F476091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 259 | 698 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10091226|Ga0207705_100912262 |
| Length | 292 |
| Sequence | LQNGFNLIFLFPGYFYFFQKNKKIFDRTNLISIFGLNKLVTMSLAGQNLKYLRKLRGWTQEEFAAKLRIKRSLIGAYEEERADPRLEVLETISQIFKVTLDELLLQDMSVVTGSSYLAKRRQMKMMNADRNVIHFVPVKAAAGYLAGYADSEFIDELNTFTLPMLSGGSYRAFEIIGDSMMPTPSGSVIVGEKIENMDSVKNNATYIVVSKSEGIVYKRVVKNNKNKNKLTLVSDNPSFQPYQVQMADVLEMWQAQAVINKVTQHQRWDVDSLVNLVSNLQDQVSSLKKKMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 194 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 234 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 235 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 241 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 248 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 249 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 253 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 254 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.57 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 91.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1004410 | 3300000545 | Unclassified | 993 |
| 2 | JGI24740J21852_10033782 | 3300001979 | Bacteria | 1618 |
| 3 | JGI24033J26618_1009290 | 3300002155 | Bacteria | 1142 |
| 4 | JGI25406J46586_10001082 | 3300003203 | Bacteria | 12780 |
| 5 | rootH1_10012510 | 3300003316 | Bacteria | 8478 |
| 6 | rootH2_10008764 | 3300003320 | Bacteria | 25286 |
| 7 | rootH2_10022558 | 3300003320 | Bacteria | 3001 |
| 8 | rootH2_10077251 | 3300003320 | Bacteria | 5116 |
| 9 | rootH2_10241788 | 3300003320 | Bacteria | 1318 |
| 10 | rootH2_10265827 | 3300003320 | Bacteria | 2346 |
| 11 | rootL2_10035418 | 3300003322 | Bacteria | 2424 |
| 12 | rootL2_10047293 | 3300003322 | Bacteria | 2836 |
| 13 | rootL2_10184333 | 3300003322 | Bacteria | 2560 |
| 14 | rootL2_10252239 | 3300003322 | Bacteria | 2215 |
| 15 | rootH1_10033150 | 3300003323 | Bacteria | 4234 |
| 16 | rootH1_10033151 | 3300003323 | Bacteria | 22992 |
| 17 | JGI25160J50197_1000265 | 3300003354 | Bacteria | 39530 |
| 18 | Ga0065714_10142125 | 3300005288 | Bacteria | 1164 |
| 19 | Ga0065712_10007433 | 3300005290 | Bacteria | 2398 |
| 20 | Ga0065712_10009117 | 3300005290 | Bacteria | 3822 |
| 21 | Ga0065712_10013245 | 3300005290 | Bacteria | 3298 |
| 22 | Ga0065712_10104013 | 3300005290 | Bacteria | 1971 |
| 23 | Ga0065715_10004611 | 3300005293 | Bacteria | 4272 |
| 24 | Ga0065715_10034333 | 3300005293 | Bacteria | 1859 |
| 25 | Ga0065715_10212873 | 3300005293 | Bacteria | 1283 |
| 26 | Ga0065715_10396081 | 3300005293 | Unclassified | 888 |
| 27 | Ga0065707_10010710 | 3300005295 | Bacteria | 6212 |
| 28 | Ga0065707_10324906 | 3300005295 | Unclassified | 949 |
| 29 | Ga0070658_10018351 | 3300005327 | Bacteria | 5601 |
| 30 | Ga0070658_10040671 | 3300005327 | Bacteria | 3751 |
| 31 | Ga0070658_10056084 | 3300005327 | Bacteria | 3201 |
| 32 | Ga0070658_10078815 | 3300005327 | Bacteria | 2704 |
| 33 | Ga0070658_10185797 | 3300005327 | Bacteria | 1750 |
| 34 | Ga0070676_10003200 | 3300005328 | Bacteria | 8493 |
| 35 | Ga0070676_10045907 | 3300005328 | Unclassified | 2546 |
| 36 | Ga0070683_100006418 | 3300005329 | Bacteria | 9863 |
| 37 | Ga0070683_100033650 | 3300005329 | Bacteria | 4675 |
| 38 | Ga0070683_100354476 | 3300005329 | Bacteria | 1397 |
| 39 | Ga0070683_100359807 | 3300005329 | Unclassified | 1386 |
| 40 | Ga0070690_100048040 | 3300005330 | Bacteria | 2717 |
| 41 | Ga0070690_100097057 | 3300005330 | Bacteria | 1949 |
| 42 | Ga0070670_100242799 | 3300005331 | Bacteria | 1568 |
| 43 | Ga0070677_10102586 | 3300005333 | Bacteria | 1264 |
| 44 | Ga0068869_100005681 | 3300005334 | Bacteria | 7866 |
| 45 | Ga0068869_100011037 | 3300005334 | Bacteria | 5917 |
| 46 | Ga0068869_100074809 | 3300005334 | Bacteria | 2515 |
| 47 | Ga0068869_100100089 | 3300005334 | Bacteria | 2191 |
| 48 | Ga0068869_100207709 | 3300005334 | Unclassified | 1547 |
| 49 | Ga0068869_100369350 | 3300005334 | Bacteria | 1173 |
| 50 | Ga0070666_10000108 | 3300005335 | Bacteria | 56931 |
| 51 | Ga0070666_10005443 | 3300005335 | Bacteria | 7806 |
| 52 | Ga0070680_100004884 | 3300005336 | Bacteria | 10095 |
| 53 | Ga0070680_100005000 | 3300005336 | Bacteria | 9990 |
| 54 | Ga0070680_100006348 | 3300005336 | Bacteria | 8976 |
| 55 | Ga0070680_100065505 | 3300005336 | Bacteria | 2977 |
| 56 | Ga0070680_100174801 | 3300005336 | Bacteria | 1808 |
| 57 | Ga0070682_100000044 | 3300005337 | Bacteria | 133653 |
| 58 | Ga0070682_100030518 | 3300005337 | Unclassified | 3255 |
| 59 | Ga0070682_100065804 | 3300005337 | Unclassified | 2304 |
| 60 | Ga0070682_100281747 | 3300005337 | Bacteria | 1212 |
| 61 | Ga0068868_100016265 | 3300005338 | Bacteria | 5520 |
| 62 | Ga0070660_100001860 | 3300005339 | Bacteria | 14529 |
| 63 | Ga0070660_100052194 | 3300005339 | Bacteria | 3151 |
| 64 | Ga0070660_100062334 | 3300005339 | Bacteria | 2896 |
| 65 | Ga0070660_100111324 | 3300005339 | Unclassified | 2178 |
| 66 | Ga0070689_100027434 | 3300005340 | Unclassified | 4293 |
| 67 | Ga0070689_100126179 | 3300005340 | Bacteria | 2048 |
| 68 | Ga0070687_100026323 | 3300005343 | Unclassified | 2800 |
| 69 | Ga0070687_100070111 | 3300005343 | Unclassified | 1879 |
| 70 | Ga0070687_100328840 | 3300005343 | Bacteria | 979 |
| 71 | Ga0070687_100426268 | 3300005343 | Bacteria | 876 |
| 72 | Ga0070661_100579417 | 3300005344 | Bacteria | 905 |
| 73 | Ga0070668_100023358 | 3300005347 | Bacteria | 4677 |
| 74 | Ga0070668_100095877 | 3300005347 | Unclassified | 2344 |
| 75 | Ga0070668_100245019 | 3300005347 | Bacteria | 1486 |
| 76 | Ga0070668_100298307 | 3300005347 | Bacteria | 1351 |
| 77 | Ga0070669_100003025 | 3300005353 | Bacteria | 12090 |
| 78 | Ga0070669_100006016 | 3300005353 | Bacteria | 8750 |
| 79 | Ga0070669_100019749 | 3300005353 | Bacteria | 4814 |
| 80 | Ga0070669_100106011 | 3300005353 | Unclassified | 2127 |
| 81 | Ga0070669_100197503 | 3300005353 | Unclassified | 1581 |
| 82 | Ga0070669_100248187 | 3300005353 | Bacteria | 1417 |
| 83 | Ga0070675_100005755 | 3300005354 | Bacteria | 9482 |
| 84 | Ga0070675_100022774 | 3300005354 | Bacteria | 5005 |
| 85 | Ga0070675_100229698 | 3300005354 | Bacteria | 1618 |
| 86 | Ga0070671_100183300 | 3300005355 | Bacteria | 1773 |
| 87 | Ga0070671_100282748 | 3300005355 | Bacteria | 1411 |
| 88 | Ga0070674_100025842 | 3300005356 | Bacteria | 3827 |
| 89 | Ga0070674_100418666 | 3300005356 | Bacteria | 1098 |
| 90 | Ga0070673_100020510 | 3300005364 | Bacteria | 4768 |
| 91 | Ga0070673_100029789 | 3300005364 | Bacteria | 4075 |
| 92 | Ga0070673_100030274 | 3300005364 | Bacteria | 4047 |
| 93 | Ga0070673_100037299 | 3300005364 | Bacteria | 3702 |
| 94 | Ga0070673_100046319 | 3300005364 | Bacteria | 3377 |
| 95 | Ga0070673_100110690 | 3300005364 | Unclassified | 2277 |
| 96 | Ga0070688_100097292 | 3300005365 | Bacteria | 1934 |
| 97 | Ga0070688_100205700 | 3300005365 | Bacteria | 1379 |
| 98 | Ga0070688_100330992 | 3300005365 | Bacteria | 1109 |
| 99 | Ga0070659_100011028 | 3300005366 | Bacteria | 6675 |
| 100 | Ga0070659_100018722 | 3300005366 | Bacteria | 5228 |
| 101 | Ga0070659_100052418 | 3300005366 | Unclassified | 3209 |
| 102 | Ga0070667_100689315 | 3300005367 | Bacteria | 945 |
| 103 | Ga0070667_100694800 | 3300005367 | Bacteria | 941 |
| 104 | Ga0070663_100008886 | 3300005455 | Bacteria | 6203 |
| 105 | Ga0070678_100007906 | 3300005456 | Bacteria | 6330 |
| 106 | Ga0070678_100524434 | 3300005456 | Bacteria | 1048 |
| 107 | Ga0070662_100010256 | 3300005457 | Bacteria | 6142 |
| 108 | Ga0070681_10012148 | 3300005458 | Bacteria | 8541 |
| 109 | Ga0070681_10042870 | 3300005458 | Bacteria | 4534 |
| 110 | Ga0068867_100167406 | 3300005459 | Unclassified | 1738 |
| 111 | Ga0070685_10253042 | 3300005466 | Bacteria | 1168 |
| 112 | Ga0070698_100002094 | 3300005471 | Bacteria | 22141 |
| 113 | Ga0070698_100006624 | 3300005471 | Bacteria | 12560 |
| 114 | Ga0070698_100024951 | 3300005471 | Bacteria | 6231 |
| 115 | Ga0070698_100089771 | 3300005471 | Bacteria | 3057 |
| 116 | Ga0070699_100262423 | 3300005518 | Bacteria | 1545 |
| 117 | Ga0070699_100529154 | 3300005518 | Bacteria | 1072 |
| 118 | Ga0070679_100000634 | 3300005530 | Bacteria | 29900 |
| 119 | Ga0070679_100016556 | 3300005530 | Bacteria | 7117 |
| 120 | Ga0070679_100036052 | 3300005530 | Unclassified | 4908 |
| 121 | Ga0070679_100056862 | 3300005530 | Bacteria | 3898 |
| 122 | Ga0070679_100084605 | 3300005530 | Bacteria | 3160 |
| 123 | Ga0068853_100000245 | 3300005539 | Bacteria | 38110 |
| 124 | Ga0068853_100035695 | 3300005539 | Unclassified | 4224 |
| 125 | Ga0068853_100091375 | 3300005539 | Bacteria | 2677 |
| 126 | Ga0068853_100218982 | 3300005539 | Bacteria | 1738 |
| 127 | Ga0068853_100275596 | 3300005539 | Bacteria | 1550 |
| 128 | Ga0068853_100353874 | 3300005539 | Bacteria | 1367 |
| 129 | Ga0068853_100379252 | 3300005539 | Bacteria | 1320 |
| 130 | Ga0070672_100008700 | 3300005543 | Bacteria | 6963 |
| 131 | Ga0070672_100296941 | 3300005543 | Bacteria | 1369 |
| 132 | Ga0070672_100609170 | 3300005543 | Unclassified | 952 |
| 133 | Ga0070693_100428876 | 3300005547 | Bacteria | 923 |
| 134 | Ga0070704_100365544 | 3300005549 | Bacteria | 1222 |
| 135 | Ga0068855_100011433 | 3300005563 | Bacteria | 10723 |
| 136 | Ga0068855_100027170 | 3300005563 | Bacteria | 6847 |
| 137 | Ga0068855_100037472 | 3300005563 | Bacteria | 5765 |
| 138 | Ga0068855_100074116 | 3300005563 | Bacteria | 3954 |
| 139 | Ga0068855_100089553 | 3300005563 | Bacteria | 3552 |
| 140 | Ga0068855_100158566 | 3300005563 | Bacteria | 2569 |
| 141 | Ga0070664_100135290 | 3300005564 | Unclassified | 2167 |
| 142 | Ga0070664_100802129 | 3300005564 | Bacteria | 880 |
| 143 | Ga0068857_100039907 | 3300005577 | Unclassified | 4161 |
| 144 | Ga0068857_100203049 | 3300005577 | Bacteria | 1807 |
| 145 | Ga0068857_100247614 | 3300005577 | Unclassified | 1633 |
| 146 | Ga0068854_100206141 | 3300005578 | Bacteria | 1548 |
| 147 | Ga0068854_100403259 | 3300005578 | Bacteria | 1132 |
| 148 | Ga0068854_100425054 | 3300005578 | Unclassified | 1104 |
| 149 | Ga0068856_100006856 | 3300005614 | Bacteria | 11140 |
| 150 | Ga0068856_100100400 | 3300005614 | Bacteria | 2886 |
| 151 | Ga0068856_100119384 | 3300005614 | Bacteria | 2638 |
| 152 | Ga0068856_100745300 | 3300005614 | Bacteria | 999 |
| 153 | Ga0070702_100251574 | 3300005615 | Bacteria | 1198 |
| 154 | Ga0068852_100032072 | 3300005616 | Bacteria | 4346 |
| 155 | Ga0068852_100186643 | 3300005616 | Bacteria | 1953 |
| 156 | Ga0068852_100302781 | 3300005616 | Bacteria | 1548 |
| 157 | Ga0068852_100420885 | 3300005616 | Bacteria | 1318 |
| 158 | Ga0068852_100431596 | 3300005616 | Unclassified | 1301 |
| 159 | Ga0068859_100000029 | 3300005617 | Bacteria | 178422 |
| 160 | Ga0068859_100007565 | 3300005617 | Bacteria | 11034 |
| 161 | Ga0068859_100018315 | 3300005617 | Bacteria | 7040 |
| 162 | Ga0068859_100027468 | 3300005617 | Bacteria | 5707 |
| 163 | Ga0068859_100039091 | 3300005617 | Bacteria | 4759 |
| 164 | Ga0068859_100058782 | 3300005617 | Bacteria | 3873 |
| 165 | Ga0068859_100073894 | 3300005617 | Bacteria | 3448 |
| 166 | Ga0068859_100262553 | 3300005617 | Unclassified | 1818 |
| 167 | Ga0068864_100009388 | 3300005618 | Bacteria | 8069 |
| 168 | Ga0068864_100026182 | 3300005618 | Unclassified | 4917 |
| 169 | Ga0068864_100117451 | 3300005618 | Bacteria | 2374 |
| 170 | Ga0068864_100399788 | 3300005618 | Bacteria | 1305 |
| 171 | Ga0068864_100549346 | 3300005618 | Bacteria | 1116 |
| 172 | Ga0068864_100960300 | 3300005618 | Bacteria | 846 |
| 173 | Ga0068866_10063525 | 3300005718 | Bacteria | 1925 |
| 174 | Ga0068861_100008514 | 3300005719 | Bacteria | 7062 |
| 175 | Ga0068861_100016996 | 3300005719 | Bacteria | 5159 |
