 Ga0163162_10251320 3300013306 Bacteria 1900
321 Ga0163162_10262372 3300013306 Bacteria 1859
322 Ga0157372_10025681 3300013307 Bacteria 6407
323 Ga0157372_10030554 3300013307 Bacteria 5893
324 Ga0157372_10061345 3300013307 Bacteria 4210
325 Ga0157372_10167403 3300013307 Unclassified 2542
326 Ga0157372_10204938 3300013307 Bacteria 2285
327 Ga0157372_10238603 3300013307 Bacteria 2109
328 Ga0157372_10258301 3300013307 Bacteria 2023
329 Ga0157372_10277756 3300013307 Bacteria 1947
330 Ga0157372_10481397 3300013307 Bacteria 1447
331 Ga0157372_10489868 3300013307 Unclassified 1433
332 Ga0157372_10637876 3300013307 Bacteria 1241
333 Ga0157375_10066346 3300013308 Bacteria 3602
334 Ga0157375_10085653 3300013308 Unclassified 3201
335 Ga0157375_10108617 3300013308 Bacteria 2869
336 Ga0157375_10140330 3300013308 Bacteria 2543
337 Ga0157375_10213591 3300013308 Bacteria 2087
338 Ga0157375_10409018 3300013308 Bacteria 1523
339 Ga0157375_10649109 3300013308 Bacteria 1212
340 Ga0157375_11095802 3300013308 Unclassified 932
341 Ga0163163_10000129 3300014325 Bacteria 77897
342 Ga0163163_10073765 3300014325 Bacteria 3404
343 Ga0163163_10266332 3300014325 Bacteria 1765
344 Ga0163163_10432658 3300014325 Bacteria 1375
345 Ga0163163_10616899 3300014325 Bacteria 1148
346 Ga0157380_10006594 3300014326 Bacteria 8189
347 Ga0157380_10013692 3300014326 Bacteria 5921
348 Ga0157380_10101656 3300014326 Unclassified 2396
349 Ga0157380_10179169 3300014326 Unclassified 1860
350 Ga0157380_10345684 3300014326 Bacteria 1390
351 Ga0157380_10540829 3300014326 Unclassified 1141
352 Ga0157380_10875646 3300014326 Bacteria 922
353 Ga0157377_10002037 3300014745 Bacteria 8859
354 Ga0157377_10021802 3300014745 Unclassified 3375
355 Ga0157377_10160914 3300014745 Bacteria 1396
356 Ga0157379_10051873 3300014968 Bacteria 3662
357 Ga0157379_10315885 3300014968 Bacteria 1426
358 Ga0157376_10221588 3300014969 Bacteria 1752
359 Ga0157376_10256231 3300014969 Bacteria 1637
360 Ga0163161_10011166 3300017792 Bacteria 6223
361 Ga0163161_10113733 3300017792 Bacteria 2026
362 Ga0163161_10233390 3300017792 Bacteria 1428
363 Ga0213876_10012974 3300021384 Bacteria 4429
364 Ga0213876_10145600 3300021384 Bacteria 1260
365 Ga0209646_1003581 3300025246 Bacteria 3024
366 Ga0207426_1000258 3300025302 Bacteria 114759
367 Ga0207697_10009721 3300025315 Bacteria 4143
368 Ga0207697_10096383 3300025315 Unclassified 1258
369 Ga0207697_10097219 3300025315 Bacteria 1252
370 Ga0207697_10148764 3300025315 Bacteria 1018
371 Ga0207656_10230566 3300025321 Bacteria 902
372 Ga0207682_10010808 3300025893 Bacteria 3574
373 Ga0207682_10019790 3300025893 Bacteria 2638
374 Ga0207682_10062178 3300025893 Unclassified 1565
375 Ga0207642_10015421 3300025899 Bacteria 2846
376 Ga0207710_10025589 3300025900 Unclassified 2547
377 Ga0207688_10010263 3300025901 Bacteria 5098
378 Ga0207688_10140019 3300025901 Unclassified 1424
379 Ga0207680_10000016 3300025903 Bacteria 134657
380 Ga0207647_10082748 3300025904 Bacteria 1922
381 Ga0207645_10000263 3300025907 Bacteria 43560
382 Ga0207645_10052338 3300025907 Bacteria 2608
383 Ga0207645_10277725 3300025907 Bacteria 1112
384 Ga0207643_10002440 3300025908 Bacteria 10046
385 Ga0207643_10004417 3300025908 Bacteria 7561
386 Ga0207643_10054394 3300025908 Bacteria 2275
387 Ga0207705_10006172 3300025909 Bacteria 8913
388 Ga0207705_10025699 3300025909 Bacteria 4201
389 Ga0207705_10061297 3300025909 Bacteria 2717
390 Ga0207705_10091226 3300025909 Bacteria 2231
391 Ga0207705_10119881 3300025909 Bacteria 1951
392 Ga0207654_10002271 3300025911 Bacteria 9858
393 Ga0207654_10122176 3300025911 Bacteria 1637
394 Ga0207707_10108115 3300025912 Bacteria 2431
395 Ga0207707_10159871 3300025912 Bacteria 1970
396 Ga0207695_10000446 3300025913 Bacteria 90493
397 Ga0207695_10005705 3300025913 Bacteria 16413
398 Ga0207695_10019063 3300025913 Bacteria 7912
399 Ga0207695_10040146 3300025913 Bacteria 5022
400 Ga0207671_10001104 3300025914 Bacteria 32550
401 Ga0207671_10005043 3300025914 Bacteria 12331
402 Ga0207671_10285209 3300025914 Bacteria 1303
403 Ga0207671_10344147 3300025914 Bacteria 1182
404 Ga0207660_10029293 3300025917 Bacteria 3774
405 Ga0207660_10060280 3300025917 Bacteria 2727
406 Ga0207660_10069501 3300025917 Bacteria 2557
407 Ga0207660_10263135 3300025917 Bacteria 1365
408 Ga0207662_10019410 3300025918 Unclassified 3868
409 Ga0207662_10044012 3300025918 Bacteria 2635
410 Ga0207657_10004643 3300025919 Bacteria 14508
411 Ga0207657_10015504 3300025919 Bacteria 7381
412 Ga0207657_10044524 3300025919 Unclassified 3901
413 Ga0207657_10069705 3300025919 Bacteria 2982
414 Ga0207652_10000051 3300025921 Bacteria 120327
415 Ga0207652_10000614 3300025921 Bacteria 35439
416 Ga0207652_10081187 3300025921 Bacteria 2836
417 Ga0207652_10121674 3300025921 Bacteria 2322
418 Ga0207652_10131866 3300025921 Unclassified 2229
419 Ga0207652_10477456 3300025921 Bacteria 1123
420 Ga0207681_10020407 3300025923 Unclassified 4199
421 Ga0207681_10054591 3300025923 Bacteria 2717
422 Ga0207681_10173555 3300025923 Unclassified 1636
423 Ga0207681_10260147 3300025923 Bacteria 1358
424 Ga0207681_10447651 3300025923 Bacteria 1050
425 Ga0207650_10200290 3300025925 Bacteria 1599
426 Ga0207650_10213972 3300025925 Bacteria 1549
427 Ga0207659_10043227 3300025926 Bacteria 3164
428 Ga0207659_10171793 3300025926 Bacteria 1710
429 Ga0207659_10238981 3300025926 Bacteria 1469
430 Ga0207644_10201255 3300025931 Unclassified 1571
431 Ga0207644_10617691 3300025931 Bacteria 901
432 Ga0207690_10045587 3300025932 Bacteria 2897
433 Ga0207690_10164783 3300025932 Unclassified 1655
434 Ga0207706_10191384 3300025933 Unclassified 1796
435 Ga0207706_10738248 3300025933 Bacteria 839
436 Ga0207686_10020142 3300025934 Bacteria 3806
437 Ga0207686_10048171 3300025934 Bacteria 2639
438 Ga0207686_10354138 3300025934 Unclassified 1106
439 Ga0207670_10037112 3300025936 Bacteria 3174
440 Ga0207670_10302628 3300025936 Bacteria 1252
441 Ga0207670_10364496 3300025936 Bacteria 1147
442 Ga0207670_10438822 3300025936 Bacteria 1051
443 Ga0207669_10033202 3300025937 Bacteria 2910
444 Ga0207704_10046681 3300025938 Bacteria 2583
445 Ga0207691_10003243 3300025940 Bacteria 15850
446 Ga0207691_10010867 3300025940 Bacteria 8736
447 Ga0207691_10178894 3300025940 Unclassified 1854
448 Ga0207691_10205216 3300025940 Unclassified 1714
449 Ga0207689_10000681 3300025942 Bacteria 32411
450 Ga0207689_10007704 3300025942 Bacteria 9423
451 Ga0207689_10018354 3300025942 Bacteria 5903
452 Ga0207689_10301673 3300025942 Unclassified 1328
453 Ga0207689_10509746 3300025942 Bacteria 1008
454 Ga0207661_10033063 3300025944 Bacteria 4012
455 Ga0207667_10000150 3300025949 Bacteria 104244
456 Ga0207667_10024155 3300025949 Bacteria 6679
457 Ga0207667_10033162 3300025949 Bacteria 5555
458 Ga0207667_10062837 3300025949 Bacteria 3881
459 Ga0207667_10324314 3300025949 Bacteria 1573
460 Ga0207651_10036208 3300025960 Bacteria 3219
461 Ga0207651_10194519 3300025960 Bacteria 1620
462 Ga0207651_10264242 3300025960 Unclassified 1414
463 Ga0207651_10333861 3300025960 Bacteria 1271
464 Ga0207712_10001366 3300025961 Bacteria 16706
465 Ga0207712_10003055 3300025961 Bacteria 10674
466 Ga0207712_10009499 3300025961 Bacteria 6153
467 Ga0207712_10023399 3300025961 Bacteria 4076
468 Ga0207712_10026721 3300025961 Bacteria 3849
469 Ga0207668_10031257 3300025972 Bacteria 3505
470 Ga0207668_10044922 3300025972 Bacteria 3009
471 Ga0207668_10102538 3300025972 Bacteria 2129
472 Ga0207668_10540995 3300025972 Bacteria 1008
473 Ga0207640_10334023 3300025981 Bacteria 1211
474 Ga0207640_10479294 3300025981 Bacteria 1032
475 Ga0207640_10520082 3300025981 Bacteria 994
476 Ga0207658_10103400 3300025986 Bacteria 2236
477 Ga0207658_10204847 3300025986 Bacteria 1649
478 Ga0207658_10602197 3300025986 Bacteria 987
479 Ga0207658_10684404 3300025986 Bacteria 926
480 Ga0207677_10093287 3300026023 Bacteria 2194
481 Ga0207677_10631056 3300026023 Bacteria 943
482 Ga0207703_10603213 3300026035 Bacteria 1039
483 Ga0207639_10006001 3300026041 Bacteria 8240
484 Ga0207639_10119917 3300026041 Bacteria 2160
485 Ga0207639_10193641 3300026041 Bacteria 1738
486 Ga0207639_10230286 3300026041 Bacteria 1606
487 Ga0207639_10861182 3300026041 Unclassified 846
488 Ga0207702_10200284 3300026078 Bacteria 1850
489 Ga0207641_10001043 3300026088 Bacteria 28025
490 Ga0207641_10001405 3300026088 Bacteria 23727
491 Ga0207641_10090858 3300026088 Bacteria 2671
492 Ga0207641_10378379 3300026088 Bacteria 1355
493 Ga0207641_10487497 3300026088 Bacteria 1195
494 Ga0207648_10002644 3300026089 Bacteria 19132
495 Ga0207648_10024271 3300026089 Bacteria 5415
496 Ga0207676_10005706 3300026095 Bacteria 8810
497 Ga0207676_10261190 3300026095 Bacteria 1564
498 Ga0207676_10353591 3300026095 Bacteria 1359
499 Ga0207676_10441505 3300026095 Unclassified 1225
500 Ga0207674_10001856 3300026116 Bacteria 26902
501 Ga0207674_10053595 3300026116 Bacteria 4110
502 Ga0207674_10077852 3300026116 Bacteria 3321
503 Ga0207674_10155794 3300026116 Bacteria 2240
504 Ga0207674_10181400 3300026116 Unclassified 2057
505 Ga0207675_100003498 3300026118 Bacteria 15327
506 Ga0207675_100006997 3300026118 Bacteria 10670
507 Ga0207675_100011111 3300026118 Bacteria 8436