| 176 | Ga0068861_100055850 | 3300005719 | Bacteria | 3012 |
| 177 | Ga0068861_100222400 | 3300005719 | Bacteria | 1596 |
| 178 | Ga0068851_10163188 | 3300005834 | Bacteria | 1225 |
| 179 | Ga0068870_10002573 | 3300005840 | Bacteria | 7587 |
| 180 | Ga0068870_10002679 | 3300005840 | Bacteria | 7457 |
| 181 | Ga0068870_10036841 | 3300005840 | Unclassified | 2518 |
| 182 | Ga0068863_100033403 | 3300005841 | Bacteria | 4901 |
| 183 | Ga0068863_100134632 | 3300005841 | Bacteria | 2361 |
| 184 | Ga0068863_100321371 | 3300005841 | Bacteria | 1503 |
| 185 | Ga0068863_100733818 | 3300005841 | Bacteria | 983 |
| 186 | Ga0068858_100011366 | 3300005842 | Bacteria | 8407 |
| 187 | Ga0068858_100611731 | 3300005842 | Bacteria | 1057 |
| 188 | Ga0068860_100000888 | 3300005843 | Bacteria | 33230 |
| 189 | Ga0068860_100004943 | 3300005843 | Bacteria | 13587 |
| 190 | Ga0068860_100014679 | 3300005843 | Bacteria | 7663 |
| 191 | Ga0068860_100024627 | 3300005843 | Bacteria | 5812 |
| 192 | Ga0068860_100032340 | 3300005843 | Bacteria | 5026 |
| 193 | Ga0068860_100076873 | 3300005843 | Bacteria | 3174 |
| 194 | Ga0068860_100128907 | 3300005843 | Unclassified | 2426 |
| 195 | Ga0068860_100400647 | 3300005843 | Bacteria | 1357 |
| 196 | Ga0068862_100011687 | 3300005844 | Bacteria | 7244 |
| 197 | Ga0068862_100145587 | 3300005844 | Bacteria | 2105 |
| 198 | Ga0068862_100157435 | 3300005844 | Bacteria | 2026 |
| 199 | Ga0068862_100544408 | 3300005844 | Bacteria | 1108 |
| 200 | Ga0081539_10000223 | 3300005985 | Bacteria | 133106 |
| 201 | Ga0075366_10019311 | 3300006195 | Bacteria | 3941 |
| 202 | Ga0075366_10049342 | 3300006195 | Unclassified | 2498 |
| 203 | Ga0075366_10082030 | 3300006195 | Bacteria | 1927 |
| 204 | Ga0097621_100046624 | 3300006237 | Unclassified | 3508 |
| 205 | Ga0097621_100055899 | 3300006237 | Bacteria | 3223 |
| 206 | Ga0097621_100137766 | 3300006237 | Bacteria | 2083 |
| 207 | Ga0097621_100261178 | 3300006237 | Bacteria | 1519 |
| 208 | Ga0097621_100357386 | 3300006237 | Bacteria | 1300 |
| 209 | Ga0068871_100068956 | 3300006358 | Unclassified | 2904 |
| 210 | Ga0068871_100162204 | 3300006358 | Bacteria | 1912 |
| 211 | Ga0068871_100650571 | 3300006358 | Bacteria | 962 |
| 212 | Ga0075428_100055685 | 3300006844 | Unclassified | 4333 |
| 213 | Ga0075428_100206236 | 3300006844 | Bacteria | 2124 |
| 214 | Ga0075430_100003135 | 3300006846 | Bacteria | 13825 |
| 215 | Ga0075430_100044213 | 3300006846 | Bacteria | 3767 |
| 216 | Ga0075431_100028830 | 3300006847 | Bacteria | 5708 |
| 217 | Ga0075431_100202278 | 3300006847 | Bacteria | 2032 |
| 218 | Ga0075429_100142825 | 3300006880 | Bacteria | 2095 |
| 219 | Ga0075429_100430073 | 3300006880 | Bacteria | 1156 |
| 220 | Ga0068865_100001928 | 3300006881 | Bacteria | 12208 |
| 221 | Ga0068865_100319933 | 3300006881 | Bacteria | 1247 |
| 222 | Ga0097620_100000029 | 3300006931 | Bacteria | 178422 |
| 223 | Ga0097620_100007565 | 3300006931 | Bacteria | 11034 |
| 224 | Ga0097620_100018315 | 3300006931 | Bacteria | 7040 |
| 225 | Ga0097620_100027468 | 3300006931 | Bacteria | 5707 |
| 226 | Ga0097620_100039091 | 3300006931 | Bacteria | 4759 |
| 227 | Ga0097620_100058788 | 3300006931 | Bacteria | 3873 |
| 228 | Ga0097620_100073895 | 3300006931 | Bacteria | 3448 |
| 229 | Ga0097620_100262539 | 3300006931 | Unclassified | 1818 |
| 230 | Ga0105240_10000635 | 3300009093 | Bacteria | 64838 |
| 231 | Ga0105240_10027355 | 3300009093 | Bacteria | 7466 |
| 232 | Ga0105240_10030822 | 3300009093 | Bacteria | 6966 |
| 233 | Ga0105240_10032492 | 3300009093 | Bacteria | 6756 |
| 234 | Ga0111539_10431535 | 3300009094 | Bacteria | 1534 |
| 235 | Ga0111539_10631839 | 3300009094 | Bacteria | 1247 |
| 236 | Ga0111539_10690835 | 3300009094 | Bacteria | 1188 |
| 237 | Ga0105245_10157620 | 3300009098 | Bacteria | 2151 |
| 238 | Ga0105245_10310613 | 3300009098 | Bacteria | 1550 |
| 239 | Ga0105247_10016806 | 3300009101 | Bacteria | 4386 |
| 240 | Ga0105247_10166630 | 3300009101 | Bacteria | 1462 |
| 241 | Ga0114129_10010185 | 3300009147 | Bacteria | 13403 |
| 242 | Ga0114129_10187129 | 3300009147 | Bacteria | 2813 |
| 243 | Ga0105241_10000468 | 3300009174 | Bacteria | 30529 |
| 244 | Ga0105241_10005738 | 3300009174 | Bacteria | 9165 |
| 245 | Ga0105241_10013834 | 3300009174 | Bacteria | 5911 |
| 246 | Ga0105241_10027570 | 3300009174 | Bacteria | 4231 |
| 247 | Ga0105242_10052513 | 3300009176 | Unclassified | 3326 |
| 248 | Ga0105242_10058644 | 3300009176 | Bacteria | 3157 |
| 249 | Ga0105242_10166053 | 3300009176 | Bacteria | 1937 |
| 250 | Ga0105242_10518713 | 3300009176 | Bacteria | 1137 |
| 251 | Ga0105242_10573280 | 3300009176 | Unclassified | 1086 |
| 252 | Ga0105248_10472181 | 3300009177 | Bacteria | 1414 |
| 253 | Ga0105237_10002932 | 3300009545 | Bacteria | 20656 |
| 254 | Ga0105237_10002948 | 3300009545 | Bacteria | 20606 |
| 255 | Ga0105237_10025576 | 3300009545 | Bacteria | 6033 |
| 256 | Ga0105237_10027810 | 3300009545 | Bacteria | 5764 |
| 257 | Ga0105237_10048270 | 3300009545 | Bacteria | 4279 |
| 258 | Ga0105238_10285865 | 3300009551 | Bacteria | 1631 |
| 259 | Ga0105249_10001339 | 3300009553 | Bacteria | 21527 |
| 260 | Ga0105249_10003125 | 3300009553 | Bacteria | 14313 |
| 261 | Ga0105249_10003218 | 3300009553 | Bacteria | 14139 |
| 262 | Ga0105249_10003898 | 3300009553 | Bacteria | 12892 |
| 263 | Ga0105249_10048552 | 3300009553 | Bacteria | 3869 |
| 264 | Ga0105249_10056524 | 3300009553 | Bacteria | 3593 |
| 265 | Ga0105249_10384454 | 3300009553 | Bacteria | 1430 |
| 266 | Ga0105249_10502117 | 3300009553 | Unclassified | 1258 |
| 267 | Ga0105249_10557101 | 3300009553 | Bacteria | 1197 |
| 268 | Ga0105239_10000368 | 3300010375 | Bacteria | 66186 |
| 269 | Ga0105239_10002663 | 3300010375 | Bacteria | 22508 |
| 270 | Ga0105239_10025652 | 3300010375 | Bacteria | 6491 |
| 271 | Ga0105239_10057990 | 3300010375 | Unclassified | 4247 |
| 272 | Ga0105239_10094004 | 3300010375 | Bacteria | 3311 |
| 273 | Ga0105246_10021224 | 3300011119 | Bacteria | 4177 |
| 274 | Ga0157373_10005342 | 3300013100 | Bacteria | 9652 |
| 275 | Ga0157373_10010907 | 3300013100 | Bacteria | 6690 |
| 276 | Ga0157373_10049758 | 3300013100 | Bacteria | 2986 |
| 277 | Ga0157371_10000494 | 3300013102 | Bacteria | 47840 |
| 278 | Ga0157371_10001626 | 3300013102 | Bacteria | 22988 |
| 279 | Ga0157371_10004069 | 3300013102 | Bacteria | 12926 |
| 280 | Ga0157371_10021743 | 3300013102 | Bacteria | 4706 |
| 281 | Ga0157371_10025181 | 3300013102 | Bacteria | 4338 |
| 282 | Ga0157371_10036499 | 3300013102 | Bacteria | 3519 |
| 283 | Ga0157371_10039269 | 3300013102 | Bacteria | 3384 |
| 284 | Ga0157371_10044737 | 3300013102 | Bacteria | 3152 |
| 285 | Ga0157371_10092646 | 3300013102 | Bacteria | 2141 |
| 286 | Ga0157371_10142457 | 3300013102 | Bacteria | 1707 |
| 287 | Ga0157371_10167253 | 3300013102 | Unclassified | 1571 |
| 288 | Ga0157371_10255945 | 3300013102 | Bacteria | 1261 |
| 289 | Ga0157371_10273071 | 3300013102 | Bacteria | 1220 |
| 290 | Ga0157371_10359515 | 3300013102 | Bacteria | 1061 |
| 291 | Ga0157370_10001064 | 3300013104 | Bacteria | 34340 |
| 292 | Ga0157370_10003014 | 3300013104 | Bacteria | 20000 |
| 293 | Ga0157370_10008406 | 3300013104 | Bacteria | 11134 |
| 294 | Ga0157370_10017114 | 3300013104 | Bacteria | 7320 |
| 295 | Ga0157370_10112529 | 3300013104 | Bacteria | 2544 |
| 296 | Ga0157370_10274710 | 3300013104 | Bacteria | 1557 |
| 297 | Ga0157370_10378830 | 3300013104 | Bacteria | 1303 |
| 298 | Ga0157370_10497403 | 3300013104 | Bacteria | 1120 |
| 299 | Ga0157369_10107542 | 3300013105 | Bacteria | 2967 |
| 300 | Ga0157369_10108609 | 3300013105 | Bacteria | 2951 |
| 301 | Ga0157369_10160957 | 3300013105 | Unclassified | 2369 |
| 302 | Ga0157369_10184327 | 3300013105 | Bacteria | 2195 |
| 303 | Ga0157369_10189105 | 3300013105 | Unclassified | 2164 |
| 304 | Ga0157374_10093734 | 3300013296 | Unclassified | 2868 |
| 305 | Ga0157374_10100813 | 3300013296 | Bacteria | 2768 |
| 306 | Ga0157374_10123860 | 3300013296 | Bacteria | 2497 |
| 307 | Ga0157374_10360374 | 3300013296 | Bacteria | 1446 |
| 308 | Ga0157374_10507552 | 3300013296 | Bacteria | 1211 |
| 309 | Ga0157374_10753620 | 3300013296 | Bacteria | 988 |
| 310 | Ga0157378_10048302 | 3300013297 | Bacteria | 3784 |
| 311 | Ga0157378_10059540 | 3300013297 | Bacteria | 3408 |
| 312 | Ga0157378_10152519 | 3300013297 | Bacteria | 2154 |
| 313 | Ga0157378_10186511 | 3300013297 | Bacteria | 1954 |
| 314 | Ga0157378_10430012 | 3300013297 | Bacteria | 1306 |
| 315 | Ga0163162_10009899 | 3300013306 | Bacteria | 9271 |
| 316 | Ga0163162_10016971 | 3300013306 | Bacteria | 7123 |
| 317 | Ga0163162_10055575 | 3300013306 | Bacteria | 3986 |
| 318 | Ga0163162_10145244 | 3300013306 | Bacteria | 2488 |
| 319 | Ga0163162_10179790 | 3300013306 | Bacteria | 2241 |
| 320 | Ga0163162_10251320 | 3300013306 | Bacteria | 1900 |
| 321 | Ga0163162_10262372 | 3300013306 | Bacteria | 1859 |
| 322 | Ga0157372_10025681 | 3300013307 | Bacteria | 6407 |
| 323 | Ga0157372_10030554 | 3300013307 | Bacteria | 5893 |
| 324 | Ga0157372_10061345 | 3300013307 | Bacteria | 4210 |
| 325 | Ga0157372_10167403 | 3300013307 | Unclassified | 2542 |
| 326 | Ga0157372_10204938 | 3300013307 | Bacteria | 2285 |
| 327 | Ga0157372_10238603 | 3300013307 | Bacteria | 2109 |
| 328 | Ga0157372_10258301 | 3300013307 | Bacteria | 2023 |
| 329 | Ga0157372_10277756 | 3300013307 | Bacteria | 1947 |
| 330 | Ga0157372_10481397 | 3300013307 | Bacteria | 1447 |
| 331 | Ga0157372_10489868 | 3300013307 | Unclassified | 1433 |
| 332 | Ga0157372_10637876 | 3300013307 | Bacteria | 1241 |
| 333 | Ga0157375_10066346 | 3300013308 | Bacteria | 3602 |
| 334 | Ga0157375_10085653 | 3300013308 | Unclassified | 3201 |
| 335 | Ga0157375_10108617 | 3300013308 | Bacteria | 2869 |
| 336 | Ga0157375_10140330 | 3300013308 | Bacteria | 2543 |
| 337 | Ga0157375_10213591 | 3300013308 | Bacteria | 2087 |
| 338 | Ga0157375_10409018 | 3300013308 | Bacteria | 1523 |
| 339 | Ga0157375_10649109 | 3300013308 | Bacteria | 1212 |
| 340 | Ga0157375_11095802 | 3300013308 | Unclassified | 932 |
| 341 | Ga0163163_10000129 | 3300014325 | Bacteria | 77897 |
| 342 | Ga0163163_10073765 | 3300014325 | Bacteria | 3404 |
| 343 | Ga0163163_10266332 | 3300014325 | Bacteria | 1765 |
| 344 | Ga0163163_10432658 | 3300014325 | Bacteria | 1375 |
| 345 | Ga0163163_10616899 | 3300014325 | Bacteria | 1148 |
| 346 | Ga0157380_10006594 | 3300014326 | Bacteria | 8189 |
| 347 | Ga0157380_10013692 | 3300014326 | Bacteria | 5921 |
| 348 | Ga0157380_10101656 | 3300014326 | Unclassified | 2396 |
| 349 | Ga0157380_10179169 | 3300014326 | Unclassified | 1860 |
| 350 | Ga0157380_10345684 | 3300014326 | Bacteria | 1390 |
| 351 | Ga0157380_10540829 | 3300014326 | Unclassified | 1141 |
| 352 | Ga0157380_10875646 | 3300014326 | Bacteria | 922 |
| 353 | Ga0157377_10002037 | 3300014745 | Bacteria | 8859 |
| 354 | Ga0157377_10021802 | 3300014745 | Unclassified | 3375 |
| 355 | Ga0157377_10160914 | 3300014745 | Bacteria | 1396 |
| 356 | Ga0157379_10051873 | 3300014968 | Bacteria | 3662 |
| 357 | Ga0157379_10315885 | 3300014968 | Bacteria | 1426 |
| 358 | Ga0157376_10221588 | 3300014969 | Bacteria | 1752 |
| 359 | Ga0157376_10256231 | 3300014969 | Bacteria | 1637 |
| 360 | Ga0163161_10011166 | 3300017792 | Bacteria | 6223 |
| 361 | Ga0163161_10113733 | 3300017792 | Bacteria | 2026 |
| 362 | Ga0163161_10233390 | 3300017792 | Bacteria | 1428 |
| 363 | Ga0213876_10012974 | 3300021384 | Bacteria | 4429 |
| 364 | Ga0213876_10145600 | 3300021384 | Bacteria | 1260 |
| 365 | Ga0209646_1003581 | 3300025246 | Bacteria | 3024 |
| 366 | Ga0207426_1000258 | 3300025302 | Bacteria | 114759 |
| 367 | Ga0207697_10009721 | 3300025315 | Bacteria | 4143 |