508 Ga0207675_100136537 3300026118 Bacteria 2327
509 Ga0207675_100836763 3300026118 Bacteria 935
510 Ga0207683_10000943 3300026121 Bacteria 26669
511 Ga0207683_10215994 3300026121 Unclassified 1746
512 Ga0207683_10285839 3300026121 Unclassified 1508
513 Ga0207698_10004744 3300026142 Bacteria 8313
514 Ga0207698_10025059 3300026142 Bacteria 4196
515 Ga0207698_10319375 3300026142 Bacteria 1454
516 Ga0207698_10861439 3300026142 Unclassified 912
517 Ga0207428_10216825 3300027907 Bacteria 1436
518 Ga0207428_10470496 3300027907 Bacteria 915
519 Ga0268266_10398009 3300028379 Bacteria 1302
520 Ga0268265_10016719 3300028380 Bacteria 5047
521 Ga0268265_10116090 3300028380 Bacteria 2196
522 Ga0268265_10221874 3300028380 Bacteria 1655
523 Ga0268265_10224769 3300028380 Unclassified 1645
524 Ga0268264_10006240 3300028381 Bacteria 10058
525 Ga0268264_10036247 3300028381 Bacteria 4062
526 Ga0268264_10046441 3300028381 Bacteria 3607
527 Ga0268264_10190068 3300028381 Bacteria 1871
528 Ga0268264_10347444 3300028381 Bacteria 1411
529 Ga0268264_10351178 3300028381 Bacteria 1404
530 Ga0268264_10585933 3300028381 Unclassified 1098
531 Ga0268264_10747072 3300028381 Bacteria 974
532 Ga0307517_10107496 3300028786 Bacteria 2149
533 Ga0307515_10000002 3300028794 Bacteria 1231751
534 Ga0307512_10139691 3300030522 Bacteria 1487
535 Ga0265327_10000148 3300031251 Bacteria 151952
536 Ga0265327_10006106 3300031251 Bacteria 9763
537 Ga0265327_10089082 3300031251 Bacteria 1508
538 Ga0265327_10091403 3300031251 Bacteria 1483
539 Ga0307513_10125869 3300031456 Bacteria 2518
540 Ga0307509_10167093 3300031507 Bacteria 2086
541 Ga0265313_10012879 3300031595 Bacteria 5072
542 Ga0307516_10165356 3300031730 Bacteria 1958
543 Ga0307516_10224045 3300031730 Bacteria 1588
544 Ga0307412_10283557 3300031911 Bacteria 1302
545 Ga0307411_10253122 3300032005 Bacteria 1386
546 Ga0307415_100337848 3300032126 Bacteria 1263
547 Ga0307510_10000042 3300033180 Bacteria 100951
548 Ga0373927_0215912 3300035695 Bacteria 1260
549 Ga0373925_0172357 3300037068 Bacteria 1709
550 Ga0395899_0007352 3300037312 Bacteria 8518
551 Ga0395899_0011758 3300037312 Bacteria 6699
552 Ga0395899_0068454 3300037312 Bacteria 2602
553 Ga0395899_0110249 3300037312 Bacteria 1979
554 Ga0395900_0016503 3300037418 Bacteria 7532
555 Ga0395900_0046549 3300037418 Bacteria 4467
556 Ga0395900_0114897 3300037418 Unclassified 2762
557 Ga0395900_0160845 3300037418 Bacteria 2290
558 Ga0395900_0170725 3300037418 Bacteria 2214
559 Ga0395900_0717142 3300037418 Bacteria 932
560 Ga0395898_0001425 3300037466 Bacteria 34011
561 Ga0395898_0034774 3300037466 Bacteria 5016
562 Ga0395898_0073958 3300037466 Bacteria 3292
563 Ga0395898_0091609 3300037466 Unclassified 2924
564 Ga0395898_0203725 3300037466 Bacteria 1888
565 Ga0395898_0525410 3300037466 Bacteria 1125
566 Ga0395905_0004544 3300037471 Bacteria 14369
567 Ga0395905_0020976 3300037471 Bacteria 6187
568 Ga0395905_0067486 3300037471 Bacteria 3350
569 Ga0395901_0006414 3300038443 Bacteria 11920
570 Ga0395901_0037225 3300038443 Bacteria 5032
571 Ga0395901_0240064 3300038443 Bacteria 1890
572 Ga0395901_0302386 3300038443 Bacteria 1658
573 Ga0436365_0153361 3300039437 Unclassified 3105
574 Ga0436365_0169461 3300039437 Bacteria 4540
575 Ga0436365_0298838 3300039437 Bacteria 7530
576 Ga0436365_1415753 3300039437 Bacteria 4573
577 Ga0439436_0005974 3300041404 Bacteria 3734
578 Ga0439465_0011935 3300041413 Unclassified 2721
579 Ga0451791_0456665 3300041451 Bacteria 1764
580 Ga0451807_1365644 3300041486 Bacteria 1740
581 Ga0451849_0299315 3300041505 Bacteria 917
582 Ga0439431_0011275 3300041997 Unclassified 2041
583 Ga0439442_008572 3300042002 Bacteria 2063
584 Ga0439445_0005014 3300042004 Bacteria 3007
585 Ga0439449_0005127 3300042007 Bacteria 5039
586 Ga0439449_0019046 3300042007 Bacteria 2574
587 Ga0439449_0059046 3300042007 Bacteria 1416
588 Ga0439457_000452 3300042014 Bacteria 11848
589 Ga0439457_018898 3300042014 Bacteria 1531
590 Ga0439462_0028840 3300042015 Bacteria 1468
591 Ga0451577_0011413 3300042876 Bacteria 8406
592 Ga0451577_0095648 3300042876 Bacteria 2652
593 Ga0466969_0000082 3300044656 Bacteria 50189
594 Ga0466972_0000226 3300044658 Bacteria 39467
595 Ga0453683_0144086 3300044673 Bacteria 1504
596 Ga0466966_0000162 3300044684 Bacteria 43660
597 Ga0466961_0257819 3300044693 Bacteria 1070
598 Ga0466964_0023681 3300044706 Bacteria 2388
599 Ga0453684_0068125 3300044712 Bacteria 4521
600 Ga0453684_1173423 3300044712 Bacteria 807
601 Ga0466968_0010921 3300044735 Bacteria 3530
602 Ga0466968_0182869 3300044735 Bacteria 975
603 Ga0466957_0000673 3300044842 Bacteria 17391
604 Ga0466957_0001739 3300044842 Bacteria 11468
605 Ga0466960_0122825 3300044901 Bacteria 1362
606 Ga0466959_0000077 3300045049 Bacteria 62293
607 Ga0466967_0520304 3300045976 Bacteria 1169
608 Ga0495594_0127585 3300046499 Bacteria 1440
609 Ga0495606_0005751 3300046507 Bacteria 11723
610 Ga0495643_0038623 3300046522 Bacteria 2614
611 Ga0495598_0105781 3300046537 Bacteria 937
612 Ga0495645_0102790 3300046543 Bacteria 2031
613 Ga0495668_0000878 3300046616 Bacteria 33873
614 Ga0495668_0003042 3300046616 Bacteria 13052
615 Ga0495611_0000011 3300046648 Bacteria 146643
616 Ga0495636_0128017 3300047318 Bacteria 1128
617 Ga0495672_0012712 3300047320 Bacteria 5854
618 Ga0495672_0025053 3300047320 Bacteria 3828
619 Ga0495686_0016543 3300047472 Bacteria 5000
620 Ga0496108_0111020 3300048911 Bacteria 2345
621 Ga0501032_0011965 3300049569 Bacteria 6215
622 Ga0501032_0034263 3300049569 Bacteria 3477
623 Ga0501033_0010920 3300049570 Bacteria 6961
624 Ga0501033_0341958 3300049570 Bacteria 1049
625 Ga0501034_0000225 3300049571 Bacteria 107163
626 Ga0501034_0007951 3300049571 Bacteria 11263
627 Ga0501034_0014056 3300049571 Bacteria 8245
628 Ga0501034_0020625 3300049571 Bacteria 6731
629 Ga0501034_0024371 3300049571 Bacteria 6154
630 Ga0501034_0040672 3300049571 Bacteria 4705
631 Ga0501034_0834615 3300049571 Bacteria 813
632 Ga0501036_0058612 3300049572 Bacteria 3262
633 Ga0501036_0605010 3300049572 Bacteria 909
634 Ga0501036_0682384 3300049572 Unclassified 849
635 Ga0501037_0017921 3300049573 Bacteria 5213
636 Ga0501037_0029493 3300049573 Bacteria 4053
637 Ga0501037_0138975 3300049573 Bacteria 1739
638 Ga0501037_0201350 3300049573 Bacteria 1407
639 Ga0501038_0063668 3300049574 Bacteria 3147
640 Ga0501043_0025587 3300049579 Bacteria 4630
641 Ga0501043_0530827 3300049579 Unclassified 876
642 Ga0501047_0010456 3300049581 Bacteria 8783
643 Ga0501047_0014516 3300049581 Bacteria 7492
644 Ga0501047_0071661 3300049581 Bacteria 3335
645 Ga0501047_0340047 3300049581 Bacteria 1338
646 Ga0501048_0037369 3300049582 Bacteria 3487
647 Ga0501067_0031611 3300049583 Bacteria 2937
648 Ga0501070_0043109 3300049586 Bacteria 3756
649 Ga0501070_0064010 3300049586 Bacteria 3046
650 Ga0501073_0094626 3300049589 Bacteria 2075
651 Ga0501073_0365422 3300049589 Unclassified 997
652 Ga0501074_0012848 3300049590 Bacteria 6087
653 Ga0501235_033679 3300049669 Bacteria 1161
654 Ga0501257_006486 3300049686 Unclassified 2596
655 Ga0501219_000096 3300049703 Bacteria 15208
656 Ga0501225_0005775 3300049705 Bacteria 3623
657 Ga0501079_0211643 3300049741 Bacteria 1514
658 Ga0501080_0206677 3300049742 Bacteria 1800
659 Ga0501035_0017551 3300049822 Bacteria 6604
660 Ga0501035_0020579 3300049822 Bacteria 6060
661 Ga0501035_0034818 3300049822 Bacteria 4575
662 Ga0501035_0071998 3300049822 Bacteria 3060
663 Ga0501044_0024861 3300049823 Bacteria 6353
664 Ga0501044_0126575 3300049823 Bacteria 2552
665 Ga0501044_0131607 3300049823 Bacteria 2495
666 Ga0501044_0184568 3300049823 Bacteria 2051
667 Ga0501044_0379902 3300049823 Bacteria 1328
668 Ga0501044_0605743 3300049823 Bacteria 988
669 Ga0501284_00101 3300050005 Bacteria 17814
670 nmdc:mga0k408_1636_c1 3300050493 Bacteria 12115
671 nmdc:mga05p37_63512_c1 3300050507 Bacteria 4544
672 nmdc:mga09592_165397_c1 3300050508 Unclassified 1912
673 nmdc:mga09592_210214_c1 3300050508 Bacteria 1686
674 nmdc:mga0qj67_10091_c1 3300050509 Bacteria 7047
675 nmdc:mga0qj67_80584_c1 3300050509 Bacteria 2608
676 nmdc:mga08y16_301704_c1 3300050511 Bacteria 1651
677 nmdc:mga08y16_776412_c1 3300050511 Bacteria 953
678 Ga0500578_0008966 3300053086 Bacteria 6520
679 Ga0500578_0010664 3300053086 Bacteria 5936
680 Ga0500646_0041006 3300053090 Bacteria 1303
681 Ga0500583_0000180 3300053092 Bacteria 25825
682 Ga0500583_0006538 3300053092 Bacteria 4021
683 Ga0500583_0147196 3300053092 Bacteria 1172
684 Ga0500555_027869 3300053103 Bacteria 1611
685 Ga0500556_0120806 3300053104 Bacteria 1022
686 Ga0500559_0020352 3300053136 Unclassified 2806
687 Ga0500588_0008405 3300053146 Bacteria 2410
688 Ga0500604_0009128 3300053151 Bacteria 2639
689 Ga0500604_0050660 3300053151 Bacteria 1281
690 Ga0500616_0073222 3300053153 Unclassified 1740
691 Ga0500616_0145608 3300053153 Bacteria 1102
692 Ga0500622_0087709 3300053156 Bacteria 1549
693 Ga0500622_0104811 3300053156 Bacteria 1388
694 Ga0500636_0237655 3300053177 Bacteria 938
695 Ga0500611_000002 3300053727 Bacteria 345991
696 Ga0500611_050146 3300053727 Bacteria 953
697 Ga0501084_0585202 3300054114 Bacteria 943
698 Ga0466962_0011495 3300061719 Bacteria 4263