| 368 | Ga0207697_10096383 | 3300025315 | Unclassified | 1258 |
| 369 | Ga0207697_10097219 | 3300025315 | Bacteria | 1252 |
| 370 | Ga0207697_10148764 | 3300025315 | Bacteria | 1018 |
| 371 | Ga0207656_10230566 | 3300025321 | Bacteria | 902 |
| 372 | Ga0207682_10010808 | 3300025893 | Bacteria | 3574 |
| 373 | Ga0207682_10019790 | 3300025893 | Bacteria | 2638 |
| 374 | Ga0207682_10062178 | 3300025893 | Unclassified | 1565 |
| 375 | Ga0207642_10015421 | 3300025899 | Bacteria | 2846 |
| 376 | Ga0207710_10025589 | 3300025900 | Unclassified | 2547 |
| 377 | Ga0207688_10010263 | 3300025901 | Bacteria | 5098 |
| 378 | Ga0207688_10140019 | 3300025901 | Unclassified | 1424 |
| 379 | Ga0207680_10000016 | 3300025903 | Bacteria | 134657 |
| 380 | Ga0207647_10082748 | 3300025904 | Bacteria | 1922 |
| 381 | Ga0207645_10000263 | 3300025907 | Bacteria | 43560 |
| 382 | Ga0207645_10052338 | 3300025907 | Bacteria | 2608 |
| 383 | Ga0207645_10277725 | 3300025907 | Bacteria | 1112 |
| 384 | Ga0207643_10002440 | 3300025908 | Bacteria | 10046 |
| 385 | Ga0207643_10004417 | 3300025908 | Bacteria | 7561 |
| 386 | Ga0207643_10054394 | 3300025908 | Bacteria | 2275 |
| 387 | Ga0207705_10006172 | 3300025909 | Bacteria | 8913 |
| 388 | Ga0207705_10025699 | 3300025909 | Bacteria | 4201 |
| 389 | Ga0207705_10061297 | 3300025909 | Bacteria | 2717 |
| 390 | Ga0207705_10091226 | 3300025909 | Bacteria | 2231 |
| 391 | Ga0207705_10119881 | 3300025909 | Bacteria | 1951 |
| 392 | Ga0207654_10002271 | 3300025911 | Bacteria | 9858 |
| 393 | Ga0207654_10122176 | 3300025911 | Bacteria | 1637 |
| 394 | Ga0207707_10108115 | 3300025912 | Bacteria | 2431 |
| 395 | Ga0207707_10159871 | 3300025912 | Bacteria | 1970 |
| 396 | Ga0207695_10000446 | 3300025913 | Bacteria | 90493 |
| 397 | Ga0207695_10005705 | 3300025913 | Bacteria | 16413 |
| 398 | Ga0207695_10019063 | 3300025913 | Bacteria | 7912 |
| 399 | Ga0207695_10040146 | 3300025913 | Bacteria | 5022 |
| 400 | Ga0207671_10001104 | 3300025914 | Bacteria | 32550 |
| 401 | Ga0207671_10005043 | 3300025914 | Bacteria | 12331 |
| 402 | Ga0207671_10285209 | 3300025914 | Bacteria | 1303 |
| 403 | Ga0207671_10344147 | 3300025914 | Bacteria | 1182 |
| 404 | Ga0207660_10029293 | 3300025917 | Bacteria | 3774 |
| 405 | Ga0207660_10060280 | 3300025917 | Bacteria | 2727 |
| 406 | Ga0207660_10069501 | 3300025917 | Bacteria | 2557 |
| 407 | Ga0207660_10263135 | 3300025917 | Bacteria | 1365 |
| 408 | Ga0207662_10019410 | 3300025918 | Unclassified | 3868 |
| 409 | Ga0207662_10044012 | 3300025918 | Bacteria | 2635 |
| 410 | Ga0207657_10004643 | 3300025919 | Bacteria | 14508 |
| 411 | Ga0207657_10015504 | 3300025919 | Bacteria | 7381 |
| 412 | Ga0207657_10044524 | 3300025919 | Unclassified | 3901 |
| 413 | Ga0207657_10069705 | 3300025919 | Bacteria | 2982 |
| 414 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 415 | Ga0207652_10000614 | 3300025921 | Bacteria | 35439 |
| 416 | Ga0207652_10081187 | 3300025921 | Bacteria | 2836 |
| 417 | Ga0207652_10121674 | 3300025921 | Bacteria | 2322 |
| 418 | Ga0207652_10131866 | 3300025921 | Unclassified | 2229 |
| 419 | Ga0207652_10477456 | 3300025921 | Bacteria | 1123 |
| 420 | Ga0207681_10020407 | 3300025923 | Unclassified | 4199 |
| 421 | Ga0207681_10054591 | 3300025923 | Bacteria | 2717 |
| 422 | Ga0207681_10173555 | 3300025923 | Unclassified | 1636 |
| 423 | Ga0207681_10260147 | 3300025923 | Bacteria | 1358 |
| 424 | Ga0207681_10447651 | 3300025923 | Bacteria | 1050 |
| 425 | Ga0207650_10200290 | 3300025925 | Bacteria | 1599 |
| 426 | Ga0207650_10213972 | 3300025925 | Bacteria | 1549 |
| 427 | Ga0207659_10043227 | 3300025926 | Bacteria | 3164 |
| 428 | Ga0207659_10171793 | 3300025926 | Bacteria | 1710 |
| 429 | Ga0207659_10238981 | 3300025926 | Bacteria | 1469 |
| 430 | Ga0207644_10201255 | 3300025931 | Unclassified | 1571 |
| 431 | Ga0207644_10617691 | 3300025931 | Bacteria | 901 |
| 432 | Ga0207690_10045587 | 3300025932 | Bacteria | 2897 |
| 433 | Ga0207690_10164783 | 3300025932 | Unclassified | 1655 |
| 434 | Ga0207706_10191384 | 3300025933 | Unclassified | 1796 |
| 435 | Ga0207706_10738248 | 3300025933 | Bacteria | 839 |
| 436 | Ga0207686_10020142 | 3300025934 | Bacteria | 3806 |
| 437 | Ga0207686_10048171 | 3300025934 | Bacteria | 2639 |
| 438 | Ga0207686_10354138 | 3300025934 | Unclassified | 1106 |
| 439 | Ga0207670_10037112 | 3300025936 | Bacteria | 3174 |
| 440 | Ga0207670_10302628 | 3300025936 | Bacteria | 1252 |
| 441 | Ga0207670_10364496 | 3300025936 | Bacteria | 1147 |
| 442 | Ga0207670_10438822 | 3300025936 | Bacteria | 1051 |
| 443 | Ga0207669_10033202 | 3300025937 | Bacteria | 2910 |
| 444 | Ga0207704_10046681 | 3300025938 | Bacteria | 2583 |
| 445 | Ga0207691_10003243 | 3300025940 | Bacteria | 15850 |
| 446 | Ga0207691_10010867 | 3300025940 | Bacteria | 8736 |
| 447 | Ga0207691_10178894 | 3300025940 | Unclassified | 1854 |
| 448 | Ga0207691_10205216 | 3300025940 | Unclassified | 1714 |
| 449 | Ga0207689_10000681 | 3300025942 | Bacteria | 32411 |
| 450 | Ga0207689_10007704 | 3300025942 | Bacteria | 9423 |
| 451 | Ga0207689_10018354 | 3300025942 | Bacteria | 5903 |
| 452 | Ga0207689_10301673 | 3300025942 | Unclassified | 1328 |
| 453 | Ga0207689_10509746 | 3300025942 | Bacteria | 1008 |
| 454 | Ga0207661_10033063 | 3300025944 | Bacteria | 4012 |
| 455 | Ga0207667_10000150 | 3300025949 | Bacteria | 104244 |
| 456 | Ga0207667_10024155 | 3300025949 | Bacteria | 6679 |
| 457 | Ga0207667_10033162 | 3300025949 | Bacteria | 5555 |
| 458 | Ga0207667_10062837 | 3300025949 | Bacteria | 3881 |
| 459 | Ga0207667_10324314 | 3300025949 | Bacteria | 1573 |
| 460 | Ga0207651_10036208 | 3300025960 | Bacteria | 3219 |
| 461 | Ga0207651_10194519 | 3300025960 | Bacteria | 1620 |
| 462 | Ga0207651_10264242 | 3300025960 | Unclassified | 1414 |
| 463 | Ga0207651_10333861 | 3300025960 | Bacteria | 1271 |
| 464 | Ga0207712_10001366 | 3300025961 | Bacteria | 16706 |
| 465 | Ga0207712_10003055 | 3300025961 | Bacteria | 10674 |
| 466 | Ga0207712_10009499 | 3300025961 | Bacteria | 6153 |
| 467 | Ga0207712_10023399 | 3300025961 | Bacteria | 4076 |
| 468 | Ga0207712_10026721 | 3300025961 | Bacteria | 3849 |
| 469 | Ga0207668_10031257 | 3300025972 | Bacteria | 3505 |
| 470 | Ga0207668_10044922 | 3300025972 | Bacteria | 3009 |
| 471 | Ga0207668_10102538 | 3300025972 | Bacteria | 2129 |
| 472 | Ga0207668_10540995 | 3300025972 | Bacteria | 1008 |
| 473 | Ga0207640_10334023 | 3300025981 | Bacteria | 1211 |
| 474 | Ga0207640_10479294 | 3300025981 | Bacteria | 1032 |
| 475 | Ga0207640_10520082 | 3300025981 | Bacteria | 994 |
| 476 | Ga0207658_10103400 | 3300025986 | Bacteria | 2236 |
| 477 | Ga0207658_10204847 | 3300025986 | Bacteria | 1649 |
| 478 | Ga0207658_10602197 | 3300025986 | Bacteria | 987 |
| 479 | Ga0207658_10684404 | 3300025986 | Bacteria | 926 |
| 480 | Ga0207677_10093287 | 3300026023 | Bacteria | 2194 |
| 481 | Ga0207677_10631056 | 3300026023 | Bacteria | 943 |
| 482 | Ga0207703_10603213 | 3300026035 | Bacteria | 1039 |
| 483 | Ga0207639_10006001 | 3300026041 | Bacteria | 8240 |
| 484 | Ga0207639_10119917 | 3300026041 | Bacteria | 2160 |
| 485 | Ga0207639_10193641 | 3300026041 | Bacteria | 1738 |
| 486 | Ga0207639_10230286 | 3300026041 | Bacteria | 1606 |
| 487 | Ga0207639_10861182 | 3300026041 | Unclassified | 846 |
| 488 | Ga0207702_10200284 | 3300026078 | Bacteria | 1850 |
| 489 | Ga0207641_10001043 | 3300026088 | Bacteria | 28025 |
| 490 | Ga0207641_10001405 | 3300026088 | Bacteria | 23727 |
| 491 | Ga0207641_10090858 | 3300026088 | Bacteria | 2671 |
| 492 | Ga0207641_10378379 | 3300026088 | Bacteria | 1355 |
| 493 | Ga0207641_10487497 | 3300026088 | Bacteria | 1195 |
| 494 | Ga0207648_10002644 | 3300026089 | Bacteria | 19132 |
| 495 | Ga0207648_10024271 | 3300026089 | Bacteria | 5415 |
| 496 | Ga0207676_10005706 | 3300026095 | Bacteria | 8810 |
| 497 | Ga0207676_10261190 | 3300026095 | Bacteria | 1564 |
| 498 | Ga0207676_10353591 | 3300026095 | Bacteria | 1359 |
| 499 | Ga0207676_10441505 | 3300026095 | Unclassified | 1225 |
| 500 | Ga0207674_10001856 | 3300026116 | Bacteria | 26902 |
| 501 | Ga0207674_10053595 | 3300026116 | Bacteria | 4110 |
| 502 | Ga0207674_10077852 | 3300026116 | Bacteria | 3321 |
| 503 | Ga0207674_10155794 | 3300026116 | Bacteria | 2240 |
| 504 | Ga0207674_10181400 | 3300026116 | Unclassified | 2057 |
| 505 | Ga0207675_100003498 | 3300026118 | Bacteria | 15327 |
| 506 | Ga0207675_100006997 | 3300026118 | Bacteria | 10670 |
| 507 | Ga0207675_100011111 | 3300026118 | Bacteria | 8436 |
| 508 | Ga0207675_100136537 | 3300026118 | Bacteria | 2327 |
| 509 | Ga0207675_100836763 | 3300026118 | Bacteria | 935 |
| 510 | Ga0207683_10000943 | 3300026121 | Bacteria | 26669 |
| 511 | Ga0207683_10215994 | 3300026121 | Unclassified | 1746 |
| 512 | Ga0207683_10285839 | 3300026121 | Unclassified | 1508 |
| 513 | Ga0207698_10004744 | 3300026142 | Bacteria | 8313 |
| 514 | Ga0207698_10025059 | 3300026142 | Bacteria | 4196 |
| 515 | Ga0207698_10319375 | 3300026142 | Bacteria | 1454 |
| 516 | Ga0207698_10861439 | 3300026142 | Unclassified | 912 |
| 517 | Ga0207428_10216825 | 3300027907 | Bacteria | 1436 |
| 518 | Ga0207428_10470496 | 3300027907 | Bacteria | 915 |
| 519 | Ga0268266_10398009 | 3300028379 | Bacteria | 1302 |
| 520 | Ga0268265_10016719 | 3300028380 | Bacteria | 5047 |
| 521 | Ga0268265_10116090 | 3300028380 | Bacteria | 2196 |
| 522 | Ga0268265_10221874 | 3300028380 | Bacteria | 1655 |
| 523 | Ga0268265_10224769 | 3300028380 | Unclassified | 1645 |
| 524 | Ga0268264_10006240 | 3300028381 | Bacteria | 10058 |
| 525 | Ga0268264_10036247 | 3300028381 | Bacteria | 4062 |
| 526 | Ga0268264_10046441 | 3300028381 | Bacteria | 3607 |
| 527 | Ga0268264_10190068 | 3300028381 | Bacteria | 1871 |
| 528 | Ga0268264_10347444 | 3300028381 | Bacteria | 1411 |
| 529 | Ga0268264_10351178 | 3300028381 | Bacteria | 1404 |
| 530 | Ga0268264_10585933 | 3300028381 | Unclassified | 1098 |
| 531 | Ga0268264_10747072 | 3300028381 | Bacteria | 974 |
| 532 | Ga0307517_10107496 | 3300028786 | Bacteria | 2149 |
| 533 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 534 | Ga0307512_10139691 | 3300030522 | Bacteria | 1487 |
| 535 | Ga0265327_10000148 | 3300031251 | Bacteria | 151952 |
| 536 | Ga0265327_10006106 | 3300031251 | Bacteria | 9763 |
| 537 | Ga0265327_10089082 | 3300031251 | Bacteria | 1508 |
| 538 | Ga0265327_10091403 | 3300031251 | Bacteria | 1483 |
| 539 | Ga0307513_10125869 | 3300031456 | Bacteria | 2518 |
| 540 | Ga0307509_10167093 | 3300031507 | Bacteria | 2086 |
| 541 | Ga0265313_10012879 | 3300031595 | Bacteria | 5072 |
| 542 | Ga0307516_10165356 | 3300031730 | Bacteria | 1958 |
| 543 | Ga0307516_10224045 | 3300031730 | Bacteria | 1588 |
| 544 | Ga0307412_10283557 | 3300031911 | Bacteria | 1302 |
| 545 | Ga0307411_10253122 | 3300032005 | Bacteria | 1386 |
| 546 | Ga0307415_100337848 | 3300032126 | Bacteria | 1263 |
| 547 | Ga0307510_10000042 | 3300033180 | Bacteria | 100951 |
| 548 | Ga0373927_0215912 | 3300035695 | Bacteria | 1260 |
| 549 | Ga0373925_0172357 | 3300037068 | Bacteria | 1709 |
| 550 | Ga0395899_0007352 | 3300037312 | Bacteria | 8518 |
| 551 | Ga0395899_0011758 | 3300037312 | Bacteria | 6699 |
| 552 | Ga0395899_0068454 | 3300037312 | Bacteria | 2602 |
| 553 | Ga0395899_0110249 | 3300037312 | Bacteria | 1979 |
| 554 | Ga0395900_0016503 | 3300037418 | Bacteria | 7532 |
| 555 | Ga0395900_0046549 | 3300037418 | Bacteria | 4467 |
| 556 | Ga0395900_0114897 | 3300037418 | Unclassified | 2762 |
| 557 | Ga0395900_0160845 | 3300037418 | Bacteria | 2290 |
| 558 | Ga0395900_0170725 | 3300037418 | Bacteria | 2214 |
| 559 | Ga0395900_0717142 | 3300037418 | Bacteria | 932 |
| 560 | Ga0395898_0001425 | 3300037466 | Bacteria | 34011 |
| 561 | Ga0395898_0034774 | 3300037466 | Bacteria | 5016 |
| 562 | Ga0395898_0073958 | 3300037466 | Bacteria | 3292 |
| 563 | Ga0395898_0091609 | 3300037466 | Unclassified | 2924 |
| 564 | Ga0395898_0203725 | 3300037466 | Bacteria | 1888 |
| 565 | Ga0395898_0525410 | 3300037466 | Bacteria | 1125 |
| 566 | Ga0395905_0004544 | 3300037471 | Bacteria | 14369 |
| 567 | Ga0395905_0020976 | 3300037471 | Bacteria | 6187 |
| 568 | Ga0395905_0067486 | 3300037471 | Bacteria | 3350 |
| 569 | Ga0395901_0006414 | 3300038443 | Bacteria | 11920 |
| 570 | Ga0395901_0037225 | 3300038443 | Bacteria | 5032 |
| 571 | Ga0395901_0240064 | 3300038443 | Bacteria | 1890 |
| 572 | Ga0395901_0302386 | 3300038443 | Bacteria | 1658 |
| 573 | Ga0436365_0153361 | 3300039437 | Unclassified | 3105 |
| 574 | Ga0436365_0169461 | 3300039437 | Bacteria | 4540 |
| 575 | Ga0436365_0298838 | 3300039437 | Bacteria | 7530 |
| 576 | Ga0436365_1415753 | 3300039437 | Bacteria | 4573 |
| 577 | Ga0439436_0005974 | 3300041404 | Bacteria | 3734 |
| 578 | Ga0439465_0011935 | 3300041413 | Unclassified | 2721 |
| 579 | Ga0451791_0456665 | 3300041451 | Bacteria | 1764 |
| 580 | Ga0451807_1365644 | 3300041486 | Bacteria | 1740 |
| 581 | Ga0451849_0299315 | 3300041505 | Bacteria | 917 |
| 582 | Ga0439431_0011275 | 3300041997 | Unclassified | 2041 |
| 583 | Ga0439442_008572 | 3300042002 | Bacteria | 2063 |
| 584 | Ga0439445_0005014 | 3300042004 | Bacteria | 3007 |
| 585 | Ga0439449_0005127 | 3300042007 | Bacteria | 5039 |
| 586 | Ga0439449_0019046 | 3300042007 | Bacteria | 2574 |
| 587 | Ga0439449_0059046 | 3300042007 | Bacteria | 1416 |
| 588 | Ga0439457_000452 | 3300042014 | Bacteria | 11848 |
| 589 | Ga0439457_018898 | 3300042014 | Bacteria | 1531 |
| 590 | Ga0439462_0028840 | 3300042015 | Bacteria | 1468 |
| 591 | Ga0451577_0011413 | 3300042876 | Bacteria | 8406 |
| 592 | Ga0451577_0095648 | 3300042876 | Bacteria | 2652 |
| 593 | Ga0466969_0000082 | 3300044656 | Bacteria | 50189 |
| 594 | Ga0466972_0000226 | 3300044658 | Bacteria | 39467 |
| 595 | Ga0453683_0144086 | 3300044673 | Bacteria | 1504 |
| 596 | Ga0466966_0000162 | 3300044684 | Bacteria | 43660 |
| 597 | Ga0466961_0257819 | 3300044693 | Bacteria | 1070 |
| 598 | Ga0466964_0023681 | 3300044706 | Bacteria | 2388 |
| 599 | Ga0453684_0068125 | 3300044712 | Bacteria | 4521 |
| 600 | Ga0453684_1173423 | 3300044712 | Bacteria | 807 |
| 601 | Ga0466968_0010921 | 3300044735 | Bacteria | 3530 |
| 602 | Ga0466968_0182869 | 3300044735 | Bacteria | 975 |
| 603 | Ga0466957_0000673 | 3300044842 | Bacteria | 17391 |
| 604 | Ga0466957_0001739 | 3300044842 | Bacteria | 11468 |
| 605 | Ga0466960_0122825 | 3300044901 | Bacteria | 1362 |
| 606 | Ga0466959_0000077 | 3300045049 | Bacteria | 62293 |
| 607 | Ga0466967_0520304 | 3300045976 | Bacteria | 1169 |
| 608 | Ga0495594_0127585 | 3300046499 | Bacteria | 1440 |
| 609 | Ga0495606_0005751 | 3300046507 | Bacteria | 11723 |
| 610 | Ga0495643_0038623 | 3300046522 | Bacteria | 2614 |
| 611 | Ga0495598_0105781 | 3300046537 | Bacteria | 937 |
| 612 | Ga0495645_0102790 | 3300046543 | Bacteria | 2031 |
| 613 | Ga0495668_0000878 | 3300046616 | Bacteria | 33873 |
| 614 | Ga0495668_0003042 | 3300046616 | Bacteria | 13052 |
| 615 | Ga0495611_0000011 | 3300046648 | Bacteria | 146643 |
| 616 | Ga0495636_0128017 | 3300047318 | Bacteria | 1128 |
| 617 | Ga0495672_0012712 | 3300047320 | Bacteria | 5854 |
| 618 | Ga0495672_0025053 | 3300047320 | Bacteria | 3828 |
| 619 | Ga0495686_0016543 | 3300047472 | Bacteria | 5000 |
| 620 | Ga0496108_0111020 | 3300048911 | Bacteria | 2345 |
| 621 | Ga0501032_0011965 | 3300049569 | Bacteria | 6215 |
| 622 | Ga0501032_0034263 | 3300049569 | Bacteria | 3477 |
| 623 | Ga0501033_0010920 | 3300049570 | Bacteria | 6961 |
| 624 | Ga0501033_0341958 | 3300049570 | Bacteria | 1049 |
| 625 | Ga0501034_0000225 | 3300049571 | Bacteria | 107163 |
| 626 | Ga0501034_0007951 | 3300049571 | Bacteria | 11263 |
| 627 | Ga0501034_0014056 | 3300049571 | Bacteria | 8245 |
| 628 | Ga0501034_0020625 | 3300049571 | Bacteria | 6731 |
| 629 | Ga0501034_0024371 | 3300049571 | Bacteria | 6154 |
| 630 | Ga0501034_0040672 | 3300049571 | Bacteria | 4705 |
| 631 | Ga0501034_0834615 | 3300049571 | Bacteria | 813 |
| 632 | Ga0501036_0058612 | 3300049572 | Bacteria | 3262 |
| 633 | Ga0501036_0605010 | 3300049572 | Bacteria | 909 |
| 634 | Ga0501036_0682384 | 3300049572 | Unclassified | 849 |
| 635 | Ga0501037_0017921 | 3300049573 | Bacteria | 5213 |
| 636 | Ga0501037_0029493 | 3300049573 | Bacteria | 4053 |
| 637 | Ga0501037_0138975 | 3300049573 | Bacteria | 1739 |
| 638 | Ga0501037_0201350 | 3300049573 | Bacteria | 1407 |
| 639 | Ga0501038_0063668 | 3300049574 | Bacteria | 3147 |
| 640 | Ga0501043_0025587 | 3300049579 | Bacteria | 4630 |
| 641 | Ga0501043_0530827 | 3300049579 | Unclassified | 876 |
| 642 | Ga0501047_0010456 | 3300049581 | Bacteria | 8783 |
| 643 | Ga0501047_0014516 | 3300049581 | Bacteria | 7492 |
| 644 | Ga0501047_0071661 | 3300049581 | Bacteria | 3335 |
| 645 | Ga0501047_0340047 | 3300049581 | Bacteria | 1338 |
| 646 | Ga0501048_0037369 | 3300049582 | Bacteria | 3487 |
| 647 | Ga0501067_0031611 | 3300049583 | Bacteria | 2937 |
| 648 | Ga0501070_0043109 | 3300049586 | Bacteria | 3756 |
| 649 | Ga0501070_0064010 | 3300049586 | Bacteria | 3046 |
| 650 | Ga0501073_0094626 | 3300049589 | Bacteria | 2075 |
| 651 | Ga0501073_0365422 | 3300049589 | Unclassified | 997 |
| 652 | Ga0501074_0012848 | 3300049590 | Bacteria | 6087 |
| 653 | Ga0501235_033679 | 3300049669 | Bacteria | 1161 |
| 654 | Ga0501257_006486 | 3300049686 | Unclassified | 2596 |
| 655 | Ga0501219_000096 | 3300049703 | Bacteria | 15208 |
| 656 | Ga0501225_0005775 | 3300049705 | Bacteria | 3623 |
| 657 | Ga0501079_0211643 | 3300049741 | Bacteria | 1514 |
| 658 | Ga0501080_0206677 | 3300049742 | Bacteria | 1800 |
| 659 | Ga0501035_0017551 | 3300049822 | Bacteria | 6604 |
| 660 | Ga0501035_0020579 | 3300049822 | Bacteria | 6060 |
| 661 | Ga0501035_0034818 | 3300049822 | Bacteria | 4575 |
| 662 | Ga0501035_0071998 | 3300049822 | Bacteria | 3060 |
| 663 | Ga0501044_0024861 | 3300049823 | Bacteria | 6353 |
| 664 | Ga0501044_0126575 | 3300049823 | Bacteria | 2552 |
| 665 | Ga0501044_0131607 | 3300049823 | Bacteria | 2495 |
| 666 | Ga0501044_0184568 | 3300049823 | Bacteria | 2051 |
| 667 | Ga0501044_0379902 | 3300049823 | Bacteria | 1328 |
| 668 | Ga0501044_0605743 | 3300049823 | Bacteria | 988 |
| 669 | Ga0501284_00101 | 3300050005 | Bacteria | 17814 |
| 670 | nmdc:mga0k408_1636_c1 | 3300050493 | Bacteria | 12115 |
| 671 | nmdc:mga05p37_63512_c1 | 3300050507 | Bacteria | 4544 |
| 672 | nmdc:mga09592_165397_c1 | 3300050508 | Unclassified | 1912 |
| 673 | nmdc:mga09592_210214_c1 | 3300050508 | Bacteria | 1686 |
| 674 | nmdc:mga0qj67_10091_c1 | 3300050509 | Bacteria | 7047 |
| 675 | nmdc:mga0qj67_80584_c1 | 3300050509 | Bacteria | 2608 |
| 676 | nmdc:mga08y16_301704_c1 | 3300050511 | Bacteria | 1651 |
| 677 | nmdc:mga08y16_776412_c1 | 3300050511 | Bacteria | 953 |
| 678 | Ga0500578_0008966 | 3300053086 | Bacteria | 6520 |
| 679 | Ga0500578_0010664 | 3300053086 | Bacteria | 5936 |
| 680 | Ga0500646_0041006 | 3300053090 | Bacteria | 1303 |
| 681 | Ga0500583_0000180 | 3300053092 | Bacteria | 25825 |
| 682 | Ga0500583_0006538 | 3300053092 | Bacteria | 4021 |
| 683 | Ga0500583_0147196 | 3300053092 | Bacteria | 1172 |
| 684 | Ga0500555_027869 | 3300053103 | Bacteria | 1611 |
| 685 | Ga0500556_0120806 | 3300053104 | Bacteria | 1022 |
| 686 | Ga0500559_0020352 | 3300053136 | Unclassified | 2806 |
| 687 | Ga0500588_0008405 | 3300053146 | Bacteria | 2410 |
| 688 | Ga0500604_0009128 | 3300053151 | Bacteria | 2639 |
| 689 | Ga0500604_0050660 | 3300053151 | Bacteria | 1281 |
| 690 | Ga0500616_0073222 | 3300053153 | Unclassified | 1740 |
| 691 | Ga0500616_0145608 | 3300053153 | Bacteria | 1102 |
| 692 | Ga0500622_0087709 | 3300053156 | Bacteria | 1549 |
| 693 | Ga0500622_0104811 | 3300053156 | Bacteria | 1388 |
| 694 | Ga0500636_0237655 | 3300053177 | Bacteria | 938 |
| 695 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 696 | Ga0500611_050146 | 3300053727 | Bacteria | 953 |
| 697 | Ga0501084_0585202 | 3300054114 | Bacteria | 943 |
| 698 | Ga0466962_0011495 | 3300061719 | Bacteria | 4263 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005288 | Ga0065714_10142125 | Ga0065714_101421251 | 220 |
| 2 | 3300005843 | Ga0068860_100400647 | Ga0068860_1004006472 | 233 |
| 3 | 3300028381 | Ga0268264_10747072 | Ga0268264_107470721 | 233 |
| 4 | 3300053727 | Ga0500611_050146 | Ga0500611_050146_46_747 | 233 |
| 5 | 3300003322 | rootL2_10252239 | rootL2_102522393 | 234 |
| 6 | 3300005334 | Ga0068869_100005681 | Ga0068869_1000056815 | 235 |
| 7 | 3300005335 | Ga0070666_10000108 | Ga0070666_100001087 | 235 |
| 8 | 3300005340 | Ga0070689_100126179 | Ga0070689_1001261791 | 235 |
| 9 | 3300005355 | Ga0070671_100183300 | Ga0070671_1001833002 | 235 |
| 10 | 3300005364 | Ga0070673_100037299 | Ga0070673_1000372992 | 235 |
| 11 | 3300005617 | Ga0068859_100000029 | Ga0068859_10000002919 | 235 |
| 12 | 3300005618 | Ga0068864_100009388 | Ga0068864_1000093887 | 235 |
| 13 | 3300005842 | Ga0068858_100011366 | Ga0068858_1000113667 | 235 |
| 14 | 3300005843 | Ga0068860_100000888 | Ga0068860_10000088814 | 235 |
| 15 | 3300006237 | Ga0097621_100046624 | Ga0097621_1000466242 | 235 |
| 16 | 3300006358 | Ga0068871_100068956 | Ga0068871_1000689563 | 235 |
| 17 | 3300006931 | Ga0097620_100000029 | Ga0097620_10000002919 | 235 |
| 18 | 3300009098 | Ga0105245_10157620 | Ga0105245_101576202 | 235 |
| 19 | 3300009101 | Ga0105247_10016806 | Ga0105247_100168062 | 235 |
| 20 | 3300009174 | Ga0105241_10000468 | Ga0105241_100004685 | 235 |
| 21 | 3300009176 | Ga0105242_10052513 | Ga0105242_100525135 | 235 |
| 22 | 3300009177 | Ga0105248_10472181 | Ga0105248_104721811 | 235 |
| 23 | 3300009545 | Ga0105237_10002932 | Ga0105237_1000293216 | 235 |
| 24 | 3300009553 | Ga0105249_10001339 | Ga0105249_100013396 | 235 |
| 25 | 3300013306 | Ga0163162_10016971 | Ga0163162_100169716 | 235 |
| 26 | 3300013306 | Ga0163162_10145244 | Ga0163162_101452443 | 235 |
| 27 | 3300013308 | Ga0157375_10140330 | Ga0157375_101403302 | 235 |
| 28 | 3300014968 | Ga0157379_10051873 | Ga0157379_100518731 | 235 |
| 29 | 3300014969 | Ga0157376_10256231 | Ga0157376_102562311 | 235 |
| 30 | 3300025900 | Ga0207710_10025589 | Ga0207710_100255891 | 235 |
| 31 | 3300025903 | Ga0207680_10000016 | Ga0207680_1000001692 | 235 |
| 32 | 3300025914 | Ga0207671_10001104 | Ga0207671_100011046 | 235 |
| 33 | 3300025931 | Ga0207644_10617691 | Ga0207644_106176911 | 235 |
| 34 | 3300025934 | Ga0207686_10048171 | Ga0207686_100481712 | 235 |
| 35 | 3300025936 | Ga0207670_10302628 | Ga0207670_103026281 | 235 |
| 36 | 3300025940 | Ga0207691_10178894 | Ga0207691_101788941 | 235 |
| 37 | 3300025942 | Ga0207689_10000681 | Ga0207689_1000068118 | 235 |
| 38 | 3300025961 | Ga0207712_10003055 | Ga0207712_1000305511 | 235 |
| 39 | 3300025986 | Ga0207658_10204847 | Ga0207658_102048472 | 235 |
| 40 | 3300026023 | Ga0207677_10093287 | Ga0207677_100932871 | 235 |
| 41 | 3300026088 | Ga0207641_10001043 | Ga0207641_1000104311 | 235 |
| 42 | 3300026095 | Ga0207676_10005706 | Ga0207676_100057062 | 235 |
| 43 | 3300028381 | Ga0268264_10006240 | Ga0268264_100062406 | 235 |
| 44 | 3300047320 | Ga0495672_0025053 | Ga0495672_0025053_602_1354 | 235 |
| 45 | 3300005336 | Ga0070680_100006348 | Ga0070680_1000063487 | 236 |
| 46 | 3300005366 | Ga0070659_100011028 | Ga0070659_1000110288 | 236 |
| 47 | 3300005563 | Ga0068855_100011433 | Ga0068855_1000114332 | 236 |
| 48 | 3300005577 | Ga0068857_100203049 | Ga0068857_1002030491 | 236 |
| 49 | 3300009093 | Ga0105240_10032492 | Ga0105240_100324927 | 236 |
| 50 | 3300013100 | Ga0157373_10005342 | Ga0157373_100053426 | 236 |