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10142125 Ga0065714_101421251 220
2 3300005843 Ga0068860_100400647 Ga0068860_1004006472 233
3 3300028381 Ga0268264_10747072 Ga0268264_107470721 233
4 3300053727 Ga0500611_050146 Ga0500611_050146_46_747 233
5 3300003322 rootL2_10252239 rootL2_102522393 234
6 3300005334 Ga0068869_100005681 Ga0068869_1000056815 235
7 3300005335 Ga0070666_10000108 Ga0070666_100001087 235
8 3300005340 Ga0070689_100126179 Ga0070689_1001261791 235
9 3300005355 Ga0070671_100183300 Ga0070671_1001833002 235
10 3300005364 Ga0070673_100037299 Ga0070673_1000372992 235
11 3300005617 Ga0068859_100000029 Ga0068859_10000002919 235
12 3300005618 Ga0068864_100009388 Ga0068864_1000093887 235
13 3300005842 Ga0068858_100011366 Ga0068858_1000113667 235
14 3300005843 Ga0068860_100000888 Ga0068860_10000088814 235
15 3300006237 Ga0097621_100046624 Ga0097621_1000466242 235
16 3300006358 Ga0068871_100068956 Ga0068871_1000689563 235
17 3300006931 Ga0097620_100000029 Ga0097620_10000002919 235
18 3300009098 Ga0105245_10157620 Ga0105245_101576202 235
19 3300009101 Ga0105247_10016806 Ga0105247_100168062 235
20 3300009174 Ga0105241_10000468 Ga0105241_100004685 235
21 3300009176 Ga0105242_10052513 Ga0105242_100525135 235
22 3300009177 Ga0105248_10472181 Ga0105248_104721811 235
23 3300009545 Ga0105237_10002932 Ga0105237_1000293216 235
24 3300009553 Ga0105249_10001339 Ga0105249_100013396 235
25 3300013306 Ga0163162_10016971 Ga0163162_100169716 235
26 3300013306 Ga0163162_10145244 Ga0163162_101452443 235
27 3300013308 Ga0157375_10140330 Ga0157375_101403302 235
28 3300014968 Ga0157379_10051873 Ga0157379_100518731 235
29 3300014969 Ga0157376_10256231 Ga0157376_102562311 235
30 3300025900 Ga0207710_10025589 Ga0207710_100255891 235
31 3300025903 Ga0207680_10000016 Ga0207680_1000001692 235
32 3300025914 Ga0207671_10001104 Ga0207671_100011046 235
33 3300025931 Ga0207644_10617691 Ga0207644_106176911 235
34 3300025934 Ga0207686_10048171 Ga0207686_100481712 235
35 3300025936 Ga0207670_10302628 Ga0207670_103026281 235
36 3300025940 Ga0207691_10178894 Ga0207691_101788941 235
37 3300025942 Ga0207689_10000681 Ga0207689_1000068118 235
38 3300025961 Ga0207712_10003055 Ga0207712_1000305511 235
39 3300025986 Ga0207658_10204847 Ga0207658_102048472 235
40 3300026023 Ga0207677_10093287 Ga0207677_100932871 235
41 3300026088 Ga0207641_10001043 Ga0207641_1000104311 235
42 3300026095 Ga0207676_10005706 Ga0207676_100057062 235
43 3300028381 Ga0268264_10006240 Ga0268264_100062406 235
44 3300047320 Ga0495672_0025053 Ga0495672_0025053_602_1354 235
45 3300005336 Ga0070680_100006348 Ga0070680_1000063487 236
46 3300005366 Ga0070659_100011028 Ga0070659_1000110288 236
47 3300005563 Ga0068855_100011433 Ga0068855_1000114332 236
48 3300005577 Ga0068857_100203049 Ga0068857_1002030491 236
49 3300009093 Ga0105240_10032492 Ga0105240_100324927 236
50 3300013100 Ga0157373_10005342 Ga0157373_100053426 236
51 3300013102 Ga0157371_10025181 Ga0157371_100251811 236
52 3300025913 Ga0207695_10040146 Ga0207695_100401466 236
53 3300025917 Ga0207660_10029293 Ga0207660_100292932 236
54 3300025919 Ga0207657_10015504 Ga0207657_100155046 236
55 3300025932 Ga0207690_10045587 Ga0207690_100455871 236
56 3300025949 Ga0207667_10033162 Ga0207667_100331627 236
57 3300026116 Ga0207674_10155794 Ga0207674_101557941 236
58 3300037466 Ga0395898_0525410 Ga0395898_0525410_355_1110 236
59 3300005337 Ga0070682_100000044 Ga0070682_10000004445 238
60 3300009098 Ga0105245_10310613 Ga0105245_103106131 238
61 3300025931 Ga0207644_10201255 Ga0207644_102012552 238
62 3300013102 Ga0157371_10044737 Ga0157371_100447373 239
63 3300013307 Ga0157372_10481397 Ga0157372_104813971 239
64 3300026041 Ga0207639_10230286 Ga0207639_102302862 239
65 3300046616 Ga0495668_0000878 Ga0495668_0000878_33019_33774 240
66 3300049570 Ga0501033_0341958 Ga0501033_0341958_144_896 241
67 3300049686 Ga0501257_006486 Ga0501257_006486_54_803 242
68 3300061719 Ga0466962_0011495 Ga0466962_0011495_1362_2093 243
69 3300009176 Ga0105242_10058644 Ga0105242_100586441 244
70 3300025934 Ga0207686_10354138 Ga0207686_103541381 244
71 iso_pu_bacteria 2738541278 2738731419 245
72 iso_pu_bacteria 2818991444 2819586689 245
73 3300009147 Ga0114129_10010185 Ga0114129_1001018511 247
74 3300042876 Ga0451577_0011413 Ga0451577_0011413_4027_4770 247
75 3300042876 Ga0451577_0095648 Ga0451577_0095648_786_1538 247
76 3300044842 Ga0466957_0001739 Ga0466957_0001739_10281_11024 247
77 3300050507 nmdc:mga05p37_63512_c1 nmdc:mga05p37_63512_c1_1359_2102 247
78 3300005293 Ga0065715_10034333 Ga0065715_100343333 248
79 3300005293 Ga0065715_10212873 Ga0065715_102128731 248
80 3300005330 Ga0070690_100048040 Ga0070690_1000480401 248
81 3300005471 Ga0070698_100006624 Ga0070698_1000066245 248
82 3300005518 Ga0070699_100262423 Ga0070699_1002624232 248
83 3300005539 Ga0068853_100218982 Ga0068853_1002189822 248
84 3300005617 Ga0068859_100039091 Ga0068859_1000390914 248
85 3300006237 Ga0097621_100137766 Ga0097621_1001377663 248
86 3300006931 Ga0097620_100039091 Ga0097620_1000390914 248
87 3300009094 Ga0111539_10431535 Ga0111539_104315352 248
88 3300013296 Ga0157374_10753620 Ga0157374_107536201 248
89 3300013297 Ga0157378_10059540 Ga0157378_100595405 248
90 3300013306 Ga0163162_10251320 Ga0163162_102513202 248
91 3300013306 Ga0163162_10262372 Ga0163162_102623721 248
92 3300013308 Ga0157375_10108617 Ga0157375_101086171 248
93 3300014968 Ga0157379_10315885 Ga0157379_103158852 248
94 3300017792 Ga0163161_10113733 Ga0163161_101137333 248
95 3300025893 Ga0207682_10010808 Ga0207682_100108083 248
96 3300025926 Ga0207659_10238981 Ga0207659_102389812 248
97 3300026041 Ga0207639_10193641 Ga0207639_101936412 248
98 3300026089 Ga0207648_10024271 Ga0207648_100242716 248
99 3300027907 Ga0207428_10216825 Ga0207428_102168252 248
100 3300028381 Ga0268264_10347444 Ga0268264_103474441 248
101 3300028381 Ga0268264_10585933 Ga0268264_105859331 248
102 3300028794 Ga0307515_10000002 Ga0307515_10000002397 248
103 3300031911 Ga0307412_10283557 Ga0307412_102835572 248
104 3300032126 Ga0307415_100337848 Ga0307415_1003378481 248
105 3300048911 Ga0496108_0111020 Ga0496108_0111020_212_967 248
106 3300049571 Ga0501034_0000225 Ga0501034_0000225_15216_15977 248
107 3300053104 Ga0500556_0120806 Ga0500556_0120806_240_992 248
108 3300000545 CNXas_1004410 CNXas_10044102 249
109 3300001979 JGI24740J21852_10033782 JGI24740J21852_100337822 249
110 3300002155 JGI24033J26618_1009290 JGI24033J26618_10092901 249
111 3300003203 JGI25406J46586_10001082 JGI25406J46586_1000108210 249
112 3300003316 rootH1_10012510 rootH1_100125103 249
113 3300003320 rootH2_10008764 rootH2_1000876416 249
114 3300003320 rootH2_10022558 rootH2_100225583 249
115 3300003320 rootH2_10077251 rootH2_100772512 249
116 3300003320 rootH2_10241788 rootH2_102417882 249
117 3300003320 rootH2_10265827 rootH2_102658271 249
118 3300003322 rootL2_10035418 rootL2_100354182 249
119 3300003322 rootL2_10047293 rootL2_100472933 249
120 3300003322 rootL2_10184333 rootL2_101843331 249
121 3300003323 rootH1_10033150 rootH1_100331502 249