| 51 | 3300013102 | Ga0157371_10025181 | Ga0157371_100251811 | 236 |
| 52 | 3300025913 | Ga0207695_10040146 | Ga0207695_100401466 | 236 |
| 53 | 3300025917 | Ga0207660_10029293 | Ga0207660_100292932 | 236 |
| 54 | 3300025919 | Ga0207657_10015504 | Ga0207657_100155046 | 236 |
| 55 | 3300025932 | Ga0207690_10045587 | Ga0207690_100455871 | 236 |
| 56 | 3300025949 | Ga0207667_10033162 | Ga0207667_100331627 | 236 |
| 57 | 3300026116 | Ga0207674_10155794 | Ga0207674_101557941 | 236 |
| 58 | 3300037466 | Ga0395898_0525410 | Ga0395898_0525410_355_1110 | 236 |
| 59 | 3300005337 | Ga0070682_100000044 | Ga0070682_10000004445 | 238 |
| 60 | 3300009098 | Ga0105245_10310613 | Ga0105245_103106131 | 238 |
| 61 | 3300025931 | Ga0207644_10201255 | Ga0207644_102012552 | 238 |
| 62 | 3300013102 | Ga0157371_10044737 | Ga0157371_100447373 | 239 |
| 63 | 3300013307 | Ga0157372_10481397 | Ga0157372_104813971 | 239 |
| 64 | 3300026041 | Ga0207639_10230286 | Ga0207639_102302862 | 239 |
| 65 | 3300046616 | Ga0495668_0000878 | Ga0495668_0000878_33019_33774 | 240 |
| 66 | 3300049570 | Ga0501033_0341958 | Ga0501033_0341958_144_896 | 241 |
| 67 | 3300049686 | Ga0501257_006486 | Ga0501257_006486_54_803 | 242 |
| 68 | 3300061719 | Ga0466962_0011495 | Ga0466962_0011495_1362_2093 | 243 |
| 69 | 3300009176 | Ga0105242_10058644 | Ga0105242_100586441 | 244 |
| 70 | 3300025934 | Ga0207686_10354138 | Ga0207686_103541381 | 244 |
| 71 | iso_pu_bacteria | 2738541278 | 2738731419 | 245 |
| 72 | iso_pu_bacteria | 2818991444 | 2819586689 | 245 |
| 73 | 3300009147 | Ga0114129_10010185 | Ga0114129_1001018511 | 247 |
| 74 | 3300042876 | Ga0451577_0011413 | Ga0451577_0011413_4027_4770 | 247 |
| 75 | 3300042876 | Ga0451577_0095648 | Ga0451577_0095648_786_1538 | 247 |
| 76 | 3300044842 | Ga0466957_0001739 | Ga0466957_0001739_10281_11024 | 247 |
| 77 | 3300050507 | nmdc:mga05p37_63512_c1 | nmdc:mga05p37_63512_c1_1359_2102 | 247 |
| 78 | 3300005293 | Ga0065715_10034333 | Ga0065715_100343333 | 248 |
| 79 | 3300005293 | Ga0065715_10212873 | Ga0065715_102128731 | 248 |
| 80 | 3300005330 | Ga0070690_100048040 | Ga0070690_1000480401 | 248 |
| 81 | 3300005471 | Ga0070698_100006624 | Ga0070698_1000066245 | 248 |
| 82 | 3300005518 | Ga0070699_100262423 | Ga0070699_1002624232 | 248 |
| 83 | 3300005539 | Ga0068853_100218982 | Ga0068853_1002189822 | 248 |
| 84 | 3300005617 | Ga0068859_100039091 | Ga0068859_1000390914 | 248 |
| 85 | 3300006237 | Ga0097621_100137766 | Ga0097621_1001377663 | 248 |
| 86 | 3300006931 | Ga0097620_100039091 | Ga0097620_1000390914 | 248 |
| 87 | 3300009094 | Ga0111539_10431535 | Ga0111539_104315352 | 248 |
| 88 | 3300013296 | Ga0157374_10753620 | Ga0157374_107536201 | 248 |
| 89 | 3300013297 | Ga0157378_10059540 | Ga0157378_100595405 | 248 |
| 90 | 3300013306 | Ga0163162_10251320 | Ga0163162_102513202 | 248 |
| 91 | 3300013306 | Ga0163162_10262372 | Ga0163162_102623721 | 248 |
| 92 | 3300013308 | Ga0157375_10108617 | Ga0157375_101086171 | 248 |
| 93 | 3300014968 | Ga0157379_10315885 | Ga0157379_103158852 | 248 |
| 94 | 3300017792 | Ga0163161_10113733 | Ga0163161_101137333 | 248 |
| 95 | 3300025893 | Ga0207682_10010808 | Ga0207682_100108083 | 248 |
| 96 | 3300025926 | Ga0207659_10238981 | Ga0207659_102389812 | 248 |
| 97 | 3300026041 | Ga0207639_10193641 | Ga0207639_101936412 | 248 |
| 98 | 3300026089 | Ga0207648_10024271 | Ga0207648_100242716 | 248 |
| 99 | 3300027907 | Ga0207428_10216825 | Ga0207428_102168252 | 248 |
| 100 | 3300028381 | Ga0268264_10347444 | Ga0268264_103474441 | 248 |
| 101 | 3300028381 | Ga0268264_10585933 | Ga0268264_105859331 | 248 |
| 102 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002397 | 248 |
| 103 | 3300031911 | Ga0307412_10283557 | Ga0307412_102835572 | 248 |
| 104 | 3300032126 | Ga0307415_100337848 | Ga0307415_1003378481 | 248 |
| 105 | 3300048911 | Ga0496108_0111020 | Ga0496108_0111020_212_967 | 248 |
| 106 | 3300049571 | Ga0501034_0000225 | Ga0501034_0000225_15216_15977 | 248 |
| 107 | 3300053104 | Ga0500556_0120806 | Ga0500556_0120806_240_992 | 248 |
| 108 | 3300000545 | CNXas_1004410 | CNXas_10044102 | 249 |
| 109 | 3300001979 | JGI24740J21852_10033782 | JGI24740J21852_100337822 | 249 |
| 110 | 3300002155 | JGI24033J26618_1009290 | JGI24033J26618_10092901 | 249 |
| 111 | 3300003203 | JGI25406J46586_10001082 | JGI25406J46586_1000108210 | 249 |
| 112 | 3300003316 | rootH1_10012510 | rootH1_100125103 | 249 |
| 113 | 3300003320 | rootH2_10008764 | rootH2_1000876416 | 249 |
| 114 | 3300003320 | rootH2_10022558 | rootH2_100225583 | 249 |
| 115 | 3300003320 | rootH2_10077251 | rootH2_100772512 | 249 |
| 116 | 3300003320 | rootH2_10241788 | rootH2_102417882 | 249 |
| 117 | 3300003320 | rootH2_10265827 | rootH2_102658271 | 249 |
| 118 | 3300003322 | rootL2_10035418 | rootL2_100354182 | 249 |
| 119 | 3300003322 | rootL2_10047293 | rootL2_100472933 | 249 |
| 120 | 3300003322 | rootL2_10184333 | rootL2_101843331 | 249 |
| 121 | 3300003323 | rootH1_10033150 | rootH1_100331502 | 249 |
| 122 | 3300003323 | rootH1_10033151 | rootH1_100331519 | 249 |
| 123 | 3300003354 | JGI25160J50197_1000265 | JGI25160J50197_100026517 | 249 |
| 124 | 3300005290 | Ga0065712_10007433 | Ga0065712_100074331 | 249 |
| 125 | 3300005290 | Ga0065712_10009117 | Ga0065712_100091174 | 249 |
| 126 | 3300005290 | Ga0065712_10013245 | Ga0065712_100132452 | 249 |
| 127 | 3300005290 | Ga0065712_10104013 | Ga0065712_101040132 | 249 |
| 128 | 3300005293 | Ga0065715_10004611 | Ga0065715_100046112 | 249 |
| 129 | 3300005293 | Ga0065715_10396081 | Ga0065715_103960811 | 249 |
| 130 | 3300005295 | Ga0065707_10010710 | Ga0065707_100107104 | 249 |
| 131 | 3300005295 | Ga0065707_10324906 | Ga0065707_103249061 | 249 |
| 132 | 3300005327 | Ga0070658_10018351 | Ga0070658_100183514 | 249 |
| 133 | 3300005327 | Ga0070658_10040671 | Ga0070658_100406714 | 249 |
| 134 | 3300005327 | Ga0070658_10056084 | Ga0070658_100560841 | 249 |
| 135 | 3300005327 | Ga0070658_10078815 | Ga0070658_100788153 | 249 |
| 136 | 3300005327 | Ga0070658_10185797 | Ga0070658_101857973 | 249 |
| 137 | 3300005328 | Ga0070676_10003200 | Ga0070676_100032004 | 249 |
| 138 | 3300005328 | Ga0070676_10045907 | Ga0070676_100459072 | 249 |
| 139 | 3300005329 | Ga0070683_100006418 | Ga0070683_1000064185 | 249 |
| 140 | 3300005329 | Ga0070683_100033650 | Ga0070683_1000336502 | 249 |
| 141 | 3300005329 | Ga0070683_100354476 | Ga0070683_1003544762 | 249 |
| 142 | 3300005329 | Ga0070683_100359807 | Ga0070683_1003598072 | 249 |
| 143 | 3300005330 | Ga0070690_100097057 | Ga0070690_1000970572 | 249 |
| 144 | 3300005331 | Ga0070670_100242799 | Ga0070670_1002427991 | 249 |
| 145 | 3300005333 | Ga0070677_10102586 | Ga0070677_101025862 | 249 |
| 146 | 3300005334 | Ga0068869_100011037 | Ga0068869_1000110373 | 249 |
| 147 | 3300005334 | Ga0068869_100074809 | Ga0068869_1000748092 | 249 |
| 148 | 3300005334 | Ga0068869_100100089 | Ga0068869_1001000892 | 249 |
| 149 | 3300005334 | Ga0068869_100207709 | Ga0068869_1002077091 | 249 |
| 150 | 3300005334 | Ga0068869_100369350 | Ga0068869_1003693502 | 249 |
| 151 | 3300005335 | Ga0070666_10005443 | Ga0070666_100054431 | 249 |
| 152 | 3300005336 | Ga0070680_100004884 | Ga0070680_1000048844 | 249 |
| 153 | 3300005336 | Ga0070680_100005000 | Ga0070680_1000050009 | 249 |
| 154 | 3300005336 | Ga0070680_100065505 | Ga0070680_1000655052 | 249 |
| 155 | 3300005336 | Ga0070680_100174801 | Ga0070680_1001748013 | 249 |
| 156 | 3300005337 | Ga0070682_100030518 | Ga0070682_1000305183 | 249 |
| 157 | 3300005337 | Ga0070682_100065804 | Ga0070682_1000658043 | 249 |
| 158 | 3300005337 | Ga0070682_100281747 | Ga0070682_1002817471 | 249 |
| 159 | 3300005338 | Ga0068868_100016265 | Ga0068868_1000162653 | 249 |
| 160 | 3300005339 | Ga0070660_100001860 | Ga0070660_10000186014 | 249 |
| 161 | 3300005339 | Ga0070660_100052194 | Ga0070660_1000521943 | 249 |
| 162 | 3300005339 | Ga0070660_100062334 | Ga0070660_1000623342 | 249 |
| 163 | 3300005339 | Ga0070660_100111324 | Ga0070660_1001113242 | 249 |
| 164 | 3300005340 | Ga0070689_100027434 | Ga0070689_1000274342 | 249 |
| 165 | 3300005343 | Ga0070687_100026323 | Ga0070687_1000263233 | 249 |
| 166 | 3300005343 | Ga0070687_100070111 | Ga0070687_1000701112 | 249 |
| 167 | 3300005343 | Ga0070687_100328840 | Ga0070687_1003288401 | 249 |
| 168 | 3300005343 | Ga0070687_100426268 | Ga0070687_1004262681 | 249 |
| 169 | 3300005344 | Ga0070661_100579417 | Ga0070661_1005794171 | 249 |
| 170 | 3300005347 | Ga0070668_100023358 | Ga0070668_1000233584 | 249 |
| 171 | 3300005347 | Ga0070668_100095877 | Ga0070668_1000958772 | 249 |
| 172 | 3300005347 | Ga0070668_100245019 | Ga0070668_1002450192 | 249 |
| 173 | 3300005347 | Ga0070668_100298307 | Ga0070668_1002983071 | 249 |
| 174 | 3300005353 | Ga0070669_100003025 | Ga0070669_1000030257 | 249 |
| 175 | 3300005353 | Ga0070669_100006016 | Ga0070669_1000060168 | 249 |
| 176 | 3300005353 | Ga0070669_100019749 | Ga0070669_1000197491 | 249 |
| 177 | 3300005353 | Ga0070669_100106011 | Ga0070669_1001060112 | 249 |
| 178 | 3300005353 | Ga0070669_100197503 | Ga0070669_1001975031 | 249 |
| 179 | 3300005353 | Ga0070669_100248187 | Ga0070669_1002481871 | 249 |
| 180 | 3300005354 | Ga0070675_100005755 | Ga0070675_1000057552 | 249 |
| 181 | 3300005354 | Ga0070675_100022774 | Ga0070675_1000227744 | 249 |
| 182 | 3300005354 | Ga0070675_100229698 | Ga0070675_1002296982 | 249 |
| 183 | 3300005355 | Ga0070671_100282748 | Ga0070671_1002827482 | 249 |
| 184 | 3300005356 | Ga0070674_100025842 | Ga0070674_1000258423 | 249 |
| 185 | 3300005356 | Ga0070674_100418666 | Ga0070674_1004186662 | 249 |
| 186 | 3300005364 | Ga0070673_100020510 | Ga0070673_1000205105 | 249 |
| 187 | 3300005364 | Ga0070673_100029789 | Ga0070673_1000297893 | 249 |
| 188 | 3300005364 | Ga0070673_100030274 | Ga0070673_1000302743 | 249 |
| 189 | 3300005364 | Ga0070673_100046319 | Ga0070673_1000463193 | 249 |
| 190 | 3300005364 | Ga0070673_100110690 | Ga0070673_1001106902 | 249 |
| 191 | 3300005365 | Ga0070688_100097292 | Ga0070688_1000972921 | 249 |
| 192 | 3300005365 | Ga0070688_100205700 | Ga0070688_1002057002 | 249 |
| 193 | 3300005365 | Ga0070688_100330992 | Ga0070688_1003309922 | 249 |
| 194 | 3300005366 | Ga0070659_100018722 | Ga0070659_1000187224 | 249 |
| 195 | 3300005366 | Ga0070659_100052418 | Ga0070659_1000524183 | 249 |
| 196 | 3300005367 | Ga0070667_100689315 | Ga0070667_1006893151 | 249 |
| 197 | 3300005367 | Ga0070667_100694800 | Ga0070667_1006948001 | 249 |
| 198 | 3300005455 | Ga0070663_100008886 | Ga0070663_1000088867 | 249 |
| 199 | 3300005456 | Ga0070678_100007906 | Ga0070678_1000079066 | 249 |
| 200 | 3300005456 | Ga0070678_100524434 | Ga0070678_1005244341 | 249 |
| 201 | 3300005457 | Ga0070662_100010256 | Ga0070662_1000102569 | 249 |
| 202 | 3300005458 | Ga0070681_10012148 | Ga0070681_100121488 | 249 |
| 203 | 3300005458 | Ga0070681_10042870 | Ga0070681_100428703 | 249 |
| 204 | 3300005459 | Ga0068867_100167406 | Ga0068867_1001674061 | 249 |
| 205 | 3300005466 | Ga0070685_10253042 | Ga0070685_102530421 | 249 |
| 206 | 3300005471 | Ga0070698_100002094 | Ga0070698_10000209418 | 249 |
| 207 | 3300005471 | Ga0070698_100024951 | Ga0070698_1000249514 | 249 |
| 208 | 3300005471 | Ga0070698_100089771 | Ga0070698_1000897713 | 249 |
| 209 | 3300005518 | Ga0070699_100529154 | Ga0070699_1005291541 | 249 |
| 210 | 3300005530 | Ga0070679_100000634 | Ga0070679_10000063433 | 249 |
| 211 | 3300005530 | Ga0070679_100016556 | Ga0070679_1000165562 | 249 |
| 212 | 3300005530 | Ga0070679_100036052 | Ga0070679_1000360524 | 249 |
| 213 | 3300005530 | Ga0070679_100056862 | Ga0070679_1000568623 | 249 |
| 214 | 3300005530 | Ga0070679_100084605 | Ga0070679_1000846052 | 249 |
| 215 | 3300005539 | Ga0068853_100000245 | Ga0068853_1000002458 | 249 |