122 3300003323 rootH1_10033151 rootH1_100331519 249
123 3300003354 JGI25160J50197_1000265 JGI25160J50197_100026517 249
124 3300005290 Ga0065712_10007433 Ga0065712_100074331 249
125 3300005290 Ga0065712_10009117 Ga0065712_100091174 249
126 3300005290 Ga0065712_10013245 Ga0065712_100132452 249
127 3300005290 Ga0065712_10104013 Ga0065712_101040132 249
128 3300005293 Ga0065715_10004611 Ga0065715_100046112 249
129 3300005293 Ga0065715_10396081 Ga0065715_103960811 249
130 3300005295 Ga0065707_10010710 Ga0065707_100107104 249
131 3300005295 Ga0065707_10324906 Ga0065707_103249061 249
132 3300005327 Ga0070658_10018351 Ga0070658_100183514 249
133 3300005327 Ga0070658_10040671 Ga0070658_100406714 249
134 3300005327 Ga0070658_10056084 Ga0070658_100560841 249
135 3300005327 Ga0070658_10078815 Ga0070658_100788153 249
136 3300005327 Ga0070658_10185797 Ga0070658_101857973 249
137 3300005328 Ga0070676_10003200 Ga0070676_100032004 249
138 3300005328 Ga0070676_10045907 Ga0070676_100459072 249
139 3300005329 Ga0070683_100006418 Ga0070683_1000064185 249
140 3300005329 Ga0070683_100033650 Ga0070683_1000336502 249
141 3300005329 Ga0070683_100354476 Ga0070683_1003544762 249
142 3300005329 Ga0070683_100359807 Ga0070683_1003598072 249
143 3300005330 Ga0070690_100097057 Ga0070690_1000970572 249
144 3300005331 Ga0070670_100242799 Ga0070670_1002427991 249
145 3300005333 Ga0070677_10102586 Ga0070677_101025862 249
146 3300005334 Ga0068869_100011037 Ga0068869_1000110373 249
147 3300005334 Ga0068869_100074809 Ga0068869_1000748092 249
148 3300005334 Ga0068869_100100089 Ga0068869_1001000892 249
149 3300005334 Ga0068869_100207709 Ga0068869_1002077091 249
150 3300005334 Ga0068869_100369350 Ga0068869_1003693502 249
151 3300005335 Ga0070666_10005443 Ga0070666_100054431 249
152 3300005336 Ga0070680_100004884 Ga0070680_1000048844 249
153 3300005336 Ga0070680_100005000 Ga0070680_1000050009 249
154 3300005336 Ga0070680_100065505 Ga0070680_1000655052 249
155 3300005336 Ga0070680_100174801 Ga0070680_1001748013 249
156 3300005337 Ga0070682_100030518 Ga0070682_1000305183 249
157 3300005337 Ga0070682_100065804 Ga0070682_1000658043 249
158 3300005337 Ga0070682_100281747 Ga0070682_1002817471 249
159 3300005338 Ga0068868_100016265 Ga0068868_1000162653 249
160 3300005339 Ga0070660_100001860 Ga0070660_10000186014 249
161 3300005339 Ga0070660_100052194 Ga0070660_1000521943 249
162 3300005339 Ga0070660_100062334 Ga0070660_1000623342 249
163 3300005339 Ga0070660_100111324 Ga0070660_1001113242 249
164 3300005340 Ga0070689_100027434 Ga0070689_1000274342 249
165 3300005343 Ga0070687_100026323 Ga0070687_1000263233 249
166 3300005343 Ga0070687_100070111 Ga0070687_1000701112 249
167 3300005343 Ga0070687_100328840 Ga0070687_1003288401 249
168 3300005343 Ga0070687_100426268 Ga0070687_1004262681 249
169 3300005344 Ga0070661_100579417 Ga0070661_1005794171 249
170 3300005347 Ga0070668_100023358 Ga0070668_1000233584 249
171 3300005347 Ga0070668_100095877 Ga0070668_1000958772 249
172 3300005347 Ga0070668_100245019 Ga0070668_1002450192 249
173 3300005347 Ga0070668_100298307 Ga0070668_1002983071 249
174 3300005353 Ga0070669_100003025 Ga0070669_1000030257 249
175 3300005353 Ga0070669_100006016 Ga0070669_1000060168 249
176 3300005353 Ga0070669_100019749 Ga0070669_1000197491 249
177 3300005353 Ga0070669_100106011 Ga0070669_1001060112 249
178 3300005353 Ga0070669_100197503 Ga0070669_1001975031 249
179 3300005353 Ga0070669_100248187 Ga0070669_1002481871 249
180 3300005354 Ga0070675_100005755 Ga0070675_1000057552 249
181 3300005354 Ga0070675_100022774 Ga0070675_1000227744 249
182 3300005354 Ga0070675_100229698 Ga0070675_1002296982 249
183 3300005355 Ga0070671_100282748 Ga0070671_1002827482 249
184 3300005356 Ga0070674_100025842 Ga0070674_1000258423 249
185 3300005356 Ga0070674_100418666 Ga0070674_1004186662 249
186 3300005364 Ga0070673_100020510 Ga0070673_1000205105 249
187 3300005364 Ga0070673_100029789 Ga0070673_1000297893 249
188 3300005364 Ga0070673_100030274 Ga0070673_1000302743 249
189 3300005364 Ga0070673_100046319 Ga0070673_1000463193 249
190 3300005364 Ga0070673_100110690 Ga0070673_1001106902 249
191 3300005365 Ga0070688_100097292 Ga0070688_1000972921 249
192 3300005365 Ga0070688_100205700 Ga0070688_1002057002 249
193 3300005365 Ga0070688_100330992 Ga0070688_1003309922 249
194 3300005366 Ga0070659_100018722 Ga0070659_1000187224 249
195 3300005366 Ga0070659_100052418 Ga0070659_1000524183 249
196 3300005367 Ga0070667_100689315 Ga0070667_1006893151 249
197 3300005367 Ga0070667_100694800 Ga0070667_1006948001 249
198 3300005455 Ga0070663_100008886 Ga0070663_1000088867 249
199 3300005456 Ga0070678_100007906 Ga0070678_1000079066 249
200 3300005456 Ga0070678_100524434 Ga0070678_1005244341 249
201 3300005457 Ga0070662_100010256 Ga0070662_1000102569 249
202 3300005458 Ga0070681_10012148 Ga0070681_100121488 249
203 3300005458 Ga0070681_10042870 Ga0070681_100428703 249
204 3300005459 Ga0068867_100167406 Ga0068867_1001674061 249
205 3300005466 Ga0070685_10253042 Ga0070685_102530421 249
206 3300005471 Ga0070698_100002094 Ga0070698_10000209418 249
207 3300005471 Ga0070698_100024951 Ga0070698_1000249514 249
208 3300005471 Ga0070698_100089771 Ga0070698_1000897713 249
209 3300005518 Ga0070699_100529154 Ga0070699_1005291541 249
210 3300005530 Ga0070679_100000634 Ga0070679_10000063433 249
211 3300005530 Ga0070679_100016556 Ga0070679_1000165562 249
212 3300005530 Ga0070679_100036052 Ga0070679_1000360524 249
213 3300005530 Ga0070679_100056862 Ga0070679_1000568623 249
214 3300005530 Ga0070679_100084605 Ga0070679_1000846052 249
215 3300005539 Ga0068853_100000245 Ga0068853_1000002458 249
216 3300005539 Ga0068853_100035695 Ga0068853_1000356953 249
217 3300005539 Ga0068853_100091375 Ga0068853_1000913753 249
218 3300005539 Ga0068853_100275596 Ga0068853_1002755962 249
219 3300005539 Ga0068853_100353874 Ga0068853_1003538742 249
220 3300005539 Ga0068853_100379252 Ga0068853_1003792522 249
221 3300005543 Ga0070672_100008700 Ga0070672_1000087004 249
222 3300005543 Ga0070672_100296941 Ga0070672_1002969412 249
223 3300005543 Ga0070672_100609170 Ga0070672_1006091701 249
224 3300005547 Ga0070693_100428876 Ga0070693_1004288761 249
225 3300005549 Ga0070704_100365544 Ga0070704_1003655442 249
226 3300005563 Ga0068855_100027170 Ga0068855_1000271704 249
227 3300005563 Ga0068855_100037472 Ga0068855_1000374725 249
228 3300005563 Ga0068855_100074116 Ga0068855_1000741163 249
229 3300005563 Ga0068855_100089553 Ga0068855_1000895533 249
230 3300005563 Ga0068855_100158566 Ga0068855_1001585662 249
231 3300005564 Ga0070664_100135290 Ga0070664_1001352902 249
232 3300005564 Ga0070664_100802129 Ga0070664_1008021291 249
233 3300005577 Ga0068857_100039907 Ga0068857_1000399072 249
234 3300005577 Ga0068857_100247614 Ga0068857_1002476142 249
235 3300005578 Ga0068854_100206141 Ga0068854_1002061411 249
236 3300005578 Ga0068854_100403259 Ga0068854_1004032592 249
237 3300005578 Ga0068854_100425054 Ga0068854_1004250541 249
238 3300005614 Ga0068856_100006856 Ga0068856_1000068565 249
239 3300005614 Ga0068856_100100400 Ga0068856_1001004004 249
240 3300005614 Ga0068856_100119384 Ga0068856_1001193841 249
241 3300005614 Ga0068856_100745300 Ga0068856_1007453001 249
242 3300005615 Ga0070702_100251574 Ga0070702_1002515741 249
243 3300005616 Ga0068852_100032072 Ga0068852_1000320723 249
244 3300005616 Ga0068852_100186643 Ga0068852_1001866432 249
245 3300005616 Ga0068852_100302781 Ga0068852_1003027812 249
246 3300005616 Ga0068852_100420885 Ga0068852_1004208852 249
247 3300005616 Ga0068852_100431596 Ga0068852_1004315962 249
248 3300005617 Ga0068859_100007565 Ga0068859_10000756510 249
249 3300005617 Ga0068859_100018315 Ga0068859_1000183156 249
250 3300005617 Ga0068859_100027468 Ga0068859_1000274688 249
251 3300005617 Ga0068859_100058782 Ga0068859_1000587821 249
252 3300005617 Ga0068859_100073894 Ga0068859_1000738941 249
253 3300005617 Ga0068859_100262553 Ga0068859_1002625532 249
254 3300005618 Ga0068864_100026182 Ga0068864_1000261824 249
255 3300005618 Ga0068864_100117451 Ga0068864_1001174514 249
256 3300005618 Ga0068864_100399788 Ga0068864_1003997882 249
257 3300005618 Ga0068864_100549346 Ga0068864_1005493461 249
258 3300005618 Ga0068864_100960300 Ga0068864_1009603001 249
259 3300005718 Ga0068866_10063525 Ga0068866_100635254 249
260 3300005719 Ga0068861_100008514 Ga0068861_1000085143 249
261 3300005719 Ga0068861_100016996 Ga0068861_1000169962 249
262 3300005719 Ga0068861_100055850 Ga0068861_1000558504 249
263 3300005719 Ga0068861_100222400 Ga0068861_1002224002 249
264 3300005834 Ga0068851_10163188 Ga0068851_101631881 249
265 3300005840 Ga0068870_10002573 Ga0068870_100025738 249
266 3300005840 Ga0068870_10002679 Ga0068870_100026792 249
267 3300005840 Ga0068870_10036841 Ga0068870_100368413 249
268 3300005841 Ga0068863_100033403 Ga0068863_1000334035 249
269 3300005841 Ga0068863_100134632 Ga0068863_1001346321 249
270 3300005841 Ga0068863_100321371 Ga0068863_1003213711 249
271 3300005841 Ga0068863_100733818 Ga0068863_1007338182 249
272 3300005842 Ga0068858_100611731 Ga0068858_1006117312 249
273 3300005843 Ga0068860_100004943 Ga0068860_10000494311 249
274 3300005843 Ga0068860_100014679 Ga0068860_1000146792 249
275 3300005843 Ga0068860_100024627 Ga0068860_1000246273 249
276 3300005843 Ga0068860_100032340 Ga0068860_1000323402 249
277 3300005843 Ga0068860_100076873 Ga0068860_1000768732 249
278 3300005843 Ga0068860_100128907 Ga0068860_1001289072 249
279 3300005844 Ga0068862_100011687 Ga0068862_1000116873 249
280 3300005844 Ga0068862_100145587 Ga0068862_1001455873 249
281 3300005844 Ga0068862_100157435 Ga0068862_1001574352 249
282 3300005844 Ga0068862_100544408 Ga0068862_1005444081 249
283 3300005985 Ga0081539_10000223 Ga0081539_1000022388 249
284 3300006195 Ga0075366_10019311 Ga0075366_100193112 249
285 3300006195 Ga0075366_10049342 Ga0075366_100493422 249
286 3300006195 Ga0075366_10082030 Ga0075366_100820302 249
287 3300006237 Ga0097621_100055899 Ga0097621_1000558994 249
288 3300006237 Ga0097621_100261178 Ga0097621_1002611781 249
289 3300006237 Ga0097621_100357386 Ga0097621_1003573862 249
290 3300006358 Ga0068871_100162204 Ga0068871_1001622042 249
291 3300006358 Ga0068871_100650571 Ga0068871_1006505711 249
292 3300006844 Ga0075428_100055685 Ga0075428_1000556852 249
293 3300006844 Ga0075428_100206236 Ga0075428_1002062362 249
294 3300006846 Ga0075430_100003135 Ga0075430_1000031353 249
295 3300006846 Ga0075430_100044213 Ga0075430_1000442132 249
296 3300006847 Ga0075431_100028830 Ga0075431_1000288303 249
297 3300006847 Ga0075431_100202278 Ga0075431_1002022781 249
298 3300006880 Ga0075429_100142825 Ga0075429_1001428252 249
299 3300006880 Ga0075429_100430073 Ga0075429_1004300732 249
300 3300006881 Ga0068865_100001928 Ga0068865_10000192816 249
301 3300006881 Ga0068865_100319933 Ga0068865_1003199331 249
302 3300006931 Ga0097620_100007565 Ga0097620_10000756510 249
303 3300006931 Ga0097620_100018315 Ga0097620_1000183156 249
304 3300006931 Ga0097620_100027468 Ga0097620_1000274688 249
305 3300006931 Ga0097620_100058788 Ga0097620_1000587881 249
306 3300006931 Ga0097620_100073895 Ga0097620_1000738951 249
307 3300006931 Ga0097620_100262539 Ga0097620_1002625392 249
308 3300009093 Ga0105240_10000635 Ga0105240_1000063537 249
309 3300009093 Ga0105240_10027355 Ga0105240_100273553 249
310 3300009093 Ga0105240_10030822 Ga0105240_100308223 249
311 3300009094 Ga0111539_10631839 Ga0111539_106318392 249
312 3300009094 Ga0111539_10690835 Ga0111539_106908351 249
313 3300009101 Ga0105247_10166630 Ga0105247_101666301 249
314 3300009147 Ga0114129_10187129 Ga0114129_101871292 249
315 3300009174 Ga0105241_10005738 Ga0105241_100057383 249
316 3300009174 Ga0105241_10013834 Ga0105241_100138346 249
317 3300009174 Ga0105241_10027570 Ga0105241_100275702 249
318 3300009176 Ga0105242_10166053 Ga0105242_101660531 249
319 3300009176 Ga0105242_10518713 Ga0105242_105187131 249
320 3300009176 Ga0105242_10573280 Ga0105242_105732802 249
321 3300009545 Ga0105237_10002948 Ga0105237_1000294813 249
322 3300009545 Ga0105237_10025576 Ga0105237_100255766 249
323 3300009545 Ga0105237_10027810 Ga0105237_100278106 249
324 3300009545 Ga0105237_10048270 Ga0105237_100482702 249
325 3300009551 Ga0105238_10285865 Ga0105238_102858651 249
326 3300009553 Ga0105249_10003125 Ga0105249_100031255 249
327 3300009553 Ga0105249_10003218 Ga0105249_100032189 249
328 3300009553 Ga0105249_10003898 Ga0105249_1000389810 249
329 3300009553 Ga0105249_10048552 Ga0105249_100485522 249
330 3300009553 Ga0105249_10056524 Ga0105249_100565242 249
331 3300009553 Ga0105249_10384454 Ga0105249_103844542 249
332 3300009553 Ga0105249_10502117 Ga0105249_105021171 249
333 3300009553 Ga0105249_10557101 Ga0105249_105571012 249
334 3300010375 Ga0105239_10000368 Ga0105239_1000036817 249
335 3300010375 Ga0105239_10002663 Ga0105239_1000266315 249
336 3300010375 Ga0105239_10025652 Ga0105239_100256522 249
337 3300010375 Ga0105239_10057990 Ga0105239_100579903 249
338 3300010375 Ga0105239_10094004 Ga0105239_100940044 249
339 3300011119 Ga0105246_10021224 Ga0105246_100212243 249
340 3300013100 Ga0157373_10010907 Ga0157373_100109072 249
341 3300013100 Ga0157373_10049758 Ga0157373_100497584 249
342 3300013102 Ga0157371_10000494 Ga0157371_1000049413 249
343 3300013102 Ga0157371_10001626 Ga0157371_100016263 249
344 3300013102 Ga0157371_10004069 Ga0157371_100040694 249
345 3300013102 Ga0157371_10021743 Ga0157371_100217433 249
346 3300013102 Ga0157371_10036499 Ga0157371_100364994 249
347 3300013102 Ga0157371_10039269 Ga0157371_100392694 249
348 3300013102 Ga0157371_10092646 Ga0157371_100926462 249
349 3300013102 Ga0157371_10142457 Ga0157371_101424572 249
350 3300013102 Ga0157371_10167253 Ga0157371_101672532 249
351 3300013102 Ga0157371_10255945 Ga0157371_102559451 249
352 3300013102 Ga0157371_10273071 Ga0157371_102730711 249
353 3300013102 Ga0157371_10359515 Ga0157371_103595151 249
354 3300013104 Ga0157370_10001064 Ga0157370_1000106413 249
355 3300013104 Ga0157370_10003014 Ga0157370_100030144 249
356 3300013104 Ga0157370_10008406 Ga0157370_100084066 249
357 3300013104 Ga0157370_10017114 Ga0157370_100171145 249
358 3300013104 Ga0157370_10112529 Ga0157370_101125293 249
359 3300013104 Ga0157370_10274710 Ga0157370_102747102 249