| 216 | 3300005539 | Ga0068853_100035695 | Ga0068853_1000356953 | 249 |
| 217 | 3300005539 | Ga0068853_100091375 | Ga0068853_1000913753 | 249 |
| 218 | 3300005539 | Ga0068853_100275596 | Ga0068853_1002755962 | 249 |
| 219 | 3300005539 | Ga0068853_100353874 | Ga0068853_1003538742 | 249 |
| 220 | 3300005539 | Ga0068853_100379252 | Ga0068853_1003792522 | 249 |
| 221 | 3300005543 | Ga0070672_100008700 | Ga0070672_1000087004 | 249 |
| 222 | 3300005543 | Ga0070672_100296941 | Ga0070672_1002969412 | 249 |
| 223 | 3300005543 | Ga0070672_100609170 | Ga0070672_1006091701 | 249 |
| 224 | 3300005547 | Ga0070693_100428876 | Ga0070693_1004288761 | 249 |
| 225 | 3300005549 | Ga0070704_100365544 | Ga0070704_1003655442 | 249 |
| 226 | 3300005563 | Ga0068855_100027170 | Ga0068855_1000271704 | 249 |
| 227 | 3300005563 | Ga0068855_100037472 | Ga0068855_1000374725 | 249 |
| 228 | 3300005563 | Ga0068855_100074116 | Ga0068855_1000741163 | 249 |
| 229 | 3300005563 | Ga0068855_100089553 | Ga0068855_1000895533 | 249 |
| 230 | 3300005563 | Ga0068855_100158566 | Ga0068855_1001585662 | 249 |
| 231 | 3300005564 | Ga0070664_100135290 | Ga0070664_1001352902 | 249 |
| 232 | 3300005564 | Ga0070664_100802129 | Ga0070664_1008021291 | 249 |
| 233 | 3300005577 | Ga0068857_100039907 | Ga0068857_1000399072 | 249 |
| 234 | 3300005577 | Ga0068857_100247614 | Ga0068857_1002476142 | 249 |
| 235 | 3300005578 | Ga0068854_100206141 | Ga0068854_1002061411 | 249 |
| 236 | 3300005578 | Ga0068854_100403259 | Ga0068854_1004032592 | 249 |
| 237 | 3300005578 | Ga0068854_100425054 | Ga0068854_1004250541 | 249 |
| 238 | 3300005614 | Ga0068856_100006856 | Ga0068856_1000068565 | 249 |
| 239 | 3300005614 | Ga0068856_100100400 | Ga0068856_1001004004 | 249 |
| 240 | 3300005614 | Ga0068856_100119384 | Ga0068856_1001193841 | 249 |
| 241 | 3300005614 | Ga0068856_100745300 | Ga0068856_1007453001 | 249 |
| 242 | 3300005615 | Ga0070702_100251574 | Ga0070702_1002515741 | 249 |
| 243 | 3300005616 | Ga0068852_100032072 | Ga0068852_1000320723 | 249 |
| 244 | 3300005616 | Ga0068852_100186643 | Ga0068852_1001866432 | 249 |
| 245 | 3300005616 | Ga0068852_100302781 | Ga0068852_1003027812 | 249 |
| 246 | 3300005616 | Ga0068852_100420885 | Ga0068852_1004208852 | 249 |
| 247 | 3300005616 | Ga0068852_100431596 | Ga0068852_1004315962 | 249 |
| 248 | 3300005617 | Ga0068859_100007565 | Ga0068859_10000756510 | 249 |
| 249 | 3300005617 | Ga0068859_100018315 | Ga0068859_1000183156 | 249 |
| 250 | 3300005617 | Ga0068859_100027468 | Ga0068859_1000274688 | 249 |
| 251 | 3300005617 | Ga0068859_100058782 | Ga0068859_1000587821 | 249 |
| 252 | 3300005617 | Ga0068859_100073894 | Ga0068859_1000738941 | 249 |
| 253 | 3300005617 | Ga0068859_100262553 | Ga0068859_1002625532 | 249 |
| 254 | 3300005618 | Ga0068864_100026182 | Ga0068864_1000261824 | 249 |
| 255 | 3300005618 | Ga0068864_100117451 | Ga0068864_1001174514 | 249 |
| 256 | 3300005618 | Ga0068864_100399788 | Ga0068864_1003997882 | 249 |
| 257 | 3300005618 | Ga0068864_100549346 | Ga0068864_1005493461 | 249 |
| 258 | 3300005618 | Ga0068864_100960300 | Ga0068864_1009603001 | 249 |
| 259 | 3300005718 | Ga0068866_10063525 | Ga0068866_100635254 | 249 |
| 260 | 3300005719 | Ga0068861_100008514 | Ga0068861_1000085143 | 249 |
| 261 | 3300005719 | Ga0068861_100016996 | Ga0068861_1000169962 | 249 |
| 262 | 3300005719 | Ga0068861_100055850 | Ga0068861_1000558504 | 249 |
| 263 | 3300005719 | Ga0068861_100222400 | Ga0068861_1002224002 | 249 |
| 264 | 3300005834 | Ga0068851_10163188 | Ga0068851_101631881 | 249 |
| 265 | 3300005840 | Ga0068870_10002573 | Ga0068870_100025738 | 249 |
| 266 | 3300005840 | Ga0068870_10002679 | Ga0068870_100026792 | 249 |
| 267 | 3300005840 | Ga0068870_10036841 | Ga0068870_100368413 | 249 |
| 268 | 3300005841 | Ga0068863_100033403 | Ga0068863_1000334035 | 249 |
| 269 | 3300005841 | Ga0068863_100134632 | Ga0068863_1001346321 | 249 |
| 270 | 3300005841 | Ga0068863_100321371 | Ga0068863_1003213711 | 249 |
| 271 | 3300005841 | Ga0068863_100733818 | Ga0068863_1007338182 | 249 |
| 272 | 3300005842 | Ga0068858_100611731 | Ga0068858_1006117312 | 249 |
| 273 | 3300005843 | Ga0068860_100004943 | Ga0068860_10000494311 | 249 |
| 274 | 3300005843 | Ga0068860_100014679 | Ga0068860_1000146792 | 249 |
| 275 | 3300005843 | Ga0068860_100024627 | Ga0068860_1000246273 | 249 |
| 276 | 3300005843 | Ga0068860_100032340 | Ga0068860_1000323402 | 249 |
| 277 | 3300005843 | Ga0068860_100076873 | Ga0068860_1000768732 | 249 |
| 278 | 3300005843 | Ga0068860_100128907 | Ga0068860_1001289072 | 249 |
| 279 | 3300005844 | Ga0068862_100011687 | Ga0068862_1000116873 | 249 |
| 280 | 3300005844 | Ga0068862_100145587 | Ga0068862_1001455873 | 249 |
| 281 | 3300005844 | Ga0068862_100157435 | Ga0068862_1001574352 | 249 |
| 282 | 3300005844 | Ga0068862_100544408 | Ga0068862_1005444081 | 249 |
| 283 | 3300005985 | Ga0081539_10000223 | Ga0081539_1000022388 | 249 |
| 284 | 3300006195 | Ga0075366_10019311 | Ga0075366_100193112 | 249 |
| 285 | 3300006195 | Ga0075366_10049342 | Ga0075366_100493422 | 249 |
| 286 | 3300006195 | Ga0075366_10082030 | Ga0075366_100820302 | 249 |
| 287 | 3300006237 | Ga0097621_100055899 | Ga0097621_1000558994 | 249 |
| 288 | 3300006237 | Ga0097621_100261178 | Ga0097621_1002611781 | 249 |
| 289 | 3300006237 | Ga0097621_100357386 | Ga0097621_1003573862 | 249 |
| 290 | 3300006358 | Ga0068871_100162204 | Ga0068871_1001622042 | 249 |
| 291 | 3300006358 | Ga0068871_100650571 | Ga0068871_1006505711 | 249 |
| 292 | 3300006844 | Ga0075428_100055685 | Ga0075428_1000556852 | 249 |
| 293 | 3300006844 | Ga0075428_100206236 | Ga0075428_1002062362 | 249 |
| 294 | 3300006846 | Ga0075430_100003135 | Ga0075430_1000031353 | 249 |
| 295 | 3300006846 | Ga0075430_100044213 | Ga0075430_1000442132 | 249 |
| 296 | 3300006847 | Ga0075431_100028830 | Ga0075431_1000288303 | 249 |
| 297 | 3300006847 | Ga0075431_100202278 | Ga0075431_1002022781 | 249 |
| 298 | 3300006880 | Ga0075429_100142825 | Ga0075429_1001428252 | 249 |
| 299 | 3300006880 | Ga0075429_100430073 | Ga0075429_1004300732 | 249 |
| 300 | 3300006881 | Ga0068865_100001928 | Ga0068865_10000192816 | 249 |
| 301 | 3300006881 | Ga0068865_100319933 | Ga0068865_1003199331 | 249 |
| 302 | 3300006931 | Ga0097620_100007565 | Ga0097620_10000756510 | 249 |
| 303 | 3300006931 | Ga0097620_100018315 | Ga0097620_1000183156 | 249 |
| 304 | 3300006931 | Ga0097620_100027468 | Ga0097620_1000274688 | 249 |
| 305 | 3300006931 | Ga0097620_100058788 | Ga0097620_1000587881 | 249 |
| 306 | 3300006931 | Ga0097620_100073895 | Ga0097620_1000738951 | 249 |
| 307 | 3300006931 | Ga0097620_100262539 | Ga0097620_1002625392 | 249 |
| 308 | 3300009093 | Ga0105240_10000635 | Ga0105240_1000063537 | 249 |
| 309 | 3300009093 | Ga0105240_10027355 | Ga0105240_100273553 | 249 |
| 310 | 3300009093 | Ga0105240_10030822 | Ga0105240_100308223 | 249 |
| 311 | 3300009094 | Ga0111539_10631839 | Ga0111539_106318392 | 249 |
| 312 | 3300009094 | Ga0111539_10690835 | Ga0111539_106908351 | 249 |
| 313 | 3300009101 | Ga0105247_10166630 | Ga0105247_101666301 | 249 |
| 314 | 3300009147 | Ga0114129_10187129 | Ga0114129_101871292 | 249 |
| 315 | 3300009174 | Ga0105241_10005738 | Ga0105241_100057383 | 249 |
| 316 | 3300009174 | Ga0105241_10013834 | Ga0105241_100138346 | 249 |
| 317 | 3300009174 | Ga0105241_10027570 | Ga0105241_100275702 | 249 |
| 318 | 3300009176 | Ga0105242_10166053 | Ga0105242_101660531 | 249 |
| 319 | 3300009176 | Ga0105242_10518713 | Ga0105242_105187131 | 249 |
| 320 | 3300009176 | Ga0105242_10573280 | Ga0105242_105732802 | 249 |
| 321 | 3300009545 | Ga0105237_10002948 | Ga0105237_1000294813 | 249 |
| 322 | 3300009545 | Ga0105237_10025576 | Ga0105237_100255766 | 249 |
| 323 | 3300009545 | Ga0105237_10027810 | Ga0105237_100278106 | 249 |
| 324 | 3300009545 | Ga0105237_10048270 | Ga0105237_100482702 | 249 |
| 325 | 3300009551 | Ga0105238_10285865 | Ga0105238_102858651 | 249 |
| 326 | 3300009553 | Ga0105249_10003125 | Ga0105249_100031255 | 249 |
| 327 | 3300009553 | Ga0105249_10003218 | Ga0105249_100032189 | 249 |
| 328 | 3300009553 | Ga0105249_10003898 | Ga0105249_1000389810 | 249 |
| 329 | 3300009553 | Ga0105249_10048552 | Ga0105249_100485522 | 249 |
| 330 | 3300009553 | Ga0105249_10056524 | Ga0105249_100565242 | 249 |
| 331 | 3300009553 | Ga0105249_10384454 | Ga0105249_103844542 | 249 |
| 332 | 3300009553 | Ga0105249_10502117 | Ga0105249_105021171 | 249 |
| 333 | 3300009553 | Ga0105249_10557101 | Ga0105249_105571012 | 249 |
| 334 | 3300010375 | Ga0105239_10000368 | Ga0105239_1000036817 | 249 |
| 335 | 3300010375 | Ga0105239_10002663 | Ga0105239_1000266315 | 249 |
| 336 | 3300010375 | Ga0105239_10025652 | Ga0105239_100256522 | 249 |
| 337 | 3300010375 | Ga0105239_10057990 | Ga0105239_100579903 | 249 |
| 338 | 3300010375 | Ga0105239_10094004 | Ga0105239_100940044 | 249 |
| 339 | 3300011119 | Ga0105246_10021224 | Ga0105246_100212243 | 249 |
| 340 | 3300013100 | Ga0157373_10010907 | Ga0157373_100109072 | 249 |
| 341 | 3300013100 | Ga0157373_10049758 | Ga0157373_100497584 | 249 |
| 342 | 3300013102 | Ga0157371_10000494 | Ga0157371_1000049413 | 249 |
| 343 | 3300013102 | Ga0157371_10001626 | Ga0157371_100016263 | 249 |
| 344 | 3300013102 | Ga0157371_10004069 | Ga0157371_100040694 | 249 |
| 345 | 3300013102 | Ga0157371_10021743 | Ga0157371_100217433 | 249 |
| 346 | 3300013102 | Ga0157371_10036499 | Ga0157371_100364994 | 249 |
| 347 | 3300013102 | Ga0157371_10039269 | Ga0157371_100392694 | 249 |
| 348 | 3300013102 | Ga0157371_10092646 | Ga0157371_100926462 | 249 |
| 349 | 3300013102 | Ga0157371_10142457 | Ga0157371_101424572 | 249 |
| 350 | 3300013102 | Ga0157371_10167253 | Ga0157371_101672532 | 249 |
| 351 | 3300013102 | Ga0157371_10255945 | Ga0157371_102559451 | 249 |
| 352 | 3300013102 | Ga0157371_10273071 | Ga0157371_102730711 | 249 |
| 353 | 3300013102 | Ga0157371_10359515 | Ga0157371_103595151 | 249 |
| 354 | 3300013104 | Ga0157370_10001064 | Ga0157370_1000106413 | 249 |
| 355 | 3300013104 | Ga0157370_10003014 | Ga0157370_100030144 | 249 |
| 356 | 3300013104 | Ga0157370_10008406 | Ga0157370_100084066 | 249 |
| 357 | 3300013104 | Ga0157370_10017114 | Ga0157370_100171145 | 249 |
| 358 | 3300013104 | Ga0157370_10112529 | Ga0157370_101125293 | 249 |
| 359 | 3300013104 | Ga0157370_10274710 | Ga0157370_102747102 | 249 |
| 360 | 3300013104 | Ga0157370_10378830 | Ga0157370_103788302 | 249 |
| 361 | 3300013104 | Ga0157370_10497403 | Ga0157370_104974031 | 249 |
| 362 | 3300013105 | Ga0157369_10107542 | Ga0157369_101075423 | 249 |
| 363 | 3300013105 | Ga0157369_10108609 | Ga0157369_101086095 | 249 |
| 364 | 3300013105 | Ga0157369_10160957 | Ga0157369_101609574 | 249 |
| 365 | 3300013105 | Ga0157369_10184327 | Ga0157369_101843272 | 249 |
| 366 | 3300013105 | Ga0157369_10189105 | Ga0157369_101891052 | 249 |
| 367 | 3300013296 | Ga0157374_10093734 | Ga0157374_100937344 | 249 |
| 368 | 3300013296 | Ga0157374_10100813 | Ga0157374_101008134 | 249 |
| 369 | 3300013296 | Ga0157374_10123860 | Ga0157374_101238602 | 249 |
| 370 | 3300013296 | Ga0157374_10360374 | Ga0157374_103603742 | 249 |
| 371 | 3300013296 | Ga0157374_10507552 | Ga0157374_105075522 | 249 |
| 372 | 3300013297 | Ga0157378_10048302 | Ga0157378_100483023 | 249 |
| 373 | 3300013297 | Ga0157378_10152519 | Ga0157378_101525193 | 249 |
| 374 | 3300013297 | Ga0157378_10186511 | Ga0157378_101865112 | 249 |
| 375 | 3300013297 | Ga0157378_10430012 | Ga0157378_104300122 | 249 |
| 376 | 3300013306 | Ga0163162_10009899 | Ga0163162_100098999 | 249 |
| 377 | 3300013306 | Ga0163162_10055575 | Ga0163162_100555755 | 249 |
| 378 | 3300013306 | Ga0163162_10179790 | Ga0163162_101797901 | 249 |
| 379 | 3300013307 | Ga0157372_10025681 | Ga0157372_100256814 | 249 |