360 3300013104 Ga0157370_10378830 Ga0157370_103788302 249
361 3300013104 Ga0157370_10497403 Ga0157370_104974031 249
362 3300013105 Ga0157369_10107542 Ga0157369_101075423 249
363 3300013105 Ga0157369_10108609 Ga0157369_101086095 249
364 3300013105 Ga0157369_10160957 Ga0157369_101609574 249
365 3300013105 Ga0157369_10184327 Ga0157369_101843272 249
366 3300013105 Ga0157369_10189105 Ga0157369_101891052 249
367 3300013296 Ga0157374_10093734 Ga0157374_100937344 249
368 3300013296 Ga0157374_10100813 Ga0157374_101008134 249
369 3300013296 Ga0157374_10123860 Ga0157374_101238602 249
370 3300013296 Ga0157374_10360374 Ga0157374_103603742 249
371 3300013296 Ga0157374_10507552 Ga0157374_105075522 249
372 3300013297 Ga0157378_10048302 Ga0157378_100483023 249
373 3300013297 Ga0157378_10152519 Ga0157378_101525193 249
374 3300013297 Ga0157378_10186511 Ga0157378_101865112 249
375 3300013297 Ga0157378_10430012 Ga0157378_104300122 249
376 3300013306 Ga0163162_10009899 Ga0163162_100098999 249
377 3300013306 Ga0163162_10055575 Ga0163162_100555755 249
378 3300013306 Ga0163162_10179790 Ga0163162_101797901 249
379 3300013307 Ga0157372_10025681 Ga0157372_100256814 249
380 3300013307 Ga0157372_10030554 Ga0157372_100305545 249
381 3300013307 Ga0157372_10061345 Ga0157372_100613453 249
382 3300013307 Ga0157372_10167403 Ga0157372_101674032 249
383 3300013307 Ga0157372_10204938 Ga0157372_102049384 249
384 3300013307 Ga0157372_10238603 Ga0157372_102386032 249
385 3300013307 Ga0157372_10258301 Ga0157372_102583011 249
386 3300013307 Ga0157372_10277756 Ga0157372_102777562 249
387 3300013307 Ga0157372_10489868 Ga0157372_104898682 249
388 3300013307 Ga0157372_10637876 Ga0157372_106378762 249
389 3300013308 Ga0157375_10066346 Ga0157375_100663462 249
390 3300013308 Ga0157375_10085653 Ga0157375_100856532 249
391 3300013308 Ga0157375_10213591 Ga0157375_102135911 249
392 3300013308 Ga0157375_10409018 Ga0157375_104090182 249
393 3300013308 Ga0157375_10649109 Ga0157375_106491091 249
394 3300013308 Ga0157375_11095802 Ga0157375_110958022 249
395 3300014325 Ga0163163_10000129 Ga0163163_1000012918 249
396 3300014325 Ga0163163_10073765 Ga0163163_100737654 249
397 3300014325 Ga0163163_10266332 Ga0163163_102663322 249
398 3300014325 Ga0163163_10432658 Ga0163163_104326581 249
399 3300014325 Ga0163163_10616899 Ga0163163_106168991 249
400 3300014326 Ga0157380_10006594 Ga0157380_100065946 249
401 3300014326 Ga0157380_10013692 Ga0157380_100136922 249
402 3300014326 Ga0157380_10101656 Ga0157380_101016563 249
403 3300014326 Ga0157380_10179169 Ga0157380_101791692 249
404 3300014326 Ga0157380_10345684 Ga0157380_103456841 249
405 3300014326 Ga0157380_10540829 Ga0157380_105408291 249
406 3300014326 Ga0157380_10875646 Ga0157380_108756461 249
407 3300014745 Ga0157377_10002037 Ga0157377_100020372 249
408 3300014745 Ga0157377_10021802 Ga0157377_100218022 249
409 3300014745 Ga0157377_10160914 Ga0157377_101609142 249
410 3300014969 Ga0157376_10221588 Ga0157376_102215882 249
411 3300017792 Ga0163161_10011166 Ga0163161_100111664 249
412 3300017792 Ga0163161_10233390 Ga0163161_102333902 249
413 3300021384 Ga0213876_10012974 Ga0213876_100129745 249
414 3300021384 Ga0213876_10145600 Ga0213876_101456002 249
415 3300025246 Ga0209646_1003581 Ga0209646_10035812 249
416 3300025302 Ga0207426_1000258 Ga0207426_100025839 249
417 3300025315 Ga0207697_10009721 Ga0207697_100097212 249
418 3300025315 Ga0207697_10096383 Ga0207697_100963832 249
419 3300025315 Ga0207697_10097219 Ga0207697_100972192 249
420 3300025315 Ga0207697_10148764 Ga0207697_101487641 249
421 3300025321 Ga0207656_10230566 Ga0207656_102305661 249
422 3300025893 Ga0207682_10019790 Ga0207682_100197903 249
423 3300025893 Ga0207682_10062178 Ga0207682_100621782 249
424 3300025899 Ga0207642_10015421 Ga0207642_100154211 249
425 3300025901 Ga0207688_10010263 Ga0207688_100102634 249
426 3300025901 Ga0207688_10140019 Ga0207688_101400192 249
427 3300025904 Ga0207647_10082748 Ga0207647_100827483 249
428 3300025907 Ga0207645_10000263 Ga0207645_100002637 249
429 3300025907 Ga0207645_10052338 Ga0207645_100523382 249
430 3300025907 Ga0207645_10277725 Ga0207645_102777251 249
431 3300025908 Ga0207643_10002440 Ga0207643_100024405 249
432 3300025908 Ga0207643_10004417 Ga0207643_100044177 249
433 3300025908 Ga0207643_10054394 Ga0207643_100543942 249
434 3300025909 Ga0207705_10006172 Ga0207705_100061724 249
435 3300025909 Ga0207705_10025699 Ga0207705_100256995 249
436 3300025909 Ga0207705_10061297 Ga0207705_100612972 249
437 3300025909 Ga0207705_10091226 Ga0207705_100912262 249
438 3300025909 Ga0207705_10119881 Ga0207705_101198811 249
439 3300025911 Ga0207654_10002271 Ga0207654_100022713 249
440 3300025911 Ga0207654_10122176 Ga0207654_101221762 249
441 3300025912 Ga0207707_10108115 Ga0207707_101081152 249
442 3300025912 Ga0207707_10159871 Ga0207707_101598713 249
443 3300025913 Ga0207695_10000446 Ga0207695_1000044617 249
444 3300025913 Ga0207695_10005705 Ga0207695_100057056 249
445 3300025913 Ga0207695_10019063 Ga0207695_100190635 249
446 3300025914 Ga0207671_10005043 Ga0207671_100050438 249
447 3300025914 Ga0207671_10285209 Ga0207671_102852091 249
448 3300025914 Ga0207671_10344147 Ga0207671_103441472 249
449 3300025917 Ga0207660_10060280 Ga0207660_100602804 249
450 3300025917 Ga0207660_10069501 Ga0207660_100695013 249
451 3300025917 Ga0207660_10263135 Ga0207660_102631352 249
452 3300025918 Ga0207662_10019410 Ga0207662_100194102 249
453 3300025918 Ga0207662_10044012 Ga0207662_100440122 249
454 3300025919 Ga0207657_10004643 Ga0207657_100046431 249
455 3300025919 Ga0207657_10044524 Ga0207657_100445245 249
456 3300025919 Ga0207657_10069705 Ga0207657_100697053 249
457 3300025921 Ga0207652_10000051 Ga0207652_100000512 249
458 3300025921 Ga0207652_10000614 Ga0207652_100006144 249
459 3300025921 Ga0207652_10081187 Ga0207652_100811872 249
460 3300025921 Ga0207652_10121674 Ga0207652_101216742 249
461 3300025921 Ga0207652_10131866 Ga0207652_101318663 249
462 3300025921 Ga0207652_10477456 Ga0207652_104774561 249
463 3300025923 Ga0207681_10020407 Ga0207681_100204073 249
464 3300025923 Ga0207681_10054591 Ga0207681_100545912 249
465 3300025923 Ga0207681_10173555 Ga0207681_101735552 249
466 3300025923 Ga0207681_10260147 Ga0207681_102601472 249
467 3300025923 Ga0207681_10447651 Ga0207681_104476511 249
468 3300025925 Ga0207650_10200290 Ga0207650_102002902 249
469 3300025925 Ga0207650_10213972 Ga0207650_102139722 249
470 3300025926 Ga0207659_10043227 Ga0207659_100432273 249
471 3300025926 Ga0207659_10171793 Ga0207659_101717931 249
472 3300025932 Ga0207690_10164783 Ga0207690_101647833 249
473 3300025933 Ga0207706_10191384 Ga0207706_101913842 249
474 3300025933 Ga0207706_10738248 Ga0207706_107382481 249
475 3300025934 Ga0207686_10020142 Ga0207686_100201421 249
476 3300025936 Ga0207670_10037112 Ga0207670_100371122 249
477 3300025936 Ga0207670_10364496 Ga0207670_103644962 249
478 3300025936 Ga0207670_10438822 Ga0207670_104388221 249
479 3300025937 Ga0207669_10033202 Ga0207669_100332022 249
480 3300025938 Ga0207704_10046681 Ga0207704_100466811 249