| 380 | 3300013307 | Ga0157372_10030554 | Ga0157372_100305545 | 249 |
| 381 | 3300013307 | Ga0157372_10061345 | Ga0157372_100613453 | 249 |
| 382 | 3300013307 | Ga0157372_10167403 | Ga0157372_101674032 | 249 |
| 383 | 3300013307 | Ga0157372_10204938 | Ga0157372_102049384 | 249 |
| 384 | 3300013307 | Ga0157372_10238603 | Ga0157372_102386032 | 249 |
| 385 | 3300013307 | Ga0157372_10258301 | Ga0157372_102583011 | 249 |
| 386 | 3300013307 | Ga0157372_10277756 | Ga0157372_102777562 | 249 |
| 387 | 3300013307 | Ga0157372_10489868 | Ga0157372_104898682 | 249 |
| 388 | 3300013307 | Ga0157372_10637876 | Ga0157372_106378762 | 249 |
| 389 | 3300013308 | Ga0157375_10066346 | Ga0157375_100663462 | 249 |
| 390 | 3300013308 | Ga0157375_10085653 | Ga0157375_100856532 | 249 |
| 391 | 3300013308 | Ga0157375_10213591 | Ga0157375_102135911 | 249 |
| 392 | 3300013308 | Ga0157375_10409018 | Ga0157375_104090182 | 249 |
| 393 | 3300013308 | Ga0157375_10649109 | Ga0157375_106491091 | 249 |
| 394 | 3300013308 | Ga0157375_11095802 | Ga0157375_110958022 | 249 |
| 395 | 3300014325 | Ga0163163_10000129 | Ga0163163_1000012918 | 249 |
| 396 | 3300014325 | Ga0163163_10073765 | Ga0163163_100737654 | 249 |
| 397 | 3300014325 | Ga0163163_10266332 | Ga0163163_102663322 | 249 |
| 398 | 3300014325 | Ga0163163_10432658 | Ga0163163_104326581 | 249 |
| 399 | 3300014325 | Ga0163163_10616899 | Ga0163163_106168991 | 249 |
| 400 | 3300014326 | Ga0157380_10006594 | Ga0157380_100065946 | 249 |
| 401 | 3300014326 | Ga0157380_10013692 | Ga0157380_100136922 | 249 |
| 402 | 3300014326 | Ga0157380_10101656 | Ga0157380_101016563 | 249 |
| 403 | 3300014326 | Ga0157380_10179169 | Ga0157380_101791692 | 249 |
| 404 | 3300014326 | Ga0157380_10345684 | Ga0157380_103456841 | 249 |
| 405 | 3300014326 | Ga0157380_10540829 | Ga0157380_105408291 | 249 |
| 406 | 3300014326 | Ga0157380_10875646 | Ga0157380_108756461 | 249 |
| 407 | 3300014745 | Ga0157377_10002037 | Ga0157377_100020372 | 249 |
| 408 | 3300014745 | Ga0157377_10021802 | Ga0157377_100218022 | 249 |
| 409 | 3300014745 | Ga0157377_10160914 | Ga0157377_101609142 | 249 |
| 410 | 3300014969 | Ga0157376_10221588 | Ga0157376_102215882 | 249 |
| 411 | 3300017792 | Ga0163161_10011166 | Ga0163161_100111664 | 249 |
| 412 | 3300017792 | Ga0163161_10233390 | Ga0163161_102333902 | 249 |
| 413 | 3300021384 | Ga0213876_10012974 | Ga0213876_100129745 | 249 |
| 414 | 3300021384 | Ga0213876_10145600 | Ga0213876_101456002 | 249 |
| 415 | 3300025246 | Ga0209646_1003581 | Ga0209646_10035812 | 249 |
| 416 | 3300025302 | Ga0207426_1000258 | Ga0207426_100025839 | 249 |
| 417 | 3300025315 | Ga0207697_10009721 | Ga0207697_100097212 | 249 |
| 418 | 3300025315 | Ga0207697_10096383 | Ga0207697_100963832 | 249 |
| 419 | 3300025315 | Ga0207697_10097219 | Ga0207697_100972192 | 249 |
| 420 | 3300025315 | Ga0207697_10148764 | Ga0207697_101487641 | 249 |
| 421 | 3300025321 | Ga0207656_10230566 | Ga0207656_102305661 | 249 |
| 422 | 3300025893 | Ga0207682_10019790 | Ga0207682_100197903 | 249 |
| 423 | 3300025893 | Ga0207682_10062178 | Ga0207682_100621782 | 249 |
| 424 | 3300025899 | Ga0207642_10015421 | Ga0207642_100154211 | 249 |
| 425 | 3300025901 | Ga0207688_10010263 | Ga0207688_100102634 | 249 |
| 426 | 3300025901 | Ga0207688_10140019 | Ga0207688_101400192 | 249 |
| 427 | 3300025904 | Ga0207647_10082748 | Ga0207647_100827483 | 249 |
| 428 | 3300025907 | Ga0207645_10000263 | Ga0207645_100002637 | 249 |
| 429 | 3300025907 | Ga0207645_10052338 | Ga0207645_100523382 | 249 |
| 430 | 3300025907 | Ga0207645_10277725 | Ga0207645_102777251 | 249 |
| 431 | 3300025908 | Ga0207643_10002440 | Ga0207643_100024405 | 249 |
| 432 | 3300025908 | Ga0207643_10004417 | Ga0207643_100044177 | 249 |
| 433 | 3300025908 | Ga0207643_10054394 | Ga0207643_100543942 | 249 |
| 434 | 3300025909 | Ga0207705_10006172 | Ga0207705_100061724 | 249 |
| 435 | 3300025909 | Ga0207705_10025699 | Ga0207705_100256995 | 249 |
| 436 | 3300025909 | Ga0207705_10061297 | Ga0207705_100612972 | 249 |
| 437 | 3300025909 | Ga0207705_10091226 | Ga0207705_100912262 | 249 |
| 438 | 3300025909 | Ga0207705_10119881 | Ga0207705_101198811 | 249 |
| 439 | 3300025911 | Ga0207654_10002271 | Ga0207654_100022713 | 249 |
| 440 | 3300025911 | Ga0207654_10122176 | Ga0207654_101221762 | 249 |
| 441 | 3300025912 | Ga0207707_10108115 | Ga0207707_101081152 | 249 |
| 442 | 3300025912 | Ga0207707_10159871 | Ga0207707_101598713 | 249 |
| 443 | 3300025913 | Ga0207695_10000446 | Ga0207695_1000044617 | 249 |
| 444 | 3300025913 | Ga0207695_10005705 | Ga0207695_100057056 | 249 |
| 445 | 3300025913 | Ga0207695_10019063 | Ga0207695_100190635 | 249 |
| 446 | 3300025914 | Ga0207671_10005043 | Ga0207671_100050438 | 249 |
| 447 | 3300025914 | Ga0207671_10285209 | Ga0207671_102852091 | 249 |
| 448 | 3300025914 | Ga0207671_10344147 | Ga0207671_103441472 | 249 |
| 449 | 3300025917 | Ga0207660_10060280 | Ga0207660_100602804 | 249 |
| 450 | 3300025917 | Ga0207660_10069501 | Ga0207660_100695013 | 249 |
| 451 | 3300025917 | Ga0207660_10263135 | Ga0207660_102631352 | 249 |
| 452 | 3300025918 | Ga0207662_10019410 | Ga0207662_100194102 | 249 |
| 453 | 3300025918 | Ga0207662_10044012 | Ga0207662_100440122 | 249 |
| 454 | 3300025919 | Ga0207657_10004643 | Ga0207657_100046431 | 249 |
| 455 | 3300025919 | Ga0207657_10044524 | Ga0207657_100445245 | 249 |
| 456 | 3300025919 | Ga0207657_10069705 | Ga0207657_100697053 | 249 |
| 457 | 3300025921 | Ga0207652_10000051 | Ga0207652_100000512 | 249 |
| 458 | 3300025921 | Ga0207652_10000614 | Ga0207652_100006144 | 249 |
| 459 | 3300025921 | Ga0207652_10081187 | Ga0207652_100811872 | 249 |
| 460 | 3300025921 | Ga0207652_10121674 | Ga0207652_101216742 | 249 |
| 461 | 3300025921 | Ga0207652_10131866 | Ga0207652_101318663 | 249 |
| 462 | 3300025921 | Ga0207652_10477456 | Ga0207652_104774561 | 249 |
| 463 | 3300025923 | Ga0207681_10020407 | Ga0207681_100204073 | 249 |
| 464 | 3300025923 | Ga0207681_10054591 | Ga0207681_100545912 | 249 |
| 465 | 3300025923 | Ga0207681_10173555 | Ga0207681_101735552 | 249 |
| 466 | 3300025923 | Ga0207681_10260147 | Ga0207681_102601472 | 249 |
| 467 | 3300025923 | Ga0207681_10447651 | Ga0207681_104476511 | 249 |
| 468 | 3300025925 | Ga0207650_10200290 | Ga0207650_102002902 | 249 |
| 469 | 3300025925 | Ga0207650_10213972 | Ga0207650_102139722 | 249 |
| 470 | 3300025926 | Ga0207659_10043227 | Ga0207659_100432273 | 249 |
| 471 | 3300025926 | Ga0207659_10171793 | Ga0207659_101717931 | 249 |
| 472 | 3300025932 | Ga0207690_10164783 | Ga0207690_101647833 | 249 |
| 473 | 3300025933 | Ga0207706_10191384 | Ga0207706_101913842 | 249 |
| 474 | 3300025933 | Ga0207706_10738248 | Ga0207706_107382481 | 249 |
| 475 | 3300025934 | Ga0207686_10020142 | Ga0207686_100201421 | 249 |
| 476 | 3300025936 | Ga0207670_10037112 | Ga0207670_100371122 | 249 |
| 477 | 3300025936 | Ga0207670_10364496 | Ga0207670_103644962 | 249 |
| 478 | 3300025936 | Ga0207670_10438822 | Ga0207670_104388221 | 249 |
| 479 | 3300025937 | Ga0207669_10033202 | Ga0207669_100332022 | 249 |
| 480 | 3300025938 | Ga0207704_10046681 | Ga0207704_100466811 | 249 |
| 481 | 3300025940 | Ga0207691_10003243 | Ga0207691_1000324314 | 249 |
| 482 | 3300025940 | Ga0207691_10010867 | Ga0207691_100108674 | 249 |
| 483 | 3300025940 | Ga0207691_10205216 | Ga0207691_102052162 | 249 |
| 484 | 3300025942 | Ga0207689_10007704 | Ga0207689_100077048 | 249 |
| 485 | 3300025942 | Ga0207689_10018354 | Ga0207689_100183545 | 249 |
| 486 | 3300025942 | Ga0207689_10301673 | Ga0207689_103016731 | 249 |
| 487 | 3300025942 | Ga0207689_10509746 | Ga0207689_105097461 | 249 |
| 488 | 3300025944 | Ga0207661_10033063 | Ga0207661_100330632 | 249 |
| 489 | 3300025949 | Ga0207667_10000150 | Ga0207667_1000015058 | 249 |
| 490 | 3300025949 | Ga0207667_10024155 | Ga0207667_100241555 | 249 |
| 491 | 3300025949 | Ga0207667_10062837 | Ga0207667_100628373 | 249 |
| 492 | 3300025949 | Ga0207667_10324314 | Ga0207667_103243142 | 249 |
| 493 | 3300025960 | Ga0207651_10036208 | Ga0207651_100362083 | 249 |
| 494 | 3300025960 | Ga0207651_10194519 | Ga0207651_101945191 | 249 |
| 495 | 3300025960 | Ga0207651_10264242 | Ga0207651_102642422 | 249 |
| 496 | 3300025960 | Ga0207651_10333861 | Ga0207651_103338612 | 249 |
| 497 | 3300025961 | Ga0207712_10001366 | Ga0207712_100013664 | 249 |
| 498 | 3300025961 | Ga0207712_10009499 | Ga0207712_100094992 | 249 |
| 499 | 3300025961 | Ga0207712_10023399 | Ga0207712_100233995 | 249 |
| 500 | 3300025961 | Ga0207712_10026721 | Ga0207712_100267212 | 249 |
| 501 | 3300025972 | Ga0207668_10031257 | Ga0207668_100312572 | 249 |
| 502 | 3300025972 | Ga0207668_10044922 | Ga0207668_100449223 | 249 |
| 503 | 3300025972 | Ga0207668_10102538 | Ga0207668_101025382 | 249 |
| 504 | 3300025972 | Ga0207668_10540995 | Ga0207668_105409952 | 249 |
| 505 | 3300025981 | Ga0207640_10334023 | Ga0207640_103340231 | 249 |
| 506 | 3300025981 | Ga0207640_10479294 | Ga0207640_104792941 | 249 |
| 507 | 3300025981 | Ga0207640_10520082 | Ga0207640_105200821 | 249 |
| 508 | 3300025986 | Ga0207658_10103400 | Ga0207658_101034001 | 249 |
| 509 | 3300025986 | Ga0207658_10602197 | Ga0207658_106021971 | 249 |
| 510 | 3300025986 | Ga0207658_10684404 | Ga0207658_106844041 | 249 |
| 511 | 3300026023 | Ga0207677_10631056 | Ga0207677_106310561 | 249 |
| 512 | 3300026035 | Ga0207703_10603213 | Ga0207703_106032131 | 249 |
| 513 | 3300026041 | Ga0207639_10006001 | Ga0207639_100060017 | 249 |
| 514 | 3300026041 | Ga0207639_10119917 | Ga0207639_101199172 | 249 |
| 515 | 3300026041 | Ga0207639_10861182 | Ga0207639_108611821 | 249 |
| 516 | 3300026078 | Ga0207702_10200284 | Ga0207702_102002842 | 249 |
| 517 | 3300026088 | Ga0207641_10001405 | Ga0207641_100014055 | 249 |
| 518 | 3300026088 | Ga0207641_10090858 | Ga0207641_100908581 | 249 |
| 519 | 3300026088 | Ga0207641_10378379 | Ga0207641_103783792 | 249 |
| 520 | 3300026088 | Ga0207641_10487497 | Ga0207641_104874972 | 249 |
| 521 | 3300026089 | Ga0207648_10002644 | Ga0207648_100026444 | 249 |
| 522 | 3300026095 | Ga0207676_10261190 | Ga0207676_102611902 | 249 |
| 523 | 3300026095 | Ga0207676_10353591 | Ga0207676_103535912 | 249 |
| 524 | 3300026095 | Ga0207676_10441505 | Ga0207676_104415052 | 249 |
| 525 | 3300026116 | Ga0207674_10001856 | Ga0207674_100018564 | 249 |
| 526 | 3300026116 | Ga0207674_10053595 | Ga0207674_100535952 | 249 |
| 527 | 3300026116 | Ga0207674_10077852 | Ga0207674_100778521 | 249 |
| 528 | 3300026116 | Ga0207674_10181400 | Ga0207674_101814002 | 249 |
| 529 | 3300026118 | Ga0207675_100003498 | Ga0207675_1000034987 | 249 |
| 530 | 3300026118 | Ga0207675_100006997 | Ga0207675_1000069974 | 249 |
| 531 | 3300026118 | Ga0207675_100011111 | Ga0207675_10001111111 | 249 |
| 532 | 3300026118 | Ga0207675_100136537 | Ga0207675_1001365371 | 249 |
| 533 | 3300026118 | Ga0207675_100836763 | Ga0207675_1008367632 | 249 |
| 534 | 3300026121 | Ga0207683_10000943 | Ga0207683_1000094316 | 249 |
| 535 | 3300026121 | Ga0207683_10215994 | Ga0207683_102159941 | 249 |
| 536 | 3300026121 | Ga0207683_10285839 | Ga0207683_102858392 | 249 |
| 537 | 3300026142 | Ga0207698_10004744 | Ga0207698_100047441 | 249 |
| 538 | 3300026142 | Ga0207698_10025059 | Ga0207698_100250592 | 249 |
| 539 | 3300026142 | Ga0207698_10319375 | Ga0207698_103193752 | 249 |
| 540 | 3300026142 | Ga0207698_10861439 | Ga0207698_108614391 | 249 |
| 541 | 3300027907 | Ga0207428_10470496 | Ga0207428_104704961 | 249 |
| 542 | 3300028379 | Ga0268266_10398009 | Ga0268266_103980092 | 249 |
| 543 | 3300028380 | Ga0268265_10016719 | Ga0268265_100167194 | 249 |
| 544 | 3300028380 | Ga0268265_10116090 | Ga0268265_101160902 | 249 |
| 545 | 3300028380 | Ga0268265_10221874 | Ga0268265_102218742 | 249 |
| 546 | 3300028380 | Ga0268265_10224769 | Ga0268265_102247691 | 249 |