481 3300025940 Ga0207691_10003243 Ga0207691_1000324314 249
482 3300025940 Ga0207691_10010867 Ga0207691_100108674 249
483 3300025940 Ga0207691_10205216 Ga0207691_102052162 249
484 3300025942 Ga0207689_10007704 Ga0207689_100077048 249
485 3300025942 Ga0207689_10018354 Ga0207689_100183545 249
486 3300025942 Ga0207689_10301673 Ga0207689_103016731 249
487 3300025942 Ga0207689_10509746 Ga0207689_105097461 249
488 3300025944 Ga0207661_10033063 Ga0207661_100330632 249
489 3300025949 Ga0207667_10000150 Ga0207667_1000015058 249
490 3300025949 Ga0207667_10024155 Ga0207667_100241555 249
491 3300025949 Ga0207667_10062837 Ga0207667_100628373 249
492 3300025949 Ga0207667_10324314 Ga0207667_103243142 249
493 3300025960 Ga0207651_10036208 Ga0207651_100362083 249
494 3300025960 Ga0207651_10194519 Ga0207651_101945191 249
495 3300025960 Ga0207651_10264242 Ga0207651_102642422 249
496 3300025960 Ga0207651_10333861 Ga0207651_103338612 249
497 3300025961 Ga0207712_10001366 Ga0207712_100013664 249
498 3300025961 Ga0207712_10009499 Ga0207712_100094992 249
499 3300025961 Ga0207712_10023399 Ga0207712_100233995 249
500 3300025961 Ga0207712_10026721 Ga0207712_100267212 249
501 3300025972 Ga0207668_10031257 Ga0207668_100312572 249
502 3300025972 Ga0207668_10044922 Ga0207668_100449223 249
503 3300025972 Ga0207668_10102538 Ga0207668_101025382 249
504 3300025972 Ga0207668_10540995 Ga0207668_105409952 249
505 3300025981 Ga0207640_10334023 Ga0207640_103340231 249
506 3300025981 Ga0207640_10479294 Ga0207640_104792941 249
507 3300025981 Ga0207640_10520082 Ga0207640_105200821 249
508 3300025986 Ga0207658_10103400 Ga0207658_101034001 249
509 3300025986 Ga0207658_10602197 Ga0207658_106021971 249
510 3300025986 Ga0207658_10684404 Ga0207658_106844041 249
511 3300026023 Ga0207677_10631056 Ga0207677_106310561 249
512 3300026035 Ga0207703_10603213 Ga0207703_106032131 249
513 3300026041 Ga0207639_10006001 Ga0207639_100060017 249
514 3300026041 Ga0207639_10119917 Ga0207639_101199172 249
515 3300026041 Ga0207639_10861182 Ga0207639_108611821 249
516 3300026078 Ga0207702_10200284 Ga0207702_102002842 249
517 3300026088 Ga0207641_10001405 Ga0207641_100014055 249
518 3300026088 Ga0207641_10090858 Ga0207641_100908581 249
519 3300026088 Ga0207641_10378379 Ga0207641_103783792 249
520 3300026088 Ga0207641_10487497 Ga0207641_104874972 249
521 3300026089 Ga0207648_10002644 Ga0207648_100026444 249
522 3300026095 Ga0207676_10261190 Ga0207676_102611902 249
523 3300026095 Ga0207676_10353591 Ga0207676_103535912 249
524 3300026095 Ga0207676_10441505 Ga0207676_104415052 249
525 3300026116 Ga0207674_10001856 Ga0207674_100018564 249
526 3300026116 Ga0207674_10053595 Ga0207674_100535952 249
527 3300026116 Ga0207674_10077852 Ga0207674_100778521 249
528 3300026116 Ga0207674_10181400 Ga0207674_101814002 249
529 3300026118 Ga0207675_100003498 Ga0207675_1000034987 249
530 3300026118 Ga0207675_100006997 Ga0207675_1000069974 249
531 3300026118 Ga0207675_100011111 Ga0207675_10001111111 249
532 3300026118 Ga0207675_100136537 Ga0207675_1001365371 249
533 3300026118 Ga0207675_100836763 Ga0207675_1008367632 249
534 3300026121 Ga0207683_10000943 Ga0207683_1000094316 249
535 3300026121 Ga0207683_10215994 Ga0207683_102159941 249
536 3300026121 Ga0207683_10285839 Ga0207683_102858392 249
537 3300026142 Ga0207698_10004744 Ga0207698_100047441 249
538 3300026142 Ga0207698_10025059 Ga0207698_100250592 249
539 3300026142 Ga0207698_10319375 Ga0207698_103193752 249
540 3300026142 Ga0207698_10861439 Ga0207698_108614391 249
541 3300027907 Ga0207428_10470496 Ga0207428_104704961 249
542 3300028379 Ga0268266_10398009 Ga0268266_103980092 249
543 3300028380 Ga0268265_10016719 Ga0268265_100167194 249
544 3300028380 Ga0268265_10116090 Ga0268265_101160902 249
545 3300028380 Ga0268265_10221874 Ga0268265_102218742 249
546 3300028380 Ga0268265_10224769 Ga0268265_102247691 249
547 3300028381 Ga0268264_10036247 Ga0268264_100362473 249
548 3300028381 Ga0268264_10046441 Ga0268264_100464412 249
549 3300028381 Ga0268264_10190068 Ga0268264_101900682 249
550 3300028381 Ga0268264_10351178 Ga0268264_103511782 249
551 3300028786 Ga0307517_10107496 Ga0307517_101074963 249
552 3300030522 Ga0307512_10139691 Ga0307512_101396912 249
553 3300031251 Ga0265327_10000148 Ga0265327_1000014862 249
554 3300031251 Ga0265327_10006106 Ga0265327_100061062 249
555 3300031251 Ga0265327_10089082 Ga0265327_100890822 249
556 3300031251 Ga0265327_10091403 Ga0265327_100914032 249
557 3300031456 Ga0307513_10125869 Ga0307513_101258692 249
558 3300031507 Ga0307509_10167093 Ga0307509_101670932 249
559 3300031595 Ga0265313_10012879 Ga0265313_100128795 249
560 3300031730 Ga0307516_10165356 Ga0307516_101653562 249
561 3300031730 Ga0307516_10224045 Ga0307516_102240452 249
562 3300032005 Ga0307411_10253122 Ga0307411_102531222 249
563 3300033180 Ga0307510_10000042 Ga0307510_1000004232 249
564 3300035695 Ga0373927_0215912 Ga0373927_0215912_419_1168 249
565 3300037068 Ga0373925_0172357 Ga0373925_0172357_318_1067 249
566 3300037312 Ga0395899_0007352 Ga0395899_0007352_4122_4877 249
567 3300037312 Ga0395899_0011758 Ga0395899_0011758_2837_3592 249
568 3300037312 Ga0395899_0068454 Ga0395899_0068454_1815_2570 249
569 3300037312 Ga0395899_0110249 Ga0395899_0110249_227_982 249
570 3300037418 Ga0395900_0016503 Ga0395900_0016503_5750_6505 249
571 3300037418 Ga0395900_0046549 Ga0395900_0046549_584_1462 249
572 3300037418 Ga0395900_0114897 Ga0395900_0114897_321_1076 249
573 3300037418 Ga0395900_0160845 Ga0395900_0160845_436_1191 249
574 3300037418 Ga0395900_0170725 Ga0395900_0170725_1184_1939 249
575 3300037418 Ga0395900_0717142 Ga0395900_0717142_116_871 249
576 3300037466 Ga0395898_0001425 Ga0395898_0001425_28599_29354 249
577 3300037466 Ga0395898_0034774 Ga0395898_0034774_2854_3609 249
578 3300037466 Ga0395898_0073958 Ga0395898_0073958_2166_2921 249
579 3300037466 Ga0395898_0091609 Ga0395898_0091609_1988_2743 249
580 3300037466 Ga0395898_0203725 Ga0395898_0203725_365_1243 249
581 3300037471 Ga0395905_0004544 Ga0395905_0004544_106_855 249
582 3300037471 Ga0395905_0020976 Ga0395905_0020976_3747_4496 249
583 3300037471 Ga0395905_0067486 Ga0395905_0067486_1668_2423 249
584 3300038443 Ga0395901_0006414 Ga0395901_0006414_9810_10565 249
585 3300038443 Ga0395901_0037225 Ga0395901_0037225_4119_4874 249
586 3300038443 Ga0395901_0240064 Ga0395901_0240064_979_1734 249
587 3300038443 Ga0395901_0302386 Ga0395901_0302386_392_1147 249
588 3300039437 Ga0436365_0153361 Ga0436365_0153361_257_1009 249
589 3300039437 Ga0436365_0169461 Ga0436365_0169461_1192_1944 249
590 3300039437 Ga0436365_0298838 Ga0436365_0298838_3009_3764 249
591 3300039437 Ga0436365_1415753 Ga0436365_1415753_1523_2272 249
592 3300041404 Ga0439436_0005974 Ga0439436_0005974_2562_3311 249
593 3300041413 Ga0439465_0011935 Ga0439465_0011935_1162_1911 249
594 3300041451 Ga0451791_0456665 Ga0451791_0456665_697_1446 249
595 3300041486 Ga0451807_1365644 Ga0451807_1365644_184_933 249
596 3300041505 Ga0451849_0299315 Ga0451849_0299315_47_796 249
597 3300041997 Ga0439431_0011275 Ga0439431_0011275_741_1490 249
598 3300042002 Ga0439442_008572 Ga0439442_008572_1246_1995 249
599 3300042004 Ga0439445_0005014 Ga0439445_0005014_416_1165 249
600 3300042007 Ga0439449_0005127 Ga0439449_0005127_647_1396 249
601 3300042007 Ga0439449_0019046 Ga0439449_0019046_52_801 249
602 3300042007 Ga0439449_0059046 Ga0439449_0059046_146_895 249
603 3300042014 Ga0439457_000452 Ga0439457_000452_2436_3185 249
604 3300042014 Ga0439457_018898 Ga0439457_018898_750_1499 249
605 3300042015 Ga0439462_0028840 Ga0439462_0028840_555_1304 249
606 3300044656 Ga0466969_0000082 Ga0466969_0000082_43289_44038 249
607 3300044658 Ga0466972_0000226 Ga0466972_0000226_38541_39290 249
608 3300044673 Ga0453683_0144086 Ga0453683_0144086_157_906 249
609 3300044684 Ga0466966_0000162 Ga0466966_0000162_5443_6192 249
610 3300044693 Ga0466961_0257819 Ga0466961_0257819_250_999 249
611 3300044706 Ga0466964_0023681 Ga0466964_0023681_1160_1912 249
612 3300044712 Ga0453684_0068125 Ga0453684_0068125_970_1728 249
613 3300044712 Ga0453684_1173423 Ga0453684_1173423_21_776 249
614 3300044735 Ga0466968_0010921 Ga0466968_0010921_1697_2446 249
615 3300044735 Ga0466968_0182869 Ga0466968_0182869_185_937 249
616 3300044842 Ga0466957_0000673 Ga0466957_0000673_9142_9894 249
617 3300044901 Ga0466960_0122825 Ga0466960_0122825_198_947 249
618 3300045049 Ga0466959_0000077 Ga0466959_0000077_12487_13236 249
619 3300045976 Ga0466967_0520304 Ga0466967_0520304_41_793 249
620 3300046499 Ga0495594_0127585 Ga0495594_0127585_311_1060 249
621 3300046507 Ga0495606_0005751 Ga0495606_0005751_4466_5218 249
622 3300046522 Ga0495643_0038623 Ga0495643_0038623_305_1054 249
623 3300046537 Ga0495598_0105781 Ga0495598_0105781_77_826 249
624 3300046543 Ga0495645_0102790 Ga0495645_0102790_1181_1936 249
625 3300046616 Ga0495668_0003042 Ga0495668_0003042_4949_5704 249
626 3300046648 Ga0495611_0000011 Ga0495611_0000011_114239_114991 249
627 3300047318 Ga0495636_0128017 Ga0495636_0128017_113_862 249
628 3300047320 Ga0495672_0012712 Ga0495672_0012712_846_1595 249
629 3300047472 Ga0495686_0016543 Ga0495686_0016543_611_1360 249
630 3300049569 Ga0501032_0011965 Ga0501032_0011965_5438_6187 249
631 3300049569 Ga0501032_0034263 Ga0501032_0034263_1214_1963 249
632 3300049570 Ga0501033_0010920 Ga0501033_0010920_1677_2426 249
633 3300049571 Ga0501034_0007951 Ga0501034_0007951_2772_3521 249
634 3300049571 Ga0501034_0014056 Ga0501034_0014056_5161_5913 249
635 3300049571 Ga0501034_0020625 Ga0501034_0020625_2767_3612 249
636 3300049571 Ga0501034_0024371 Ga0501034_0024371_5068_5823 249
637 3300049571 Ga0501034_0040672 Ga0501034_0040672_179_928 249
638 3300049571 Ga0501034_0834615 Ga0501034_0834615_42_791 249
639 3300049572 Ga0501036_0058612 Ga0501036_0058612_1426_2175 249
640 3300049572 Ga0501036_0605010 Ga0501036_0605010_140_895 249
641 3300049572 Ga0501036_0682384 Ga0501036_0682384_71_820 249
642 3300049573 Ga0501037_0017921 Ga0501037_0017921_3300_4049 249
643 3300049573 Ga0501037_0029493 Ga0501037_0029493_39_788 249
644 3300049573 Ga0501037_0138975 Ga0501037_0138975_87_842 249
645 3300049573 Ga0501037_0201350 Ga0501037_0201350_597_1346 249
646 3300049574 Ga0501038_0063668 Ga0501038_0063668_975_1724 249
647 3300049579 Ga0501043_0025587 Ga0501043_0025587_2449_3198 249
648 3300049579 Ga0501043_0530827 Ga0501043_0530827_32_781 249
649 3300049581 Ga0501047_0010456 Ga0501047_0010456_6776_7525 249
650 3300049581 Ga0501047_0014516 Ga0501047_0014516_5351_6100 249
651 3300049581 Ga0501047_0071661 Ga0501047_0071661_1102_1851 249
652 3300049581 Ga0501047_0340047 Ga0501047_0340047_289_1038 249
653 3300049582 Ga0501048_0037369 Ga0501048_0037369_1568_2317 249
654 3300049583 Ga0501067_0031611 Ga0501067_0031611_927_1676 249
655 3300049586 Ga0501070_0043109 Ga0501070_0043109_566_1411 249
656 3300049586 Ga0501070_0064010 Ga0501070_0064010_1449_2198 249
657 3300049589 Ga0501073_0094626 Ga0501073_0094626_513_1262 249
658 3300049589 Ga0501073_0365422 Ga0501073_0365422_34_783 249
659 3300049590 Ga0501074_0012848 Ga0501074_0012848_969_1718 249
660 3300049669 Ga0501235_033679 Ga0501235_033679_361_1110 249
661 3300049703 Ga0501219_000096 Ga0501219_000096_4426_5175 249
662 3300049705 Ga0501225_0005775 Ga0501225_0005775_446_1195 249
663 3300049741 Ga0501079_0211643 Ga0501079_0211643_701_1450 249
664 3300049742 Ga0501080_0206677 Ga0501080_0206677_292_1041 249
665 3300049822 Ga0501035_0017551 Ga0501035_0017551_3618_4373 249
666 3300049822 Ga0501035_0020579 Ga0501035_0020579_4926_5675 249
667 3300049822 Ga0501035_0034818 Ga0501035_0034818_2228_2977 249
668 3300049822 Ga0501035_0071998 Ga0501035_0071998_1113_1862 249
669 3300049823 Ga0501044_0024861 Ga0501044_0024861_2230_2979 249
670 3300049823 Ga0501044_0126575 Ga0501044_0126575_194_949 249
671 3300049823 Ga0501044_0131607 Ga0501044_0131607_110_859 249
672 3300049823 Ga0501044_0184568 Ga0501044_0184568_475_1224 249
673 3300049823 Ga0501044_0379902 Ga0501044_0379902_466_1311 249
674 3300049823 Ga0501044_0605743 Ga0501044_0605743_69_824 249
675 3300050005 Ga0501284_00101 Ga0501284_00101_14252_15001 249
676 3300050493 nmdc:mga0k408_1636_c1 nmdc:mga0k408_1636_c1_3297_4046 249
677 3300050508 nmdc:mga09592_165397_c1 nmdc:mga09592_165397_c1_997_1746 249
678 3300050508 nmdc:mga09592_210214_c1 nmdc:mga09592_210214_c1_375_1124 249
679 3300050509 nmdc:mga0qj67_10091_c1 nmdc:mga0qj67_10091_c1_1372_2121 249
680 3300050509 nmdc:mga0qj67_80584_c1 nmdc:mga0qj67_80584_c1_1326_2075 249
681 3300050511 nmdc:mga08y16_301704_c1 nmdc:mga08y16_301704_c1_887_1639 249
682 3300050511 nmdc:mga08y16_776412_c1 nmdc:mga08y16_776412_c1_53_802 249
683 3300053086 Ga0500578_0008966 Ga0500578_0008966_3748_4497 249
684 3300053086 Ga0500578_0010664 Ga0500578_0010664_4950_5699 249
685 3300053090 Ga0500646_0041006 Ga0500646_0041006_282_1031 249
686 3300053092 Ga0500583_0000180 Ga0500583_0000180_3850_4599 249
687 3300053092 Ga0500583_0006538 Ga0500583_0006538_2130_2879 249
688 3300053092 Ga0500583_0147196 Ga0500583_0147196_11_769 249
689 3300053103 Ga0500555_027869 Ga0500555_027869_446_1195 249
690 3300053136 Ga0500559_0020352 Ga0500559_0020352_544_1299 249
691 3300053146 Ga0500588_0008405 Ga0500588_0008405_715_1464 249
692 3300053151 Ga0500604_0009128 Ga0500604_0009128_874_1632 249
693 3300053151 Ga0500604_0050660 Ga0500604_0050660_184_933 249
694 3300053153 Ga0500616_0073222 Ga0500616_0073222_229_978 249
695 3300053153 Ga0500616_0145608 Ga0500616_0145608_30_779 249
696 3300053156 Ga0500622_0087709 Ga0500622_0087709_263_1021 249
697 3300053156 Ga0500622_0104811 Ga0500622_0104811_568_1317 249
698 3300053177 Ga0500636_0237655 Ga0500636_0237655_34_783 249
699 3300053727 Ga0500611_000002 Ga0500611_000002_86926_87675 249
700 3300054114 Ga0501084_0585202 Ga0501084_0585202_142_891 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

49

103

0.99

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

48

105

0.98

PF12844

HTH_19

Helix-turn-helix domain

46

107

0.97

PF13560

HTH_31

Helix-turn-helix domain

44

105

0.94

PF00717

Peptidase_S24

Peptidase S24-like

134

258

0.69

Feature Viewer

pLDDT pTM Quality
76.14 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map