| 547 | 3300028381 | Ga0268264_10036247 | Ga0268264_100362473 | 249 |
| 548 | 3300028381 | Ga0268264_10046441 | Ga0268264_100464412 | 249 |
| 549 | 3300028381 | Ga0268264_10190068 | Ga0268264_101900682 | 249 |
| 550 | 3300028381 | Ga0268264_10351178 | Ga0268264_103511782 | 249 |
| 551 | 3300028786 | Ga0307517_10107496 | Ga0307517_101074963 | 249 |
| 552 | 3300030522 | Ga0307512_10139691 | Ga0307512_101396912 | 249 |
| 553 | 3300031251 | Ga0265327_10000148 | Ga0265327_1000014862 | 249 |
| 554 | 3300031251 | Ga0265327_10006106 | Ga0265327_100061062 | 249 |
| 555 | 3300031251 | Ga0265327_10089082 | Ga0265327_100890822 | 249 |
| 556 | 3300031251 | Ga0265327_10091403 | Ga0265327_100914032 | 249 |
| 557 | 3300031456 | Ga0307513_10125869 | Ga0307513_101258692 | 249 |
| 558 | 3300031507 | Ga0307509_10167093 | Ga0307509_101670932 | 249 |
| 559 | 3300031595 | Ga0265313_10012879 | Ga0265313_100128795 | 249 |
| 560 | 3300031730 | Ga0307516_10165356 | Ga0307516_101653562 | 249 |
| 561 | 3300031730 | Ga0307516_10224045 | Ga0307516_102240452 | 249 |
| 562 | 3300032005 | Ga0307411_10253122 | Ga0307411_102531222 | 249 |
| 563 | 3300033180 | Ga0307510_10000042 | Ga0307510_1000004232 | 249 |
| 564 | 3300035695 | Ga0373927_0215912 | Ga0373927_0215912_419_1168 | 249 |
| 565 | 3300037068 | Ga0373925_0172357 | Ga0373925_0172357_318_1067 | 249 |
| 566 | 3300037312 | Ga0395899_0007352 | Ga0395899_0007352_4122_4877 | 249 |
| 567 | 3300037312 | Ga0395899_0011758 | Ga0395899_0011758_2837_3592 | 249 |
| 568 | 3300037312 | Ga0395899_0068454 | Ga0395899_0068454_1815_2570 | 249 |
| 569 | 3300037312 | Ga0395899_0110249 | Ga0395899_0110249_227_982 | 249 |
| 570 | 3300037418 | Ga0395900_0016503 | Ga0395900_0016503_5750_6505 | 249 |
| 571 | 3300037418 | Ga0395900_0046549 | Ga0395900_0046549_584_1462 | 249 |
| 572 | 3300037418 | Ga0395900_0114897 | Ga0395900_0114897_321_1076 | 249 |
| 573 | 3300037418 | Ga0395900_0160845 | Ga0395900_0160845_436_1191 | 249 |
| 574 | 3300037418 | Ga0395900_0170725 | Ga0395900_0170725_1184_1939 | 249 |
| 575 | 3300037418 | Ga0395900_0717142 | Ga0395900_0717142_116_871 | 249 |
| 576 | 3300037466 | Ga0395898_0001425 | Ga0395898_0001425_28599_29354 | 249 |
| 577 | 3300037466 | Ga0395898_0034774 | Ga0395898_0034774_2854_3609 | 249 |
| 578 | 3300037466 | Ga0395898_0073958 | Ga0395898_0073958_2166_2921 | 249 |
| 579 | 3300037466 | Ga0395898_0091609 | Ga0395898_0091609_1988_2743 | 249 |
| 580 | 3300037466 | Ga0395898_0203725 | Ga0395898_0203725_365_1243 | 249 |
| 581 | 3300037471 | Ga0395905_0004544 | Ga0395905_0004544_106_855 | 249 |
| 582 | 3300037471 | Ga0395905_0020976 | Ga0395905_0020976_3747_4496 | 249 |
| 583 | 3300037471 | Ga0395905_0067486 | Ga0395905_0067486_1668_2423 | 249 |
| 584 | 3300038443 | Ga0395901_0006414 | Ga0395901_0006414_9810_10565 | 249 |
| 585 | 3300038443 | Ga0395901_0037225 | Ga0395901_0037225_4119_4874 | 249 |
| 586 | 3300038443 | Ga0395901_0240064 | Ga0395901_0240064_979_1734 | 249 |
| 587 | 3300038443 | Ga0395901_0302386 | Ga0395901_0302386_392_1147 | 249 |
| 588 | 3300039437 | Ga0436365_0153361 | Ga0436365_0153361_257_1009 | 249 |
| 589 | 3300039437 | Ga0436365_0169461 | Ga0436365_0169461_1192_1944 | 249 |
| 590 | 3300039437 | Ga0436365_0298838 | Ga0436365_0298838_3009_3764 | 249 |
| 591 | 3300039437 | Ga0436365_1415753 | Ga0436365_1415753_1523_2272 | 249 |
| 592 | 3300041404 | Ga0439436_0005974 | Ga0439436_0005974_2562_3311 | 249 |
| 593 | 3300041413 | Ga0439465_0011935 | Ga0439465_0011935_1162_1911 | 249 |
| 594 | 3300041451 | Ga0451791_0456665 | Ga0451791_0456665_697_1446 | 249 |
| 595 | 3300041486 | Ga0451807_1365644 | Ga0451807_1365644_184_933 | 249 |
| 596 | 3300041505 | Ga0451849_0299315 | Ga0451849_0299315_47_796 | 249 |
| 597 | 3300041997 | Ga0439431_0011275 | Ga0439431_0011275_741_1490 | 249 |
| 598 | 3300042002 | Ga0439442_008572 | Ga0439442_008572_1246_1995 | 249 |
| 599 | 3300042004 | Ga0439445_0005014 | Ga0439445_0005014_416_1165 | 249 |
| 600 | 3300042007 | Ga0439449_0005127 | Ga0439449_0005127_647_1396 | 249 |
| 601 | 3300042007 | Ga0439449_0019046 | Ga0439449_0019046_52_801 | 249 |
| 602 | 3300042007 | Ga0439449_0059046 | Ga0439449_0059046_146_895 | 249 |
| 603 | 3300042014 | Ga0439457_000452 | Ga0439457_000452_2436_3185 | 249 |
| 604 | 3300042014 | Ga0439457_018898 | Ga0439457_018898_750_1499 | 249 |
| 605 | 3300042015 | Ga0439462_0028840 | Ga0439462_0028840_555_1304 | 249 |
| 606 | 3300044656 | Ga0466969_0000082 | Ga0466969_0000082_43289_44038 | 249 |
| 607 | 3300044658 | Ga0466972_0000226 | Ga0466972_0000226_38541_39290 | 249 |
| 608 | 3300044673 | Ga0453683_0144086 | Ga0453683_0144086_157_906 | 249 |
| 609 | 3300044684 | Ga0466966_0000162 | Ga0466966_0000162_5443_6192 | 249 |
| 610 | 3300044693 | Ga0466961_0257819 | Ga0466961_0257819_250_999 | 249 |
| 611 | 3300044706 | Ga0466964_0023681 | Ga0466964_0023681_1160_1912 | 249 |
| 612 | 3300044712 | Ga0453684_0068125 | Ga0453684_0068125_970_1728 | 249 |
| 613 | 3300044712 | Ga0453684_1173423 | Ga0453684_1173423_21_776 | 249 |
| 614 | 3300044735 | Ga0466968_0010921 | Ga0466968_0010921_1697_2446 | 249 |
| 615 | 3300044735 | Ga0466968_0182869 | Ga0466968_0182869_185_937 | 249 |
| 616 | 3300044842 | Ga0466957_0000673 | Ga0466957_0000673_9142_9894 | 249 |
| 617 | 3300044901 | Ga0466960_0122825 | Ga0466960_0122825_198_947 | 249 |
| 618 | 3300045049 | Ga0466959_0000077 | Ga0466959_0000077_12487_13236 | 249 |
| 619 | 3300045976 | Ga0466967_0520304 | Ga0466967_0520304_41_793 | 249 |
| 620 | 3300046499 | Ga0495594_0127585 | Ga0495594_0127585_311_1060 | 249 |
| 621 | 3300046507 | Ga0495606_0005751 | Ga0495606_0005751_4466_5218 | 249 |
| 622 | 3300046522 | Ga0495643_0038623 | Ga0495643_0038623_305_1054 | 249 |
| 623 | 3300046537 | Ga0495598_0105781 | Ga0495598_0105781_77_826 | 249 |
| 624 | 3300046543 | Ga0495645_0102790 | Ga0495645_0102790_1181_1936 | 249 |
| 625 | 3300046616 | Ga0495668_0003042 | Ga0495668_0003042_4949_5704 | 249 |
| 626 | 3300046648 | Ga0495611_0000011 | Ga0495611_0000011_114239_114991 | 249 |
| 627 | 3300047318 | Ga0495636_0128017 | Ga0495636_0128017_113_862 | 249 |
| 628 | 3300047320 | Ga0495672_0012712 | Ga0495672_0012712_846_1595 | 249 |
| 629 | 3300047472 | Ga0495686_0016543 | Ga0495686_0016543_611_1360 | 249 |
| 630 | 3300049569 | Ga0501032_0011965 | Ga0501032_0011965_5438_6187 | 249 |
| 631 | 3300049569 | Ga0501032_0034263 | Ga0501032_0034263_1214_1963 | 249 |
| 632 | 3300049570 | Ga0501033_0010920 | Ga0501033_0010920_1677_2426 | 249 |
| 633 | 3300049571 | Ga0501034_0007951 | Ga0501034_0007951_2772_3521 | 249 |
| 634 | 3300049571 | Ga0501034_0014056 | Ga0501034_0014056_5161_5913 | 249 |
| 635 | 3300049571 | Ga0501034_0020625 | Ga0501034_0020625_2767_3612 | 249 |
| 636 | 3300049571 | Ga0501034_0024371 | Ga0501034_0024371_5068_5823 | 249 |
| 637 | 3300049571 | Ga0501034_0040672 | Ga0501034_0040672_179_928 | 249 |
| 638 | 3300049571 | Ga0501034_0834615 | Ga0501034_0834615_42_791 | 249 |
| 639 | 3300049572 | Ga0501036_0058612 | Ga0501036_0058612_1426_2175 | 249 |
| 640 | 3300049572 | Ga0501036_0605010 | Ga0501036_0605010_140_895 | 249 |
| 641 | 3300049572 | Ga0501036_0682384 | Ga0501036_0682384_71_820 | 249 |
| 642 | 3300049573 | Ga0501037_0017921 | Ga0501037_0017921_3300_4049 | 249 |
| 643 | 3300049573 | Ga0501037_0029493 | Ga0501037_0029493_39_788 | 249 |
| 644 | 3300049573 | Ga0501037_0138975 | Ga0501037_0138975_87_842 | 249 |
| 645 | 3300049573 | Ga0501037_0201350 | Ga0501037_0201350_597_1346 | 249 |
| 646 | 3300049574 | Ga0501038_0063668 | Ga0501038_0063668_975_1724 | 249 |
| 647 | 3300049579 | Ga0501043_0025587 | Ga0501043_0025587_2449_3198 | 249 |
| 648 | 3300049579 | Ga0501043_0530827 | Ga0501043_0530827_32_781 | 249 |
| 649 | 3300049581 | Ga0501047_0010456 | Ga0501047_0010456_6776_7525 | 249 |
| 650 | 3300049581 | Ga0501047_0014516 | Ga0501047_0014516_5351_6100 | 249 |
| 651 | 3300049581 | Ga0501047_0071661 | Ga0501047_0071661_1102_1851 | 249 |
| 652 | 3300049581 | Ga0501047_0340047 | Ga0501047_0340047_289_1038 | 249 |
| 653 | 3300049582 | Ga0501048_0037369 | Ga0501048_0037369_1568_2317 | 249 |
| 654 | 3300049583 | Ga0501067_0031611 | Ga0501067_0031611_927_1676 | 249 |
| 655 | 3300049586 | Ga0501070_0043109 | Ga0501070_0043109_566_1411 | 249 |
| 656 | 3300049586 | Ga0501070_0064010 | Ga0501070_0064010_1449_2198 | 249 |
| 657 | 3300049589 | Ga0501073_0094626 | Ga0501073_0094626_513_1262 | 249 |
| 658 | 3300049589 | Ga0501073_0365422 | Ga0501073_0365422_34_783 | 249 |
| 659 | 3300049590 | Ga0501074_0012848 | Ga0501074_0012848_969_1718 | 249 |
| 660 | 3300049669 | Ga0501235_033679 | Ga0501235_033679_361_1110 | 249 |
| 661 | 3300049703 | Ga0501219_000096 | Ga0501219_000096_4426_5175 | 249 |
| 662 | 3300049705 | Ga0501225_0005775 | Ga0501225_0005775_446_1195 | 249 |
| 663 | 3300049741 | Ga0501079_0211643 | Ga0501079_0211643_701_1450 | 249 |
| 664 | 3300049742 | Ga0501080_0206677 | Ga0501080_0206677_292_1041 | 249 |
| 665 | 3300049822 | Ga0501035_0017551 | Ga0501035_0017551_3618_4373 | 249 |
| 666 | 3300049822 | Ga0501035_0020579 | Ga0501035_0020579_4926_5675 | 249 |
| 667 | 3300049822 | Ga0501035_0034818 | Ga0501035_0034818_2228_2977 | 249 |
| 668 | 3300049822 | Ga0501035_0071998 | Ga0501035_0071998_1113_1862 | 249 |
| 669 | 3300049823 | Ga0501044_0024861 | Ga0501044_0024861_2230_2979 | 249 |
| 670 | 3300049823 | Ga0501044_0126575 | Ga0501044_0126575_194_949 | 249 |
| 671 | 3300049823 | Ga0501044_0131607 | Ga0501044_0131607_110_859 | 249 |
| 672 | 3300049823 | Ga0501044_0184568 | Ga0501044_0184568_475_1224 | 249 |
| 673 | 3300049823 | Ga0501044_0379902 | Ga0501044_0379902_466_1311 | 249 |
| 674 | 3300049823 | Ga0501044_0605743 | Ga0501044_0605743_69_824 | 249 |
| 675 | 3300050005 | Ga0501284_00101 | Ga0501284_00101_14252_15001 | 249 |
| 676 | 3300050493 | nmdc:mga0k408_1636_c1 | nmdc:mga0k408_1636_c1_3297_4046 | 249 |
| 677 | 3300050508 | nmdc:mga09592_165397_c1 | nmdc:mga09592_165397_c1_997_1746 | 249 |
| 678 | 3300050508 | nmdc:mga09592_210214_c1 | nmdc:mga09592_210214_c1_375_1124 | 249 |
| 679 | 3300050509 | nmdc:mga0qj67_10091_c1 | nmdc:mga0qj67_10091_c1_1372_2121 | 249 |
| 680 | 3300050509 | nmdc:mga0qj67_80584_c1 | nmdc:mga0qj67_80584_c1_1326_2075 | 249 |
| 681 | 3300050511 | nmdc:mga08y16_301704_c1 | nmdc:mga08y16_301704_c1_887_1639 | 249 |
| 682 | 3300050511 | nmdc:mga08y16_776412_c1 | nmdc:mga08y16_776412_c1_53_802 | 249 |
| 683 | 3300053086 | Ga0500578_0008966 | Ga0500578_0008966_3748_4497 | 249 |
| 684 | 3300053086 | Ga0500578_0010664 | Ga0500578_0010664_4950_5699 | 249 |
| 685 | 3300053090 | Ga0500646_0041006 | Ga0500646_0041006_282_1031 | 249 |
| 686 | 3300053092 | Ga0500583_0000180 | Ga0500583_0000180_3850_4599 | 249 |
| 687 | 3300053092 | Ga0500583_0006538 | Ga0500583_0006538_2130_2879 | 249 |
| 688 | 3300053092 | Ga0500583_0147196 | Ga0500583_0147196_11_769 | 249 |
| 689 | 3300053103 | Ga0500555_027869 | Ga0500555_027869_446_1195 | 249 |
| 690 | 3300053136 | Ga0500559_0020352 | Ga0500559_0020352_544_1299 | 249 |
| 691 | 3300053146 | Ga0500588_0008405 | Ga0500588_0008405_715_1464 | 249 |
| 692 | 3300053151 | Ga0500604_0009128 | Ga0500604_0009128_874_1632 | 249 |
| 693 | 3300053151 | Ga0500604_0050660 | Ga0500604_0050660_184_933 | 249 |
| 694 | 3300053153 | Ga0500616_0073222 | Ga0500616_0073222_229_978 | 249 |
| 695 | 3300053153 | Ga0500616_0145608 | Ga0500616_0145608_30_779 | 249 |
| 696 | 3300053156 | Ga0500622_0087709 | Ga0500622_0087709_263_1021 | 249 |
| 697 | 3300053156 | Ga0500622_0104811 | Ga0500622_0104811_568_1317 | 249 |
| 698 | 3300053177 | Ga0500636_0237655 | Ga0500636_0237655_34_783 | 249 |
| 699 | 3300053727 | Ga0500611_000002 | Ga0500611_000002_86926_87675 | 249 |
| 700 | 3300054114 | Ga0501084_0585202 | Ga0501084_0585202_142_891 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar