F476061
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 329 | 694 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0238233|Ga0501083_0238233_70_630 |
| Length | 186 |
| Sequence | VKGGETFAPPAPERYNPHQLQWETRTMTIKVGDKVPSAVLMEMQDGGPKPVKTDDLFAGKKVVLFALPGAFTPTCSAKHVPGFVQNFDELKKKGIDEVACVSVNDAFVMGAWGKDQKSDGKVRMLADGNGDFTRAVGLEMDGSRFGMGKRSQRYAMIVDNGVVKELNVEEPGAFSVSSAEHILGQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 71 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 72 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 73 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 74 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 108 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 109 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 110 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 213 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 226 | 3300044649 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4E | Metagenome | Unclassified |
| 227 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 228 | 3300044651 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC4E | Metagenome | Unclassified |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 231 | 3300044660 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 | Metagenome | Unclassified |
| 232 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 233 | 3300044662 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E | Metagenome | Unclassified |
| 234 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 235 | 3300044665 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E | Metagenome | Unclassified |
| 236 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 237 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 238 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 239 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 240 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 241 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048619 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC3E | Metagenome | Unclassified |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 282 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 321 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 322 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 326 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 0.43 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.86 |
| Nodule | 1.86 |
| Rhizoplane | 0.86 |
| Rhizosphere | 85.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1023279 | 3300001915 | Bacteria | 956 |
| 2 | JGI24740J21852_10050168 | 3300001979 | Bacteria | 1202 |
| 3 | JGI24735J21928_10075824 | 3300002067 | Bacteria | 963 |
| 4 | JGI25153J46596_10000638 | 3300003215 | Bacteria | 21413 |
| 5 | Ga0070658_10002507 | 3300005327 | Bacteria | 15338 |
| 6 | Ga0070658_10020976 | 3300005327 | Bacteria | 5234 |
| 7 | Ga0070658_10043431 | 3300005327 | Bacteria | 3631 |
| 8 | Ga0070658_10248743 | 3300005327 | Bacteria | 1508 |
| 9 | Ga0070658_10777845 | 3300005327 | Bacteria | 831 |
| 10 | Ga0070683_100095395 | 3300005329 | Bacteria | 2797 |
| 11 | Ga0070683_100319963 | 3300005329 | Bacteria | 1476 |
| 12 | Ga0070670_100059618 | 3300005331 | Bacteria | 3276 |
| 13 | Ga0068869_100004900 | 3300005334 | Bacteria | 8376 |
| 14 | Ga0068869_100234412 | 3300005334 | Bacteria | 1460 |
| 15 | Ga0070666_10000705 | 3300005335 | Bacteria | 20271 |
| 16 | Ga0070666_10042849 | 3300005335 | Bacteria | 3029 |
| 17 | Ga0070666_10046551 | 3300005335 | Bacteria | 2910 |
| 18 | Ga0070680_100001303 | 3300005336 | Bacteria | 18065 |
| 19 | Ga0070680_100026152 | 3300005336 | Bacteria | 4667 |
| 20 | Ga0070682_101245514 | 3300005337 | Bacteria | 630 |
| 21 | Ga0068868_100283240 | 3300005338 | Bacteria | 1403 |
| 22 | Ga0068868_100421367 | 3300005338 | Bacteria | 1156 |
| 23 | Ga0068868_100898465 | 3300005338 | Bacteria | 805 |
| 24 | Ga0070660_100001448 | 3300005339 | Bacteria | 16219 |
| 25 | Ga0070660_100006467 | 3300005339 | Bacteria | 8125 |
| 26 | Ga0070661_100094609 | 3300005344 | Bacteria | 2215 |
| 27 | Ga0070661_100147573 | 3300005344 | Bacteria | 1776 |
| 28 | Ga0070661_100434221 | 3300005344 | Bacteria | 1043 |
| 29 | Ga0070661_100503339 | 3300005344 | Bacteria | 970 |
| 30 | Ga0070692_10050671 | 3300005345 | Bacteria | 2157 |
| 31 | Ga0070668_100021438 | 3300005347 | Bacteria | 4881 |
| 32 | Ga0070669_100005327 | 3300005353 | Bacteria | 9288 |
| 33 | Ga0070669_100008465 | 3300005353 | Bacteria | 7345 |
| 34 | Ga0070671_100000695 | 3300005355 | Bacteria | 24129 |
| 35 | Ga0070673_100015368 | 3300005364 | Bacteria | 5375 |
| 36 | Ga0070673_100303682 | 3300005364 | Bacteria | 1406 |
| 37 | Ga0070667_100000067 | 3300005367 | Bacteria | 133023 |
| 38 | Ga0070667_100030809 | 3300005367 | Bacteria | 4473 |
| 39 | Ga0070667_101438179 | 3300005367 | Bacteria | 647 |
| 40 | Ga0070709_10075519 | 3300005434 | Bacteria | 2186 |
| 41 | Ga0070714_100131871 | 3300005435 | Bacteria | 2234 |
| 42 | Ga0070714_100749800 | 3300005435 | Bacteria | 944 |
| 43 | Ga0070714_101188842 | 3300005435 | Bacteria | 744 |
| 44 | Ga0070711_100058664 | 3300005439 | Bacteria | 2669 |
| 45 | Ga0070711_100883509 | 3300005439 | Bacteria | 762 |
| 46 | Ga0070663_101507080 | 3300005455 | Bacteria | 598 |
| 47 | Ga0070678_100036663 | 3300005456 | Bacteria | 3434 |
| 48 | Ga0070678_100139137 | 3300005456 | Bacteria | 1940 |
| 49 | Ga0070678_100724715 | 3300005456 | Bacteria | 898 |
| 50 | Ga0070681_10127599 | 3300005458 | Bacteria | 2477 |
| 51 | Ga0070681_10141566 | 3300005458 | Bacteria | 2335 |
| 52 | Ga0070681_10361582 | 3300005458 | Bacteria | 1362 |
| 53 | Ga0068867_100001185 | 3300005459 | Bacteria | 17878 |
| 54 | Ga0070679_100033836 | 3300005530 | Bacteria | 5061 |
| 55 | Ga0070679_100113247 | 3300005530 | Bacteria | 2698 |
| 56 | Ga0070679_100285106 | 3300005530 | Bacteria | 1604 |
| 57 | Ga0070684_100125515 | 3300005535 | Bacteria | 2311 |
| 58 | Ga0070697_101285489 | 3300005536 | Bacteria | 653 |
| 59 | Ga0068853_100004020 | 3300005539 | Bacteria | 11310 |
| 60 | Ga0068853_100050778 | 3300005539 | Bacteria | 3568 |
| 61 | Ga0068853_100229881 | 3300005539 | Bacteria | 1696 |
| 62 | Ga0068853_100423464 | 3300005539 | Bacteria | 1249 |
| 63 | Ga0068853_100686852 | 3300005539 | Bacteria | 976 |
| 64 | Ga0068853_100716685 | 3300005539 | Bacteria | 955 |
| 65 | Ga0070672_100520815 | 3300005543 | Bacteria | 1030 |
| 66 | Ga0070686_100001243 | 3300005544 | Bacteria | 14469 |
| 67 | Ga0070686_100313039 | 3300005544 | Bacteria | 1168 |
| 68 | Ga0070695_100022943 | 3300005545 | Bacteria | 3830 |
| 69 | Ga0070693_100733174 | 3300005547 | Bacteria | 727 |
| 70 | Ga0070665_100000054 | 3300005548 | Bacteria | 244426 |
| 71 | Ga0070665_100000381 | 3300005548 | Bacteria | 65638 |
| 72 | Ga0070665_100022694 | 3300005548 | Bacteria | 6318 |
| 73 | Ga0070665_100073535 | 3300005548 | Bacteria | 3424 |
| 74 | Ga0070665_100197740 | 3300005548 | Bacteria | 2011 |
| 75 | Ga0070665_100303207 | 3300005548 | Bacteria | 1600 |
| 76 | Ga0070665_100510600 | 3300005548 | Bacteria | 1213 |
| 77 | Ga0070665_101245034 | 3300005548 | Bacteria | 754 |
| 78 | Ga0068855_100003927 | 3300005563 | Bacteria | 18145 |
| 79 | Ga0068855_100009886 | 3300005563 | Bacteria | 11506 |
| 80 | Ga0068855_100014131 | 3300005563 | Bacteria | 9618 |
| 81 | Ga0068855_100199426 | 3300005563 | Bacteria | 2254 |
| 82 | Ga0068855_101386048 | 3300005563 | Bacteria | 725 |
| 83 | Ga0070664_100200182 | 3300005564 | Bacteria | 1782 |
| 84 | Ga0070664_100706132 | 3300005564 | Bacteria | 940 |
| 85 | Ga0070664_101081989 | 3300005564 | Bacteria | 755 |
| 86 | Ga0068857_100004348 | 3300005577 | Bacteria | 11963 |
| 87 | Ga0068857_100012392 | 3300005577 | Bacteria | 7421 |
| 88 | Ga0068857_100016119 | 3300005577 | Bacteria | 6546 |
| 89 | Ga0068857_100072280 | 3300005577 | Bacteria | 3074 |
| 90 | Ga0068857_100260184 | 3300005577 | Bacteria | 1592 |
| 91 | Ga0068854_101030895 | 3300005578 | Bacteria | 730 |
| 92 | Ga0068856_100049908 | 3300005614 | Bacteria | 4124 |
| 93 | Ga0068856_100053267 | 3300005614 | Bacteria | 3989 |
| 94 | Ga0068856_100183712 | 3300005614 | Bacteria | 2105 |
| 95 | Ga0068856_100305833 | 3300005614 | Bacteria | 1608 |
| 96 | Ga0068856_100341055 | 3300005614 | Bacteria | 1516 |
| 97 | Ga0070702_100600551 | 3300005615 | Bacteria | 825 |
| 98 | Ga0068852_100011185 | 3300005616 | Bacteria | 6741 |
| 99 | Ga0068852_100120461 | 3300005616 | Bacteria | 2401 |
| 100 | Ga0068852_101477709 | 3300005616 | Bacteria | 702 |
| 101 | Ga0068859_100001205 | 3300005617 | Bacteria | 26395 |
| 102 | Ga0068864_100159765 | 3300005618 | Bacteria | 2048 |
| 103 | Ga0068864_100309543 | 3300005618 | Bacteria | 1481 |
| 104 | Ga0068866_10021161 | 3300005718 | Bacteria | 2992 |
| 105 | Ga0068851_10078834 | 3300005834 | Bacteria | 1716 |
| 106 | Ga0068870_10229807 | 3300005840 | Bacteria | 1140 |
| 107 | Ga0068870_10234827 | 3300005840 | Bacteria | 1129 |
| 108 | Ga0068863_100000038 | 3300005841 | Bacteria | 161477 |
| 109 | Ga0068863_100028623 | 3300005841 | Bacteria | 5319 |
| 110 | Ga0068863_100038586 | 3300005841 | Bacteria | 4543 |
| 111 | Ga0068863_100061246 | 3300005841 | Bacteria | 3558 |
| 112 | Ga0068858_100008493 | 3300005842 | Bacteria | 9869 |
| 113 | Ga0068858_100075974 | 3300005842 | Bacteria | 3121 |
| 114 | Ga0068858_100084085 | 3300005842 | Bacteria | 2960 |
| 115 | Ga0068858_100201926 | 3300005842 | Bacteria | 1880 |
| 116 | Ga0068858_100749396 | 3300005842 | Bacteria | 951 |
| 117 | Ga0068860_100009064 | 3300005843 | Bacteria | 9902 |
| 118 | Ga0068860_100983943 | 3300005843 | Bacteria | 861 |
| 119 | Ga0068862_100159020 | 3300005844 | Bacteria | 2016 |
| 120 | Ga0068862_100401047 | 3300005844 | Bacteria | 1283 |
| 121 | Ga0068862_100415732 | 3300005844 | Bacteria | 1261 |
| 122 | Ga0070716_100069799 | 3300006173 | Bacteria | 2061 |
| 123 | Ga0070716_100231774 | 3300006173 | Bacteria | 1247 |
| 124 | Ga0070716_100868279 | 3300006173 | Bacteria | 704 |
| 125 | Ga0070712_100002269 | 3300006175 | Bacteria | 11837 |
| 126 | Ga0097621_100000201 | 3300006237 | Bacteria | 38886 |
| 127 | Ga0097621_100242673 | 3300006237 | Bacteria | 1575 |
| 128 | Ga0097621_100483268 | 3300006237 | Bacteria | 1120 |
| 129 | Ga0068871_100000805 | 3300006358 | Bacteria | 21096 |
| 130 | Ga0068871_100105402 | 3300006358 | Bacteria | 2366 |
| 131 | Ga0068871_100355575 | 3300006358 | Bacteria | 1296 |
| 132 | Ga0068871_101253175 | 3300006358 | Bacteria | 696 |
| 133 | Ga0075428_100167037 | 3300006844 | Bacteria | 2387 |
| 134 | Ga0075430_100256307 | 3300006846 | Bacteria | 1449 |
| 135 | Ga0075431_100133138 | 3300006847 | Bacteria | 2564 |
| 136 | Ga0075434_100055652 | 3300006871 | Bacteria | 3931 |
| 137 | Ga0075434_100898451 | 3300006871 | Bacteria | 901 |
| 138 | Ga0075429_100524725 | 3300006880 | Bacteria | 1038 |
| 139 | Ga0068865_100004736 | 3300006881 | Bacteria | 8219 |
| 140 | Ga0068865_100178257 | 3300006881 | Bacteria | 1635 |
| 141 | Ga0075436_100051561 | 3300006914 | Bacteria | 2839 |
| 142 | Ga0075436_100106589 | 3300006914 | Bacteria | 1955 |
| 143 | Ga0097620_100001205 | 3300006931 | Bacteria | 26395 |
| 144 | Ga0099825_1002016 | 3300006941 | Eukaryota | 26637 |
| 145 | Ga0099824_1002564 | 3300006942 | Eukaryota | 26613 |
| 146 | Ga0099822_1000027 | 3300006943 | Eukaryota | 64204 |
| 147 | Ga0099823_1001895 | 3300006944 | Eukaryota | 18167 |
| 148 | Ga0099826_10002277 | 3300006948 | Eukaryota | 12280 |
| 149 | Ga0075435_100250145 | 3300007076 | Bacteria | 1509 |
| 150 | Ga0099794_10416545 | 3300007265 | Bacteria | 702 |
| 151 | Ga0105240_10004317 | 3300009093 | Bacteria | 21704 |
| 152 | Ga0105240_10023171 | 3300009093 | Bacteria | 8221 |
| 153 | Ga0105240_10032760 | 3300009093 | Bacteria | 6724 |
| 154 | Ga0105240_10070676 | 3300009093 | Bacteria | 4318 |
| 155 | Ga0105240_10252235 | 3300009093 | Bacteria | 2040 |
| 156 | Ga0105240_10308211 | 3300009093 | Bacteria | 1809 |
| 157 | Ga0105240_10331445 | 3300009093 | Bacteria | 1732 |
| 158 | Ga0105240_10385267 | 3300009093 | Bacteria | 1582 |
| 159 | Ga0105240_10789476 | 3300009093 | Bacteria | 1029 |
| 160 | Ga0105240_10878369 | 3300009093 | Bacteria | 966 |
| 161 | Ga0105240_11053545 | 3300009093 | Bacteria | 867 |
| 162 | Ga0111539_10001219 | 3300009094 | Bacteria | 34227 |
| 163 | Ga0105245_10054560 | 3300009098 | Bacteria | 3589 |
| 164 | Ga0105245_10109746 | 3300009098 | Bacteria | 2564 |
| 165 | Ga0105245_10222650 | 3300009098 | Bacteria | 1821 |
| 166 | Ga0105247_10111633 | 3300009101 | Bacteria | 1760 |
| 167 | Ga0105247_11270183 | 3300009101 | Bacteria | 590 |
| 168 | Ga0105247_11450259 | 3300009101 | Bacteria | 557 |
| 169 | Ga0105243_10020123 | 3300009148 | Bacteria | 5059 |
| 170 | Ga0105243_10101455 | 3300009148 | Bacteria | 2389 |
| 171 | Ga0105241_10033337 | 3300009174 | Bacteria | 3866 |
| 172 | Ga0105241_10113267 | 3300009174 | Bacteria | 2174 |
| 173 | Ga0105241_10121871 | 3300009174 | Bacteria | 2101 |
| 174 | Ga0105241_10272998 | 3300009174 | Bacteria | 1441 |
| 175 | Ga0105241_10291668 | 3300009174 | Bacteria | 1397 |
| 176 | Ga0105242_10395163 | 3300009176 | Bacteria | 1289 |
| 177 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 178 | Ga0105248_10014965 | 3300009177 | Bacteria | 8540 |
| 179 | Ga0105248_10033294 | 3300009177 | Bacteria | 5756 |
| 180 | Ga0105248_10118359 | 3300009177 | Bacteria | 2988 |
| 181 | Ga0105248_10323578 | 3300009177 | Bacteria | 1737 |
| 182 | Ga0105237_10006756 | 3300009545 | Bacteria | 12665 |
| 183 | Ga0105237_10242234 | 3300009545 | Bacteria | 1805 |
| 184 | Ga0105237_10397726 | 3300009545 | Bacteria | 1382 |
| 185 | Ga0105237_10489383 | 3300009545 | Bacteria | 1236 |
| 186 | Ga0105237_10893957 | 3300009545 | Bacteria | 895 |
| 187 | Ga0105238_10000704 | 3300009551 | Bacteria | 34914 |
| 188 | Ga0105238_10013759 | 3300009551 | Bacteria | 8177 |
| 189 | Ga0105238_10141245 | 3300009551 | Bacteria | 2385 |
| 190 | Ga0105238_10147832 | 3300009551 | Bacteria | 2326 |
| 191 | Ga0105238_10210886 | 3300009551 | Bacteria | 1918 |
| 192 | Ga0105238_11377090 | 3300009551 | Bacteria | 732 |
| 193 | Ga0105249_10222999 | 3300009553 | Bacteria | 1856 |
| 194 | Ga0105249_10529415 | 3300009553 | Bacteria | 1227 |
| 195 | Ga0105239_10027086 | 3300010375 | Bacteria | 6310 |
| 196 | Ga0105239_10063655 | 3300010375 | Bacteria | 4049 |
| 197 | Ga0105239_10100032 | 3300010375 | Bacteria | 3207 |
| 198 | Ga0105239_10143688 | 3300010375 | Bacteria | 2660 |
| 199 | Ga0105239_10651718 | 3300010375 | Bacteria | 1203 |
| 200 | Ga0105239_10664047 | 3300010375 | Bacteria | 1191 |
| 201 | Ga0105246_10049099 | 3300011119 | Bacteria | 2888 |
| 202 | Ga0105246_11085335 | 3300011119 | Bacteria | 730 |
| 203 | Ga0105246_11383577 | 3300011119 | Bacteria | 656 |
| 204 | Ga0157373_10000613 | 3300013100 | Bacteria | 27891 |
| 205 | Ga0157371_10250584 | 3300013102 | Bacteria | 1275 |
| 206 | Ga0157370_10006032 | 3300013104 | Bacteria | 13471 |
| 207 | Ga0157370_10014410 | 3300013104 | Bacteria | 8083 |
| 208 | Ga0157370_10201526 | 3300013104 | Bacteria | 1846 |
| 209 | Ga0157370_10344482 | 3300013104 | Bacteria | 1374 |
| 210 | Ga0157369_10016516 | 3300013105 | Bacteria | 8299 |
| 211 | Ga0157369_10031240 | 3300013105 | Bacteria | 5867 |
| 212 | Ga0157369_10352799 | 3300013105 | Bacteria | 1528 |
| 213 | Ga0157369_10489259 | 3300013105 | Bacteria | 1273 |
| 214 | Ga0157369_10534553 | 3300013105 | Bacteria | 1212 |
| 215 | Ga0157374_10062753 | 3300013296 | Bacteria | 3484 |
| 216 | Ga0157374_10607754 | 3300013296 | Bacteria | 1104 |
| 217 | Ga0157374_10738102 | 3300013296 | Bacteria | 999 |
| 218 | Ga0157378_10005318 | 3300013297 | Bacteria | 11303 |
| 219 | Ga0157378_11351682 | 3300013297 | Bacteria | 754 |
| 220 | Ga0157378_12047602 | 3300013297 | Bacteria | 623 |
| 221 | Ga0163162_10052650 | 3300013306 | Bacteria | 4089 |
| 222 | Ga0163162_10067772 | 3300013306 | Bacteria | 3619 |
| 223 | Ga0163162_10068461 | 3300013306 | Bacteria | 3601 |
| 224 | Ga0163162_10166460 | 3300013306 | Bacteria | 2328 |
| 225 | Ga0163162_10237609 | 3300013306 | Bacteria | 1953 |
| 226 | Ga0157372_11290645 | 3300013307 | Bacteria | 843 |
| 227 | Ga0157375_10082607 | 3300013308 | Bacteria | 3255 |
| 228 | Ga0157375_11013685 | 3300013308 | Bacteria | 969 |
| 229 | Ga0157375_12371666 | 3300013308 | Bacteria | 633 |
| 230 | Ga0163163_10000179 | 3300014325 | Bacteria | 65182 |
| 231 | Ga0163163_10020912 | 3300014325 | Bacteria | 6171 |
| 232 | Ga0163163_10053902 | 3300014325 | Bacteria | 3972 |
| 233 | Ga0163163_10465171 | 3300014325 | Bacteria | 1325 |
| 234 | Ga0163163_11268864 | 3300014325 | Bacteria | 799 |
| 235 | Ga0157380_10546460 | 3300014326 | Bacteria | 1135 |
| 236 | Ga0182008_10038277 | 3300014497 | Bacteria | 2398 |
| 237 | Ga0157377_10037725 | 3300014745 | Bacteria | 2663 |
| 238 | Ga0157377_10259400 | 3300014745 | Bacteria | 1130 |
| 239 | Ga0157379_10003257 | 3300014968 | Bacteria | 13757 |
| 240 | Ga0157379_10003407 | 3300014968 | Bacteria | 13447 |
| 241 | Ga0157379_10020902 | 3300014968 | Bacteria | 5792 |
| 242 | Ga0157379_10055597 | 3300014968 | Bacteria | 3536 |
| 243 | Ga0157379_10080886 | 3300014968 | Bacteria | 2910 |
| 244 | Ga0157376_10092811 | 3300014969 | Bacteria | 2618 |
| 245 | Ga0157376_10809119 | 3300014969 | Bacteria | 950 |
| 246 | Ga0157376_11685508 | 3300014969 | Bacteria | 669 |
| 247 | Ga0182007_10029842 | 3300015262 | Bacteria | 1866 |
| 248 | Ga0163161_10709942 | 3300017792 | Bacteria | 838 |
| 249 | Ga0214544_1001531 | 3300021320 | Eukaryota | 48286 |
| 250 | Ga0214542_1001461 | 3300021321 | Eukaryota | 48370 |
| 251 | Ga0214545_1000217 | 3300021324 | Eukaryota | 78396 |
| 252 | Ga0214543_1000639 | 3300021327 | Eukaryota | 60739 |
| 253 | Ga0213876_10000785 | 3300021384 | Bacteria | 21620 |
| 254 | Ga0213876_10283476 | 3300021384 | Bacteria | 880 |
| 255 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 256 | Ga0209233_1021831 | 3300025261 | Bacteria | 1649 |
| 257 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 258 | Ga0207656_10181223 | 3300025321 | Bacteria | 1011 |
| 259 | Ga0207682_10003025 | 3300025893 | Bacteria | 7373 |
| 260 | Ga0207710_10107847 | 3300025900 | Bacteria | 1320 |
| 261 | Ga0207710_10570345 | 3300025900 | Bacteria | 590 |
| 262 | Ga0207688_10360023 | 3300025901 | Bacteria | 897 |
| 263 | Ga0207680_10002210 | 3300025903 | Bacteria | 9087 |
| 264 | Ga0207680_10002989 | 3300025903 | Bacteria | 7926 |
| 265 | Ga0207680_10208522 | 3300025903 | Bacteria | 1335 |
| 266 | Ga0207680_10828810 | 3300025903 | Bacteria | 663 |
| 267 | Ga0207699_10361200 | 3300025906 | Bacteria | 1027 |
| 268 | Ga0207645_10026965 | 3300025907 | Bacteria | 3712 |
| 269 | Ga0207645_10219597 | 3300025907 | Bacteria | 1253 |
| 270 | Ga0207643_10201751 | 3300025908 | Bacteria | 1211 |
| 271 | Ga0207643_10277955 | 3300025908 | Bacteria | 1038 |
| 272 | Ga0207705_10000679 | 3300025909 | Bacteria | 28173 |
| 273 | Ga0207705_10018233 | 3300025909 | Bacteria | 5019 |
| 274 | Ga0207705_10110402 | 3300025909 | Bacteria | 2032 |
| 275 | Ga0207705_10235696 | 3300025909 | Bacteria | 1393 |
| 276 | Ga0207654_10053426 | 3300025911 | Bacteria | 2332 |
| 277 | Ga0207654_10178341 | 3300025911 | Bacteria | 1384 |
| 278 | Ga0207654_10199457 | 3300025911 | Bacteria | 1317 |
| 279 | Ga0207654_10540629 | 3300025911 | Bacteria | 827 |
| 280 | Ga0207707_10079785 | 3300025912 | Bacteria | 2858 |
| 281 | Ga0207707_10209919 | 3300025912 | Bacteria | 1696 |
| 282 | Ga0207707_10416634 | 3300025912 | Bacteria | 1152 |
| 283 | Ga0207695_10028365 | 3300025913 | Bacteria | 6210 |
| 284 | Ga0207695_10049604 | 3300025913 | Bacteria | 4423 |
| 285 | Ga0207695_10057075 | 3300025913 | Bacteria | 4059 |
| 286 | Ga0207695_10223916 | 3300025913 | Bacteria | 1788 |
| 287 | Ga0207695_10284099 | 3300025913 | Bacteria | 1548 |
| 288 | Ga0207695_10310250 | 3300025913 | Bacteria | 1468 |
| 289 | Ga0207695_10423964 | 3300025913 | Bacteria | 1214 |
| 290 | Ga0207695_10474862 | 3300025913 | Bacteria | 1133 |
| 291 | Ga0207695_10522711 | 3300025913 | Bacteria | 1068 |
| 292 | Ga0207695_10636228 | 3300025913 | Bacteria | 948 |
| 293 | Ga0207695_10843572 | 3300025913 | Bacteria | 796 |
| 294 | Ga0207695_10959787 | 3300025913 | Bacteria | 735 |
| 295 | Ga0207671_10006474 | 3300025914 | Bacteria | 10426 |
| 296 | Ga0207671_10091424 | 3300025914 | Bacteria | 2293 |
| 297 | Ga0207671_10163366 | 3300025914 | Bacteria | 1725 |
| 298 | Ga0207671_10250687 | 3300025914 | Bacteria | 1392 |
| 299 | Ga0207671_10277082 | 3300025914 | Bacteria | 1322 |
| 300 | Ga0207693_10000488 | 3300025915 | Bacteria | 35928 |
| 301 | Ga0207663_10007822 | 3300025916 | Bacteria | 5567 |
| 302 | Ga0207660_10000313 | 3300025917 | Bacteria | 31761 |
| 303 | Ga0207660_10101363 | 3300025917 | Bacteria | 2151 |
| 304 | Ga0207657_10004158 | 3300025919 | Bacteria | 15338 |
| 305 | Ga0207657_10037025 | 3300025919 | Bacteria | 4362 |
| 306 | Ga0207657_10217465 | 3300025919 | Bacteria | 1532 |
| 307 | Ga0207649_10151325 | 3300025920 | Bacteria | 1598 |
| 308 | Ga0207649_10246997 | 3300025920 | Bacteria | 1283 |
| 309 | Ga0207649_10642910 | 3300025920 | Bacteria | 819 |
| 310 | Ga0207649_11546485 | 3300025920 | Bacteria | 525 |
| 311 | Ga0207652_10000662 | 3300025921 | Bacteria | 33794 |
| 312 | Ga0207652_10052661 | 3300025921 | Bacteria | 3494 |
| 313 | Ga0207652_10298442 | 3300025921 | Bacteria | 1454 |
| 314 | Ga0207681_10009037 | 3300025923 | Bacteria | 6088 |
| 315 | Ga0207681_10735055 | 3300025923 | Bacteria | 822 |
| 316 | Ga0207694_10018598 | 3300025924 | Bacteria | 5252 |
| 317 | Ga0207694_10092716 | 3300025924 | Bacteria | 2385 |
| 318 | Ga0207694_10251887 | 3300025924 | Bacteria | 1445 |
| 319 | Ga0207694_10408889 | 3300025924 | Bacteria | 1129 |
| 320 | Ga0207650_10043414 | 3300025925 | Bacteria | 3300 |
| 321 | Ga0207650_10384239 | 3300025925 | Bacteria | 1160 |
| 322 | Ga0207659_10011677 | 3300025926 | Bacteria | 5557 |
| 323 | Ga0207687_10161133 | 3300025927 | Bacteria | 1722 |
| 324 | Ga0207687_10269950 | 3300025927 | Bacteria | 1359 |
| 325 | Ga0207687_10830039 | 3300025927 | Bacteria | 789 |
| 326 | Ga0207700_11019596 | 3300025928 | Bacteria | 740 |
| 327 | Ga0207664_10250170 | 3300025929 | Bacteria | 1547 |
| 328 | Ga0207664_10568077 | 3300025929 | Bacteria | 1018 |
| 329 | Ga0207644_10000370 | 3300025931 | Bacteria | 29393 |
| 330 | Ga0207706_10176101 | 3300025933 | Bacteria | 1879 |
| 331 | Ga0207686_10015274 | 3300025934 | Bacteria | 4290 |
| 332 | Ga0207686_10030132 | 3300025934 | Bacteria | 3209 |
| 333 | Ga0207686_10082942 | 3300025934 | Bacteria | 2097 |
| 334 | Ga0207709_10006920 | 3300025935 | Bacteria | 6343 |
| 335 | Ga0207709_11302266 | 3300025935 | Bacteria | 600 |
| 336 | Ga0207669_10144714 | 3300025937 | Bacteria | 1656 |
| 337 | Ga0207704_10037197 | 3300025938 | Bacteria | 2810 |
| 338 | Ga0207704_10129565 | 3300025938 | Bacteria | 1744 |
| 339 | Ga0207665_10138925 | 3300025939 | Bacteria | 1730 |
| 340 | Ga0207691_11438753 | 3300025940 | Bacteria | 565 |
| 341 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 342 | Ga0207711_10081394 | 3300025941 | Bacteria | 2830 |
| 343 | Ga0207711_10237963 | 3300025941 | Bacteria | 1669 |
| 344 | Ga0207689_10534814 | 3300025942 | Bacteria | 984 |
| 345 | Ga0207689_11685011 | 3300025942 | Bacteria | 526 |
| 346 | Ga0207661_10065598 | 3300025944 | Bacteria | 2948 |
| 347 | Ga0207679_10068284 | 3300025945 | Bacteria | 2670 |
| 348 | Ga0207667_10007290 | 3300025949 | Bacteria | 13325 |
| 349 | Ga0207667_10008750 | 3300025949 | Bacteria | 12000 |
| 350 | Ga0207667_10107093 | 3300025949 | Bacteria | 2883 |
| 351 | Ga0207667_10424553 | 3300025949 | Bacteria | 1352 |
| 352 | Ga0207667_10529176 | 3300025949 | Bacteria | 1194 |
| 353 | Ga0207667_10560967 | 3300025949 | Bacteria | 1154 |
| 354 | Ga0207667_10566987 | 3300025949 | Bacteria | 1147 |
| 355 | Ga0207667_11346983 | 3300025949 | Bacteria | 689 |
| 356 | Ga0207651_10088471 | 3300025960 | Bacteria | 2258 |
| 357 | Ga0207712_10034106 | 3300025961 | Bacteria | 3446 |
| 358 | Ga0207712_10061454 | 3300025961 | Bacteria | 2666 |
| 359 | Ga0207712_10930231 | 3300025961 | Bacteria | 769 |
| 360 | Ga0207668_10000629 | 3300025972 | Bacteria | 21816 |
| 361 | Ga0207668_10001707 | 3300025972 | Bacteria | 12845 |
| 362 | Ga0207640_10237386 | 3300025981 | Bacteria | 1406 |
| 363 | Ga0207658_10000089 | 3300025986 | Bacteria | 100308 |
| 364 | Ga0207658_10006836 | 3300025986 | Bacteria | 7773 |
| 365 | Ga0207658_10007746 | 3300025986 | Bacteria | 7321 |
| 366 | Ga0207677_10031216 | 3300026023 | Bacteria | 3410 |
| 367 | Ga0207677_10875223 | 3300026023 | Bacteria | 808 |
| 368 | Ga0207677_11371940 | 3300026023 | Bacteria | 650 |
| 369 | Ga0207703_10006047 | 3300026035 | Bacteria | 9680 |
| 370 | Ga0207703_10041321 | 3300026035 | Bacteria | 3693 |
| 371 | Ga0207703_10043135 | 3300026035 | Bacteria | 3619 |
| 372 | Ga0207703_10075896 | 3300026035 | Bacteria | 2787 |
| 373 | Ga0207703_10960569 | 3300026035 | Bacteria | 819 |
| 374 | Ga0207639_10010833 | 3300026041 | Bacteria | 6322 |
| 375 | Ga0207639_10073939 | 3300026041 | Bacteria | 2674 |
| 376 | Ga0207639_10240310 | 3300026041 | Bacteria | 1574 |
| 377 | Ga0207639_10454425 | 3300026041 | Bacteria | 1163 |
| 378 | Ga0207639_10700342 | 3300026041 | Bacteria | 940 |
| 379 | Ga0207639_10836542 | 3300026041 | Bacteria | 859 |
| 380 | Ga0207678_10003372 | 3300026067 | Bacteria | 14408 |
| 381 | Ga0207678_10310111 | 3300026067 | Bacteria | 1357 |
| 382 | Ga0207702_10005060 | 3300026078 | Bacteria | 11576 |
| 383 | Ga0207702_10116163 | 3300026078 | Bacteria | 2388 |
| 384 | Ga0207702_10119069 | 3300026078 | Bacteria | 2360 |
| 385 | Ga0207702_10224640 | 3300026078 | Bacteria | 1751 |
| 386 | Ga0207702_10538844 | 3300026078 | Bacteria | 1141 |
| 387 | Ga0207641_10000060 | 3300026088 | Bacteria | 161514 |
| 388 | Ga0207641_10010427 | 3300026088 | Bacteria | 7636 |
| 389 | Ga0207641_10015268 | 3300026088 | Bacteria | 6294 |
| 390 | Ga0207641_10146807 | 3300026088 | Bacteria | 2133 |
| 391 | Ga0207648_10147353 | 3300026089 | Bacteria | 2076 |
| 392 | Ga0207648_10658283 | 3300026089 | Bacteria | 968 |
| 393 | Ga0207676_10152784 | 3300026095 | Bacteria | 1990 |
| 394 | Ga0207674_10000261 | 3300026116 | Bacteria | 66008 |
| 395 | Ga0207674_10011586 | 3300026116 | Bacteria | 9903 |
| 396 | Ga0207674_10059522 | 3300026116 | Bacteria | 3865 |
| 397 | Ga0207674_10093073 | 3300026116 | Bacteria | 3003 |
| 398 | Ga0207674_10172710 | 3300026116 | Bacteria | 2114 |
| 399 | Ga0207674_11107586 | 3300026116 | Bacteria | 761 |
| 400 | Ga0207674_11606368 | 3300026116 | Bacteria | 619 |
| 401 | Ga0207675_100274698 | 3300026118 | Bacteria | 1636 |
| 402 | Ga0207675_100553816 | 3300026118 | Bacteria | 1149 |
| 403 | Ga0207683_10009569 | 3300026121 | Bacteria | 8263 |
| 404 | Ga0207683_10053764 | 3300026121 | Bacteria | 3531 |
| 405 | Ga0207683_10173954 | 3300026121 | Bacteria | 1951 |
| 406 | Ga0207698_10148203 | 3300026142 | Bacteria | 2033 |
| 407 | Ga0207698_10387555 | 3300026142 | Bacteria | 1331 |
| 408 | Ga0207698_10766806 | 3300026142 | Bacteria | 964 |
| 409 | Ga0207698_10890989 | 3300026142 | Bacteria | 896 |
| 410 | Ga0207698_11247741 | 3300026142 | Bacteria | 758 |
| 411 | Ga0207698_11341091 | 3300026142 | Bacteria | 730 |
| 412 | Ga0209389_1038111 | 3300027296 | Eukaryota | 3795 |
| 413 | Ga0209589_1000067 | 3300027357 | Eukaryota | 100489 |
| 414 | Ga0209489_100273 | 3300027361 | Eukaryota | 89325 |
| 415 | Ga0209700_104513 | 3300027363 | Eukaryota | 24977 |
| 416 | Ga0268266_10000134 | 3300028379 | Bacteria | 143139 |
| 417 | Ga0268266_10000900 | 3300028379 | Bacteria | 38445 |
| 418 | Ga0268266_10033242 | 3300028379 | Bacteria | 4385 |
| 419 | Ga0268266_10057693 | 3300028379 | Bacteria | 3341 |
| 420 | Ga0268266_10060669 | 3300028379 | Bacteria | 3260 |
| 421 | Ga0268266_10068046 | 3300028379 | Bacteria | 3083 |
| 422 | Ga0268266_10091907 | 3300028379 | Bacteria | 2662 |
| 423 | Ga0268266_10143383 | 3300028379 | Bacteria | 2145 |
| 424 | Ga0268266_10254808 | 3300028379 | Bacteria | 1624 |
| 425 | Ga0268266_10604439 | 3300028379 | Bacteria | 1053 |
| 426 | Ga0268265_10393218 | 3300028380 | Bacteria | 1279 |
| 427 | Ga0268265_11139781 | 3300028380 | Bacteria | 775 |
| 428 | Ga0268264_10018140 | 3300028381 | Bacteria | 5755 |
| 429 | Ga0268264_10919491 | 3300028381 | Bacteria | 879 |
| 430 | Ga0265334_10012178 | 3300028573 | Bacteria | 3614 |
| 431 | Ga0265318_10000153 | 3300028577 | Bacteria | 62095 |
| 432 | Ga0307517_10171693 | 3300028786 | Bacteria | 1424 |
| 433 | Ga0265338_10000005 | 3300028800 | Bacteria | 571137 |
| 434 | Ga0265338_10032597 | 3300028800 | Bacteria | 5075 |
| 435 | Ga0265338_10039930 | 3300028800 | Bacteria | 4416 |
| 436 | Ga0265338_10080605 | 3300028800 | Bacteria | 2734 |
| 437 | Ga0265330_10176508 | 3300031235 | Bacteria | 905 |
| 438 | Ga0265330_10238357 | 3300031235 | Bacteria | 767 |
| 439 | Ga0265332_10018787 | 3300031238 | Bacteria | 3051 |
| 440 | Ga0265328_10068693 | 3300031239 | Bacteria | 1302 |
| 441 | Ga0265320_10001113 | 3300031240 | Bacteria | 19838 |
| 442 | Ga0265320_10251965 | 3300031240 | Bacteria | 783 |
| 443 | Ga0265325_10000005 | 3300031241 | Bacteria | 321343 |
| 444 | Ga0265325_10000830 | 3300031241 | Bacteria | 22349 |
| 445 | Ga0265325_10011932 | 3300031241 | Bacteria | 4981 |
| 446 | Ga0265325_10016545 | 3300031241 | Bacteria | 4123 |
| 447 | Ga0265325_10228549 | 3300031241 | Bacteria | 849 |
| 448 | Ga0265329_10052504 | 3300031242 | Bacteria | 1297 |
| 449 | Ga0265340_10111090 | 3300031247 | Bacteria | 1267 |
| 450 | Ga0265340_10312829 | 3300031247 | Bacteria | 696 |
| 451 | Ga0265339_10015788 | 3300031249 | Bacteria | 4517 |
| 452 | Ga0265339_10024408 | 3300031249 | Bacteria | 3484 |
| 453 | Ga0265339_10049381 | 3300031249 | Bacteria | 2304 |
| 454 | Ga0265339_10088546 | 3300031249 | Bacteria | 1626 |
| 455 | Ga0265339_10347490 | 3300031249 | Bacteria | 700 |
| 456 | Ga0265331_10026019 | 3300031250 | Bacteria | 2948 |
| 457 | Ga0265331_10036411 | 3300031250 | Bacteria | 2416 |
| 458 | Ga0265316_10215039 | 3300031344 | Bacteria | 1420 |
| 459 | Ga0265316_10432863 | 3300031344 | Bacteria | 945 |
| 460 | Ga0307408_100263273 | 3300031548 | Bacteria | 1428 |
| 461 | Ga0265313_10013915 | 3300031595 | Bacteria | 4791 |
| 462 | Ga0265313_10096542 | 3300031595 | Bacteria | 1318 |
| 463 | Ga0265313_10119040 | 3300031595 | Bacteria | 1154 |
| 464 | Ga0265314_10000125 | 3300031711 | Bacteria | 118671 |
| 465 | Ga0265314_10021623 | 3300031711 | Bacteria | 4941 |
| 466 | Ga0265314_10051436 | 3300031711 | Bacteria | 2869 |
| 467 | Ga0265342_10001617 | 3300031712 | Bacteria | 20801 |
| 468 | Ga0265342_10017030 | 3300031712 | Bacteria | 4734 |
| 469 | Ga0265342_10281841 | 3300031712 | Bacteria | 879 |
| 470 | Ga0307516_10024687 | 3300031730 | Bacteria | 6137 |
| 471 | Ga0307516_10039905 | 3300031730 | Bacteria | 4676 |
| 472 | Ga0307405_10057716 | 3300031731 | Bacteria | 2440 |
| 473 | Ga0307413_10027871 | 3300031824 | Bacteria | 3138 |
| 474 | Ga0307413_10102252 | 3300031824 | Bacteria | 1897 |
| 475 | Ga0307413_10792731 | 3300031824 | Bacteria | 795 |
| 476 | Ga0307406_10072962 | 3300031901 | Bacteria | 2255 |
| 477 | Ga0307406_10353158 | 3300031901 | Bacteria | 1150 |
| 478 | Ga0307407_10517553 | 3300031903 | Bacteria | 877 |
| 479 | Ga0307412_11363634 | 3300031911 | Bacteria | 640 |
| 480 | Ga0307409_100075408 | 3300031995 | Bacteria | 2700 |
| 481 | Ga0307414_10061820 | 3300032004 | Bacteria | 2654 |
| 482 | Ga0307414_10668725 | 3300032004 | Bacteria | 937 |
| 483 | Ga0307414_10790853 | 3300032004 | Bacteria | 864 |
| 484 | Ga0307411_10063962 | 3300032005 | Bacteria | 2461 |
| 485 | Ga0307415_100113471 | 3300032126 | Bacteria | 2015 |
| 486 | Ga0373928_0161920 | 3300035084 | Bacteria | 626 |
| 487 | Ga0373946_0038848 | 3300035171 | Bacteria | 1941 |
| 488 | Ga0373955_0093218 | 3300035172 | Bacteria | 1719 |
| 489 | Ga0373955_0272764 | 3300035172 | Bacteria | 1017 |
| 490 | Ga0373924_0248006 | 3300035410 | Bacteria | 788 |
| 491 | Ga0373931_0743201 | 3300035691 | Bacteria | 651 |
| 492 | Ga0373933_0002679 | 3300035724 | Bacteria | 9969 |
| 493 | Ga0373933_0076418 | 3300035724 | Bacteria | 2046 |
| 494 | Ga0373937_0004365 | 3300036401 | Bacteria | 12006 |
| 495 | Ga0373937_0051438 | 3300036401 | Bacteria | 3776 |
| 496 | Ga0373937_0074552 | 3300036401 | Bacteria | 3131 |
| 497 | Ga0373937_0082163 | 3300036401 | Bacteria | 2981 |
| 498 | Ga0310109_019444 | 3300036534 | Eukaryota | 918 |
| 499 | Ga0310110_021455 | 3300036535 | Eukaryota | 889 |
| 500 | Ga0395899_0011095 | 3300037312 | Bacteria | 6901 |
| 501 | Ga0395899_0074090 | 3300037312 | Bacteria | 2488 |
| 502 | Ga0395899_0086188 | 3300037312 | Bacteria | 2281 |
| 503 | Ga0395899_0233569 | 3300037312 | Bacteria | 1268 |
| 504 | Ga0395900_0024869 | 3300037418 | Bacteria | 6129 |
| 505 | Ga0395900_0102843 | 3300037418 | Bacteria | 2934 |
| 506 | Ga0395900_0114765 | 3300037418 | Bacteria | 2764 |
| 507 | Ga0395900_0127246 | 3300037418 | Bacteria | 2612 |
| 508 | Ga0395900_0549490 | 3300037418 | Bacteria | 1099 |
| 509 | Ga0395900_0595163 | 3300037418 | Bacteria | 1047 |
| 510 | Ga0395900_1123143 | 3300037418 | Bacteria | 703 |
| 511 | Ga0395898_0006786 | 3300037466 | Bacteria | 12186 |
| 512 | Ga0395898_0038212 | 3300037466 | Bacteria | 4759 |
| 513 | Ga0395898_0046410 | 3300037466 | Bacteria | 4267 |
| 514 | Ga0395898_0515177 | 3300037466 | Bacteria | 1137 |
| 515 | Ga0395898_0542756 | 3300037466 | Bacteria | 1104 |
| 516 | Ga0395905_0055927 | 3300037471 | Bacteria | 3693 |
| 517 | Ga0395905_0227915 | 3300037471 | Bacteria | 1743 |
| 518 | Ga0395905_0330316 | 3300037471 | Bacteria | 1415 |
| 519 | Ga0395905_1343235 | 3300037471 | Bacteria | 619 |
| 520 | Ga0395901_0023404 | 3300038443 | Bacteria | 6332 |
| 521 | Ga0395901_0051788 | 3300038443 | Bacteria | 4267 |
| 522 | Ga0395901_0071516 | 3300038443 | Bacteria | 3615 |
| 523 | Ga0395901_0293760 | 3300038443 | Bacteria | 1686 |
| 524 | Ga0395901_0353954 | 3300038443 | Bacteria | 1515 |
| 525 | Ga0395901_0510728 | 3300038443 | Bacteria | 1222 |
| 526 | Ga0395901_0957278 | 3300038443 | Bacteria | 834 |
| 527 | Ga0436365_0687864 | 3300039437 | Bacteria | 8538 |
| 528 | Ga0436365_0793637 | 3300039437 | Bacteria | 44268 |
| 529 | Ga0436365_1009922 | 3300039437 | Bacteria | 2518 |
| 530 | Ga0436365_1183741 | 3300039437 | Bacteria | 9800 |
| 531 | Ga0436362_0450835 | 3300039453 | Bacteria | 642 |
| 532 | Ga0436362_1084872 | 3300039453 | Bacteria | 1242 |
| 533 | Ga0451795_0209803 | 3300041456 | Bacteria | 782 |
| 534 | Ga0451802_2092102 | 3300041460 | Bacteria | 574 |
| 535 | Ga0451849_1157771 | 3300041505 | Eukaryota | 1001 |
| 536 | Ga0451853_1465112 | 3300041512 | Bacteria | 955 |
| 537 | Ga0466988_0030677 | 3300044536 | Eukaryota | 3052 |
| 538 | Ga0466988_0069378 | 3300044536 | Eukaryota | 2080 |
| 539 | Ga0466984_0007546 | 3300044649 | Eukaryota | 6752 |
| 540 | Ga0466986_0055896 | 3300044650 | Eukaryota | 2729 |
| 541 | Ga0466985_0114239 | 3300044651 | Eukaryota | 1837 |
| 542 | Ga0466985_0115163 | 3300044651 | Eukaryota | 1828 |
| 543 | Ga0466969_0222997 | 3300044656 | Eukaryota | 857 |
| 544 | Ga0466973_0020269 | 3300044659 | Eukaryota | 6353 |
| 545 | Ga0466973_0025791 | 3300044659 | Eukaryota | 5641 |
| 546 | Ga0466974_0037893 | 3300044660 | Eukaryota | 3182 |
| 547 | Ga0466974_0166001 | 3300044660 | Eukaryota | 1414 |
| 548 | Ga0466975_0066076 | 3300044661 | Eukaryota | 2582 |
| 549 | Ga0466975_0083820 | 3300044661 | Eukaryota | 2272 |
| 550 | Ga0466976_0056825 | 3300044662 | Eukaryota | 2368 |
| 551 | Ga0466976_0151782 | 3300044662 | Eukaryota | 1397 |
| 552 | Ga0466989_0015759 | 3300044663 | Eukaryota | 4224 |
| 553 | Ga0466989_0102508 | 3300044663 | Eukaryota | 1757 |
| 554 | Ga0466987_0072631 | 3300044665 | Eukaryota | 2169 |
| 555 | Ga0466977_0017853 | 3300044666 | Eukaryota | 4307 |
| 556 | Ga0466977_0036505 | 3300044666 | Eukaryota | 3175 |
| 557 | Ga0466980_0048423 | 3300044668 | Eukaryota | 2973 |
| 558 | Ga0466980_0078768 | 3300044668 | Eukaryota | 2287 |
| 559 | Ga0466981_0036148 | 3300044669 | Eukaryota | 3536 |
| 560 | Ga0466981_0071562 | 3300044669 | Eukaryota | 2485 |
| 561 | Ga0466978_0072563 | 3300044671 | Eukaryota | 2148 |
| 562 | Ga0466978_0078562 | 3300044671 | Eukaryota | 2059 |
| 563 | Ga0466982_0065105 | 3300044672 | Eukaryota | 2246 |
| 564 | Ga0466982_0070489 | 3300044672 | Eukaryota | 2158 |
| 565 | Ga0453683_0912732 | 3300044673 | Bacteria | 581 |
| 566 | Ga0466963_0168677 | 3300044694 | Bacteria | 1525 |
| 567 | Ga0466964_0479701 | 3300044706 | Bacteria | 664 |
| 568 | Ga0466957_0059968 | 3300044842 | Bacteria | 2333 |
| 569 | Ga0451576_0019052 | 3300045051 | Bacteria | 7499 |
| 570 | Ga0466967_1294603 | 3300045976 | Bacteria | 726 |
| 571 | Ga0495617_042718 | 3300046452 | Bacteria | 1515 |
| 572 | Ga0495629_0083349 | 3300046459 | Bacteria | 2232 |
| 573 | Ga0495650_0020299 | 3300046471 | Bacteria | 3243 |
| 574 | Ga0495580_0011236 | 3300046472 | Bacteria | 6928 |
| 575 | Ga0495582_0004184 | 3300046473 | Bacteria | 8114 |
| 576 | Ga0495606_0119410 | 3300046507 | Bacteria | 1580 |
| 577 | Ga0495621_0385877 | 3300046539 | Bacteria | 592 |
| 578 | Ga0495622_0010955 | 3300046557 | Bacteria | 4184 |
| 579 | Ga0495635_0814671 | 3300046663 | Bacteria | 601 |
| 580 | Ga0495657_0183918 | 3300046675 | Bacteria | 1281 |
| 581 | Ga0495623_0166054 | 3300046679 | Bacteria | 1293 |
| 582 | Ga0495658_0000632 | 3300046683 | Bacteria | 19106 |
| 583 | Ga0495658_0365489 | 3300046683 | Bacteria | 918 |
| 584 | Ga0495669_0461817 | 3300046684 | Bacteria | 617 |
| 585 | Ga0495649_0034458 | 3300046694 | Bacteria | 2786 |
| 586 | Ga0495581_0163435 | 3300047315 | Bacteria | 1301 |
| 587 | Ga0495581_0456796 | 3300047315 | Bacteria | 744 |
| 588 | Ga0495672_0204681 | 3300047320 | Bacteria | 985 |
| 589 | Ga0495680_0275584 | 3300047322 | Bacteria | 1187 |
| 590 | Ga0495684_0052598 | 3300047471 | Bacteria | 3108 |
| 591 | Ga0495684_0361424 | 3300047471 | Bacteria | 1028 |
| 592 | Ga0495602_0136706 | 3300048088 | Bacteria | 1946 |
| 593 | Ga0495602_0767391 | 3300048088 | Bacteria | 650 |
| 594 | Ga0466979_0010527 | 3300048619 | Eukaryota | 6600 |
| 595 | Ga0466979_0048386 | 3300048619 | Eukaryota | 3266 |
| 596 | Ga0496101_0257267 | 3300048904 | Bacteria | 1361 |
| 597 | Ga0496102_0000120 | 3300048905 | Bacteria | 112432 |
| 598 | Ga0496103_0000154 | 3300048906 | Bacteria | 72239 |
| 599 | Ga0496114_0265854 | 3300048917 | Bacteria | 1511 |
| 600 | Ga0496116_0004809 | 3300048919 | Bacteria | 12742 |
| 601 | Ga0496117_0000317 | 3300048920 | Bacteria | 84472 |
| 602 | Ga0496118_0000303 | 3300048921 | Bacteria | 85332 |
| 603 | Ga0496119_0047407 | 3300048922 | Bacteria | 2674 |
| 604 | Ga0496121_0007648 | 3300048924 | Bacteria | 12982 |
| 605 | Ga0496121_0010270 | 3300048924 | Bacteria | 10593 |
| 606 | Ga0496121_0045230 | 3300048924 | Bacteria | 3785 |
| 607 | Ga0496122_0005688 | 3300048925 | Bacteria | 14715 |
| 608 | Ga0496123_0000155 | 3300048926 | Bacteria | 139646 |
| 609 | Ga0496124_0000214 | 3300048927 | Bacteria | 113007 |
| 610 | Ga0496125_0025348 | 3300048928 | Bacteria | 5432 |
| 611 | Ga0496126_0077994 | 3300048929 | Bacteria | 2936 |
| 612 | Ga0466983_0004857 | 3300048986 | Eukaryota | 9155 |
| 613 | Ga0501305_034668 | 3300049161 | Eukaryota | 801 |
| 614 | Ga0501031_0024873 | 3300049568 | Bacteria | 3905 |
| 615 | Ga0501031_0286691 | 3300049568 | Bacteria | 1068 |
| 616 | Ga0501032_0124929 | 3300049569 | Bacteria | 1700 |
| 617 | Ga0501032_0199332 | 3300049569 | Bacteria | 1306 |
| 618 | Ga0501032_0682897 | 3300049569 | Bacteria | 651 |
| 619 | Ga0501033_0113198 | 3300049570 | Bacteria | 1973 |
| 620 | Ga0501033_0531553 | 3300049570 | Bacteria | 811 |
| 621 | Ga0501034_0067731 | 3300049571 | Unclassified | 3582 |
| 622 | Ga0501034_0376330 | 3300049571 | Bacteria | 1345 |
| 623 | Ga0501034_1160135 | 3300049571 | Bacteria | 652 |
| 624 | Ga0501036_0794637 | 3300049572 | Bacteria | 779 |
| 625 | Ga0501037_0118885 | 3300049573 | Bacteria | 1901 |
| 626 | Ga0501038_0006992 | 3300049574 | Bacteria | 10421 |
| 627 | Ga0501038_0117159 | 3300049574 | Bacteria | 2200 |
| 628 | Ga0501038_0133188 | 3300049574 | Bacteria | 2038 |
| 629 | Ga0501038_0145189 | 3300049574 | Bacteria | 1938 |
| 630 | Ga0501040_0461042 | 3300049576 | Bacteria | 915 |
| 631 | Ga0501040_0735796 | 3300049576 | Bacteria | 713 |
| 632 | Ga0501043_0391966 | 3300049579 | Bacteria | 1050 |
| 633 | Ga0501043_0645459 | 3300049579 | Bacteria | 778 |
| 634 | Ga0501046_0224897 | 3300049580 | Bacteria | 1388 |
| 635 | Ga0501047_0009953 | 3300049581 | Bacteria | 8992 |
| 636 | Ga0501047_0042416 | 3300049581 | Bacteria | 4397 |
| 637 | Ga0501047_0069635 | 3300049581 | Bacteria | 3388 |
| 638 | Ga0501047_0181547 | 3300049581 | Bacteria | 1971 |
| 639 | Ga0501047_0563871 | 3300049581 | Bacteria | 962 |
| 640 | Ga0501047_0569601 | 3300049581 | Bacteria | 956 |
| 641 | Ga0501048_0975266 | 3300049582 | Bacteria | 610 |
| 642 | Ga0501067_0049302 | 3300049583 | Bacteria | 2333 |
| 643 | Ga0501070_0000002 | 3300049586 | Bacteria | 347524 |
| 644 | Ga0501070_0040470 | 3300049586 | Bacteria | 3886 |
| 645 | Ga0501072_0001937 | 3300049588 | Bacteria | 15425 |
| 646 | Ga0501073_0027526 | 3300049589 | Bacteria | 4065 |
| 647 | Ga0501073_0686601 | 3300049589 | Bacteria | 706 |
| 648 | Ga0501074_0353404 | 3300049590 | Bacteria | 1043 |
| 649 | Ga0501074_0967029 | 3300049590 | Bacteria | 599 |
| 650 | Ga0501075_0393093 | 3300049591 | Bacteria | 1057 |
| 651 | Ga0501233_001277 | 3300049668 | Bacteria | 4302 |
| 652 | Ga0501079_0878652 | 3300049741 | Bacteria | 706 |
| 653 | Ga0501080_0017903 | 3300049742 | Bacteria | 6558 |
| 654 | Ga0501081_0235235 | 3300049743 | Bacteria | 1335 |
| 655 | Ga0501083_0203977 | 3300049744 | Unclassified | 1289 |
| 656 | Ga0501083_0238233 | 3300049744 | Bacteria | 1185 |
| 657 | Ga0501035_0017186 | 3300049822 | Bacteria | 6667 |
| 658 | Ga0501035_0064526 | 3300049822 | Bacteria | 3255 |
| 659 | Ga0501035_0086374 | 3300049822 | Bacteria | 2764 |
| 660 | Ga0501035_0305338 | 3300049822 | Bacteria | 1340 |
| 661 | Ga0501044_0007426 | 3300049823 | Bacteria | 12057 |
| 662 | Ga0501044_0010785 | 3300049823 | Bacteria | 9916 |
| 663 | Ga0501044_0049319 | 3300049823 | Bacteria | 4346 |
| 664 | Ga0501044_0146524 | 3300049823 | Bacteria | 2346 |
| 665 | Ga0501044_1495748 | 3300049823 | Bacteria | 540 |
| 666 | nmdc:mga05p37_15849_c1 | 3300050507 | Bacteria | 3724 |
| 667 | nmdc:mga09592_419927_c1 | 3300050508 | Bacteria | 1155 |
| 668 | nmdc:mga0qj67_36653_c1 | 3300050509 | Bacteria | 3838 |
| 669 | nmdc:mga06r32_1276229_c1 | 3300050510 | Bacteria | 679 |
| 670 | nmdc:mga08y16_33561_c1 | 3300050511 | Bacteria | 5390 |
| 671 | nmdc:mga0n895_178635_c1 | 3300050512 | Bacteria | 2154 |
| 672 | nmdc:mga0rr50_72149_c1 | 3300050513 | Bacteria | 2636 |
| 673 | nmdc:mga08x19_11131_c1 | 3300050514 | Bacteria | 5414 |
| 674 | nmdc:mga08x19_95181_c1 | 3300050514 | Bacteria | 1970 |
| 675 | Ga0495619_0536545 | 3300053085 | Bacteria | 803 |
| 676 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 677 | Ga0500643_003843 | 3300053087 | Bacteria | 6992 |
| 678 | Ga0500643_006651 | 3300053087 | Bacteria | 4795 |
| 679 | Ga0500647_0003634 | 3300053091 | Bacteria | 6042 |
| 680 | Ga0500641_0217153 | 3300053096 | Bacteria | 812 |
| 681 | Ga0500562_001061 | 3300053108 | Bacteria | 6752 |
| 682 | Ga0500594_0064491 | 3300053118 | Bacteria | 1064 |
| 683 | Ga0500595_005398 | 3300053119 | Bacteria | 5586 |
| 684 | Ga0500595_028127 | 3300053119 | Bacteria | 1919 |
| 685 | Ga0500595_084723 | 3300053119 | Bacteria | 924 |
| 686 | Ga0500642_0077198 | 3300053130 | Bacteria | 1525 |
| 687 | Ga0500559_0020879 | 3300053136 | Bacteria | 2772 |
| 688 | Ga0500573_0000034 | 3300053140 | Bacteria | 113547 |
| 689 | Ga0500573_0000068 | 3300053140 | Bacteria | 61479 |
| 690 | Ga0500619_018685 | 3300053154 | Bacteria | 1951 |
| 691 | Ga0500645_052097 | 3300053730 | Bacteria | 1193 |
| 692 | Ga0501084_0336011 | 3300054114 | Bacteria | 1276 |
| 693 | Ga0501084_0441751 | 3300054114 | Bacteria | 1100 |
| 694 | Ga0501082_0020270 | 3300060353 | Bacteria | 5732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044536 | Ga0466988_0030677 | Ga0466988_0030677_1855_2271 | 135 |
| 2 | 3300044650 | Ga0466986_0055896 | Ga0466986_0055896_904_1320 | 135 |
| 3 | 3300044651 | Ga0466985_0115163 | Ga0466985_0115163_787_1203 | 135 |
| 4 | 3300044659 | Ga0466973_0025791 | Ga0466973_0025791_3776_4192 | 135 |
| 5 | 3300044660 | Ga0466974_0166001 | Ga0466974_0166001_415_831 | 135 |
| 6 | 3300044661 | Ga0466975_0083820 | Ga0466975_0083820_1057_1473 | 135 |
| 7 | 3300044662 | Ga0466976_0056825 | Ga0466976_0056825_797_1213 | 135 |
| 8 | 3300044663 | Ga0466989_0102508 | Ga0466989_0102508_650_1066 | 135 |
| 9 | 3300044665 | Ga0466987_0072631 | Ga0466987_0072631_1114_1530 | 135 |
| 10 | 3300044666 | Ga0466977_0036505 | Ga0466977_0036505_1936_2352 | 135 |
| 11 | 3300044668 | Ga0466980_0048423 | Ga0466980_0048423_825_1241 | 135 |
| 12 | 3300044669 | Ga0466981_0036148 | Ga0466981_0036148_2185_2601 | 135 |
| 13 | 3300044671 | Ga0466978_0078562 | Ga0466978_0078562_1079_1495 | 135 |
| 14 | 3300044672 | Ga0466982_0065105 | Ga0466982_0065105_1313_1729 | 135 |
| 15 | 3300048619 | Ga0466979_0010527 | Ga0466979_0010527_4220_4636 | 135 |
| 16 | 3300048986 | Ga0466983_0004857 | Ga0466983_0004857_3798_4214 | 135 |
| 17 | 3300006941 | Ga0099825_1002016 | Ga0099825_10020168 | 153 |
| 18 | 3300006942 | Ga0099824_1002564 | Ga0099824_10025647 | 153 |
| 19 | 3300027361 | Ga0209489_100273 | Ga0209489_1002732 | 153 |
| 20 | 3300027363 | Ga0209700_104513 | Ga0209700_10451314 | 153 |
| 21 | 3300031712 | Ga0265342_10281841 | Ga0265342_102818412 | 155 |
| 22 | 3300049161 | Ga0501305_034668 | Ga0501305_034668_288_776 | 155 |
| 23 | iso_pu_bacteria | 2643221598 | 2643998321 | 155 |
| 24 | iso_pu_bacteria | 2643221614 | 2644086820 | 155 |
| 25 | iso_pu_bacteria | 2643221661 | 2644341774 | 155 |
| 26 | iso_pu_bacteria | 2643221666 | 2644368061 | 155 |
| 27 | iso_pu_bacteria | 2891373044 | 2891376351 | 155 |
| 28 | 3300009101 | Ga0105247_11270183 | Ga0105247_112701831 | 156 |
| 29 | 3300009545 | Ga0105237_10893957 | Ga0105237_108939572 | 156 |
| 30 | 3300013306 | Ga0163162_10068461 | Ga0163162_100684612 | 156 |
| 31 | 3300014325 | Ga0163163_10000179 | Ga0163163_1000017914 | 156 |
| 32 | 3300014968 | Ga0157379_10003407 | Ga0157379_100034075 | 156 |
| 33 | 3300025900 | Ga0207710_10570345 | Ga0207710_105703451 | 156 |
| 34 | 3300053119 | Ga0500595_005398 | Ga0500595_005398_1230_1715 | 156 |
| 35 | 3300005334 | Ga0068869_100234412 | Ga0068869_1002344122 | 157 |
| 36 | 3300005364 | Ga0070673_100303682 | Ga0070673_1003036822 | 157 |
| 37 | 3300005435 | Ga0070714_101188842 | Ga0070714_1011888422 | 157 |
| 38 | 3300006173 | Ga0070716_100868279 | Ga0070716_1008682791 | 157 |
| 39 | 3300013297 | Ga0157378_10005318 | Ga0157378_100053184 | 157 |
| 40 | 3300025929 | Ga0207664_10568077 | Ga0207664_105680772 | 157 |
| 41 | 3300025942 | Ga0207689_11685011 | Ga0207689_116850111 | 157 |
| 42 | 3300025960 | Ga0207651_10088471 | Ga0207651_100884712 | 157 |
| 43 | 3300035084 | Ga0373928_0161920 | Ga0373928_0161920_19_507 | 157 |
| 44 | 3300049569 | Ga0501032_0682897 | Ga0501032_0682897_10_498 | 157 |
| 45 | 3300049570 | Ga0501033_0113198 | Ga0501033_0113198_1070_1558 | 157 |
| 46 | 3300049571 | Ga0501034_1160135 | Ga0501034_1160135_12_500 | 157 |
| 47 | 3300049574 | Ga0501038_0145189 | Ga0501038_0145189_166_654 | 157 |
| 48 | 3300049581 | Ga0501047_0042416 | Ga0501047_0042416_3292_3780 | 157 |
| 49 | 3300049823 | Ga0501044_0007426 | Ga0501044_0007426_7764_8252 | 157 |
| 50 | 3300005327 | Ga0070658_10043431 | Ga0070658_100434314 | 158 |
| 51 | 3300005367 | Ga0070667_101438179 | Ga0070667_1014381791 | 158 |
| 52 | 3300005539 | Ga0068853_100423464 | Ga0068853_1004234642 | 158 |
| 53 | 3300005539 | Ga0068853_100716685 | Ga0068853_1007166851 | 158 |
| 54 | 3300005548 | Ga0070665_100022694 | Ga0070665_1000226942 | 158 |
| 55 | 3300005548 | Ga0070665_101245034 | Ga0070665_1012450342 | 158 |
| 56 | 3300005563 | Ga0068855_100014131 | Ga0068855_1000141315 | 158 |
| 57 | 3300005577 | Ga0068857_100016119 | Ga0068857_1000161197 | 158 |
| 58 | 3300005616 | Ga0068852_101477709 | Ga0068852_1014777091 | 158 |
| 59 | 3300006881 | Ga0068865_100178257 | Ga0068865_1001782572 | 158 |
| 60 | 3300006943 | Ga0099822_1000027 | Ga0099822_100002737 | 158 |
| 61 | 3300006944 | Ga0099823_1001895 | Ga0099823_100189518 | 158 |
| 62 | 3300006948 | Ga0099826_10002277 | Ga0099826_1000227718 | 158 |
| 63 | 3300009093 | Ga0105240_10023171 | Ga0105240_100231715 | 158 |
| 64 | 3300009093 | Ga0105240_10032760 | Ga0105240_100327602 | 158 |
| 65 | 3300009174 | Ga0105241_10291668 | Ga0105241_102916682 | 158 |
| 66 | 3300009176 | Ga0105242_10395163 | Ga0105242_103951632 | 158 |
| 67 | 3300009545 | Ga0105237_10397726 | Ga0105237_103977262 | 158 |
| 68 | 3300009551 | Ga0105238_10013759 | Ga0105238_100137595 | 158 |
| 69 | 3300009551 | Ga0105238_10141245 | Ga0105238_101412452 | 158 |
| 70 | 3300009551 | Ga0105238_10147832 | Ga0105238_101478322 | 158 |
| 71 | 3300010375 | Ga0105239_10143688 | Ga0105239_101436882 | 158 |
| 72 | 3300013296 | Ga0157374_10738102 | Ga0157374_107381021 | 158 |
| 73 | 3300013307 | Ga0157372_11290645 | Ga0157372_112906452 | 158 |
| 74 | 3300014969 | Ga0157376_10809119 | Ga0157376_108091192 | 158 |
| 75 | 3300014969 | Ga0157376_11685508 | Ga0157376_116855081 | 158 |
| 76 | 3300021320 | Ga0214544_1001531 | Ga0214544_10015319 | 158 |
| 77 | 3300021321 | Ga0214542_1001461 | Ga0214542_10014619 | 158 |
| 78 | 3300021324 | Ga0214545_1000217 | Ga0214545_100021744 | 158 |
| 79 | 3300021327 | Ga0214543_1000639 | Ga0214543_100063931 | 158 |
| 80 | 3300025909 | Ga0207705_10110402 | Ga0207705_101104022 | 158 |
| 81 | 3300025913 | Ga0207695_10057075 | Ga0207695_100570754 | 158 |
| 82 | 3300025913 | Ga0207695_10223916 | Ga0207695_102239162 | 158 |
| 83 | 3300025913 | Ga0207695_10959787 | Ga0207695_109597871 | 158 |
| 84 | 3300025914 | Ga0207671_10091424 | Ga0207671_100914242 | 158 |
| 85 | 3300025924 | Ga0207694_10092716 | Ga0207694_100927162 | 158 |
| 86 | 3300025938 | Ga0207704_10037197 | Ga0207704_100371975 | 158 |
| 87 | 3300025949 | Ga0207667_10529176 | Ga0207667_105291762 | 158 |
| 88 | 3300025949 | Ga0207667_10566987 | Ga0207667_105669872 | 158 |
| 89 | 3300026041 | Ga0207639_10454425 | Ga0207639_104544252 | 158 |
| 90 | 3300026041 | Ga0207639_10700342 | Ga0207639_107003422 | 158 |
| 91 | 3300026041 | Ga0207639_10836542 | Ga0207639_108365421 | 158 |
| 92 | 3300026116 | Ga0207674_10172710 | Ga0207674_101727102 | 158 |
| 93 | 3300026116 | Ga0207674_11606368 | Ga0207674_116063681 | 158 |
| 94 | 3300026142 | Ga0207698_10890989 | Ga0207698_108909892 | 158 |
| 95 | 3300027296 | Ga0209389_1038111 | Ga0209389_10381113 | 158 |
| 96 | 3300027357 | Ga0209589_1000067 | Ga0209589_100006715 | 158 |
| 97 | 3300028379 | Ga0268266_10057693 | Ga0268266_100576932 | 158 |
| 98 | 3300028379 | Ga0268266_10143383 | Ga0268266_101433832 | 158 |
| 99 | 3300031242 | Ga0265329_10052504 | Ga0265329_100525042 | 158 |
| 100 | 3300036534 | Ga0310109_019444 | Ga0310109_019444_191_892 | 158 |
| 101 | 3300036535 | Ga0310110_021455 | Ga0310110_021455_27_728 | 158 |
| 102 | 3300037312 | Ga0395899_0011095 | Ga0395899_0011095_1404_1883 | 158 |
| 103 | 3300037418 | Ga0395900_0024869 | Ga0395900_0024869_3289_3768 | 158 |
| 104 | 3300037466 | Ga0395898_0006786 | Ga0395898_0006786_7419_7898 | 158 |
| 105 | 3300038443 | Ga0395901_0023404 | Ga0395901_0023404_1937_2416 | 158 |
| 106 | 3300041505 | Ga0451849_1157771 | Ga0451849_1157771_169_753 | 158 |
| 107 | 3300045976 | Ga0466967_1294603 | Ga0466967_1294603_63_545 | 158 |
| 108 | 3300005327 | Ga0070658_10002507 | Ga0070658_1000250711 | 159 |
| 109 | 3300005327 | Ga0070658_10248743 | Ga0070658_102487432 | 159 |
| 110 | 3300005331 | Ga0070670_100059618 | Ga0070670_1000596182 | 159 |
| 111 | 3300005335 | Ga0070666_10000705 | Ga0070666_100007058 | 159 |
| 112 | 3300005335 | Ga0070666_10046551 | Ga0070666_100465511 | 159 |
| 113 | 3300005336 | Ga0070680_100026152 | Ga0070680_1000261522 | 159 |
| 114 | 3300005338 | Ga0068868_100898465 | Ga0068868_1008984651 | 159 |
| 115 | 3300005344 | Ga0070661_100094609 | Ga0070661_1000946093 | 159 |
| 116 | 3300005344 | Ga0070661_100503339 | Ga0070661_1005033391 | 159 |
| 117 | 3300005347 | Ga0070668_100021438 | Ga0070668_1000214382 | 159 |
| 118 | 3300005353 | Ga0070669_100005327 | Ga0070669_1000053272 | 159 |
| 119 | 3300005353 | Ga0070669_100008465 | Ga0070669_1000084654 | 159 |
| 120 | 3300005355 | Ga0070671_100000695 | Ga0070671_10000069512 | 159 |
| 121 | 3300005367 | Ga0070667_100000067 | Ga0070667_10000006775 | 159 |
| 122 | 3300005367 | Ga0070667_100030809 | Ga0070667_1000308092 | 159 |
| 123 | 3300005434 | Ga0070709_10075519 | Ga0070709_100755191 | 159 |
| 124 | 3300005435 | Ga0070714_100131871 | Ga0070714_1001318713 | 159 |
| 125 | 3300005435 | Ga0070714_100749800 | Ga0070714_1007498001 | 159 |
| 126 | 3300005439 | Ga0070711_100058664 | Ga0070711_1000586643 | 159 |
| 127 | 3300005439 | Ga0070711_100883509 | Ga0070711_1008835091 | 159 |
| 128 | 3300005458 | Ga0070681_10127599 | Ga0070681_101275992 | 159 |
| 129 | 3300005458 | Ga0070681_10141566 | Ga0070681_101415661 | 159 |
| 130 | 3300005458 | Ga0070681_10361582 | Ga0070681_103615822 | 159 |
| 131 | 3300005530 | Ga0070679_100113247 | Ga0070679_1001132473 | 159 |
| 132 | 3300005536 | Ga0070697_101285489 | Ga0070697_1012854891 | 159 |
| 133 | 3300005539 | Ga0068853_100004020 | Ga0068853_1000040207 | 159 |
| 134 | 3300005539 | Ga0068853_100050778 | Ga0068853_1000507783 | 159 |
| 135 | 3300005539 | Ga0068853_100229881 | Ga0068853_1002298812 | 159 |
| 136 | 3300005544 | Ga0070686_100001243 | Ga0070686_10000124317 | 159 |
| 137 | 3300005545 | Ga0070695_100022943 | Ga0070695_1000229433 | 159 |
| 138 | 3300005547 | Ga0070693_100733174 | Ga0070693_1007331741 | 159 |
| 139 | 3300005548 | Ga0070665_100000054 | Ga0070665_100000054121 | 159 |
| 140 | 3300005548 | Ga0070665_100000381 | Ga0070665_10000038150 | 159 |
| 141 | 3300005548 | Ga0070665_100197740 | Ga0070665_1001977401 | 159 |
| 142 | 3300005563 | Ga0068855_100009886 | Ga0068855_1000098863 | 159 |
| 143 | 3300005563 | Ga0068855_100199426 | Ga0068855_1001994263 | 159 |
| 144 | 3300005563 | Ga0068855_101386048 | Ga0068855_1013860481 | 159 |
| 145 | 3300005564 | Ga0070664_100200182 | Ga0070664_1002001822 | 159 |
| 146 | 3300005577 | Ga0068857_100004348 | Ga0068857_1000043483 | 159 |
| 147 | 3300005577 | Ga0068857_100012392 | Ga0068857_1000123924 | 159 |
| 148 | 3300005577 | Ga0068857_100072280 | Ga0068857_1000722803 | 159 |
| 149 | 3300005578 | Ga0068854_101030895 | Ga0068854_1010308951 | 159 |
| 150 | 3300005614 | Ga0068856_100053267 | Ga0068856_1000532671 | 159 |
| 151 | 3300005614 | Ga0068856_100305833 | Ga0068856_1003058332 | 159 |
| 152 | 3300005616 | Ga0068852_100011185 | Ga0068852_1000111856 | 159 |
| 153 | 3300005616 | Ga0068852_100120461 | Ga0068852_1001204613 | 159 |
| 154 | 3300005617 | Ga0068859_100001205 | Ga0068859_1000012053 | 159 |
| 155 | 3300005618 | Ga0068864_100159765 | Ga0068864_1001597653 | 159 |
| 156 | 3300005841 | Ga0068863_100000038 | Ga0068863_10000003873 | 159 |
| 157 | 3300005841 | Ga0068863_100038586 | Ga0068863_1000385863 | 159 |
| 158 | 3300005841 | Ga0068863_100061246 | Ga0068863_1000612464 | 159 |
| 159 | 3300005842 | Ga0068858_100008493 | Ga0068858_10000849310 | 159 |
| 160 | 3300005842 | Ga0068858_100075974 | Ga0068858_1000759744 | 159 |
| 161 | 3300005842 | Ga0068858_100749396 | Ga0068858_1007493962 | 159 |
| 162 | 3300005843 | Ga0068860_100009064 | Ga0068860_1000090647 | 159 |
| 163 | 3300005843 | Ga0068860_100983943 | Ga0068860_1009839432 | 159 |
| 164 | 3300005844 | Ga0068862_100159020 | Ga0068862_1001590203 | 159 |
| 165 | 3300006173 | Ga0070716_100069799 | Ga0070716_1000697992 | 159 |
| 166 | 3300006173 | Ga0070716_100231774 | Ga0070716_1002317743 | 159 |
| 167 | 3300006175 | Ga0070712_100002269 | Ga0070712_1000022695 | 159 |
| 168 | 3300006237 | Ga0097621_100483268 | Ga0097621_1004832682 | 159 |
| 169 | 3300006844 | Ga0075428_100167037 | Ga0075428_1001670372 | 159 |
| 170 | 3300006846 | Ga0075430_100256307 | Ga0075430_1002563072 | 159 |
| 171 | 3300006847 | Ga0075431_100133138 | Ga0075431_1001331381 | 159 |
| 172 | 3300006871 | Ga0075434_100055652 | Ga0075434_1000556522 | 159 |
| 173 | 3300006871 | Ga0075434_100898451 | Ga0075434_1008984511 | 159 |
| 174 | 3300006880 | Ga0075429_100524725 | Ga0075429_1005247252 | 159 |
| 175 | 3300006914 | Ga0075436_100051561 | Ga0075436_1000515615 | 159 |
| 176 | 3300006914 | Ga0075436_100106589 | Ga0075436_1001065893 | 159 |
| 177 | 3300006931 | Ga0097620_100001205 | Ga0097620_1000012053 | 159 |
| 178 | 3300007076 | Ga0075435_100250145 | Ga0075435_1002501452 | 159 |
| 179 | 3300007265 | Ga0099794_10416545 | Ga0099794_104165452 | 159 |
| 180 | 3300009093 | Ga0105240_10004317 | Ga0105240_1000431712 | 159 |
| 181 | 3300009093 | Ga0105240_10308211 | Ga0105240_103082111 | 159 |
| 182 | 3300009093 | Ga0105240_10331445 | Ga0105240_103314452 | 159 |
| 183 | 3300009093 | Ga0105240_10385267 | Ga0105240_103852674 | 159 |
| 184 | 3300009093 | Ga0105240_10789476 | Ga0105240_107894761 | 159 |
| 185 | 3300009094 | Ga0111539_10001219 | Ga0111539_100012198 | 159 |
| 186 | 3300009098 | Ga0105245_10222650 | Ga0105245_102226502 | 159 |
| 187 | 3300009101 | Ga0105247_11450259 | Ga0105247_114502591 | 159 |
| 188 | 3300009174 | Ga0105241_10033337 | Ga0105241_100333376 | 159 |
| 189 | 3300009174 | Ga0105241_10272998 | Ga0105241_102729983 | 159 |
| 190 | 3300009177 | Ga0105248_10000005 | Ga0105248_10000005587 | 159 |
| 191 | 3300009177 | Ga0105248_10014965 | Ga0105248_100149656 | 159 |
| 192 | 3300009177 | Ga0105248_10118359 | Ga0105248_101183592 | 159 |
| 193 | 3300009545 | Ga0105237_10006756 | Ga0105237_100067567 | 159 |
| 194 | 3300009545 | Ga0105237_10489383 | Ga0105237_104893832 | 159 |
| 195 | 3300009551 | Ga0105238_10000704 | Ga0105238_1000070427 | 159 |
| 196 | 3300009551 | Ga0105238_10210886 | Ga0105238_102108862 | 159 |
| 197 | 3300009553 | Ga0105249_10529415 | Ga0105249_105294152 | 159 |
| 198 | 3300010375 | Ga0105239_10027086 | Ga0105239_100270866 | 159 |
| 199 | 3300010375 | Ga0105239_10100032 | Ga0105239_101000323 | 159 |
| 200 | 3300013100 | Ga0157373_10000613 | Ga0157373_100006139 | 159 |
| 201 | 3300013104 | Ga0157370_10014410 | Ga0157370_100144105 | 159 |
| 202 | 3300013104 | Ga0157370_10344482 | Ga0157370_103444822 | 159 |
| 203 | 3300013105 | Ga0157369_10016516 | Ga0157369_100165165 | 159 |
| 204 | 3300013105 | Ga0157369_10352799 | Ga0157369_103527992 | 159 |
| 205 | 3300013105 | Ga0157369_10534553 | Ga0157369_105345532 | 159 |
| 206 | 3300013296 | Ga0157374_10062753 | Ga0157374_100627533 | 159 |
| 207 | 3300013297 | Ga0157378_12047602 | Ga0157378_120476021 | 159 |
| 208 | 3300013306 | Ga0163162_10052650 | Ga0163162_100526504 | 159 |
| 209 | 3300013306 | Ga0163162_10166460 | Ga0163162_101664603 | 159 |
| 210 | 3300013308 | Ga0157375_12371666 | Ga0157375_123716661 | 159 |
| 211 | 3300014325 | Ga0163163_10020912 | Ga0163163_100209123 | 159 |
| 212 | 3300014325 | Ga0163163_10053902 | Ga0163163_100539023 | 159 |
| 213 | 3300014497 | Ga0182008_10038277 | Ga0182008_100382774 | 159 |
| 214 | 3300014968 | Ga0157379_10003257 | Ga0157379_100032577 | 159 |
| 215 | 3300014968 | Ga0157379_10020902 | Ga0157379_100209023 | 159 |
| 216 | 3300014968 | Ga0157379_10055597 | Ga0157379_100555975 | 159 |
| 217 | 3300015262 | Ga0182007_10029842 | Ga0182007_100298422 | 159 |
| 218 | 3300021384 | Ga0213876_10000785 | Ga0213876_1000078516 | 159 |
| 219 | 3300021384 | Ga0213876_10283476 | Ga0213876_102834762 | 159 |
| 220 | 3300025893 | Ga0207682_10003025 | Ga0207682_100030252 | 159 |
| 221 | 3300025903 | Ga0207680_10002210 | Ga0207680_100022104 | 159 |
| 222 | 3300025903 | Ga0207680_10002989 | Ga0207680_100029893 | 159 |
| 223 | 3300025906 | Ga0207699_10361200 | Ga0207699_103612001 | 159 |
| 224 | 3300025909 | Ga0207705_10018233 | Ga0207705_100182335 | 159 |
| 225 | 3300025909 | Ga0207705_10235696 | Ga0207705_102356962 | 159 |
| 226 | 3300025911 | Ga0207654_10053426 | Ga0207654_100534263 | 159 |
| 227 | 3300025911 | Ga0207654_10178341 | Ga0207654_101783413 | 159 |
| 228 | 3300025912 | Ga0207707_10209919 | Ga0207707_102099192 | 159 |
| 229 | 3300025912 | Ga0207707_10416634 | Ga0207707_104166341 | 159 |
| 230 | 3300025913 | Ga0207695_10028365 | Ga0207695_100283655 | 159 |
| 231 | 3300025913 | Ga0207695_10284099 | Ga0207695_102840991 | 159 |
| 232 | 3300025913 | Ga0207695_10310250 | Ga0207695_103102502 | 159 |
| 233 | 3300025913 | Ga0207695_10474862 | Ga0207695_104748622 | 159 |
| 234 | 3300025913 | Ga0207695_10522711 | Ga0207695_105227112 | 159 |
| 235 | 3300025914 | Ga0207671_10006474 | Ga0207671_100064743 | 159 |
| 236 | 3300025914 | Ga0207671_10277082 | Ga0207671_102770822 | 159 |
| 237 | 3300025915 | Ga0207693_10000488 | Ga0207693_100004889 | 159 |
| 238 | 3300025916 | Ga0207663_10007822 | Ga0207663_100078223 | 159 |
| 239 | 3300025917 | Ga0207660_10101363 | Ga0207660_101013632 | 159 |
| 240 | 3300025919 | Ga0207657_10217465 | Ga0207657_102174652 | 159 |
| 241 | 3300025920 | Ga0207649_10151325 | Ga0207649_101513252 | 159 |
| 242 | 3300025920 | Ga0207649_11546485 | Ga0207649_115464851 | 159 |
| 243 | 3300025921 | Ga0207652_10052661 | Ga0207652_100526612 | 159 |
| 244 | 3300025923 | Ga0207681_10009037 | Ga0207681_100090372 | 159 |
| 245 | 3300025924 | Ga0207694_10018598 | Ga0207694_100185985 | 159 |
| 246 | 3300025924 | Ga0207694_10251887 | Ga0207694_102518872 | 159 |
| 247 | 3300025925 | Ga0207650_10043414 | Ga0207650_100434143 | 159 |
| 248 | 3300025927 | Ga0207687_10830039 | Ga0207687_108300392 | 159 |
| 249 | 3300025928 | Ga0207700_11019596 | Ga0207700_110195961 | 159 |
| 250 | 3300025929 | Ga0207664_10250170 | Ga0207664_102501702 | 159 |
| 251 | 3300025931 | Ga0207644_10000370 | Ga0207644_1000037031 | 159 |
| 252 | 3300025939 | Ga0207665_10138925 | Ga0207665_101389252 | 159 |
| 253 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002585 | 159 |
| 254 | 3300025941 | Ga0207711_10081394 | Ga0207711_100813943 | 159 |
| 255 | 3300025942 | Ga0207689_10534814 | Ga0207689_105348142 | 159 |
| 256 | 3300025945 | Ga0207679_10068284 | Ga0207679_100682843 | 159 |
| 257 | 3300025949 | Ga0207667_10008750 | Ga0207667_100087505 | 159 |
| 258 | 3300025949 | Ga0207667_10424553 | Ga0207667_104245532 | 159 |
| 259 | 3300025949 | Ga0207667_10560967 | Ga0207667_105609672 | 159 |
| 260 | 3300025949 | Ga0207667_11346983 | Ga0207667_113469831 | 159 |
| 261 | 3300025961 | Ga0207712_10930231 | Ga0207712_109302311 | 159 |
| 262 | 3300025972 | Ga0207668_10000629 | Ga0207668_100006298 | 159 |
| 263 | 3300025972 | Ga0207668_10001707 | Ga0207668_100017074 | 159 |
| 264 | 3300025981 | Ga0207640_10237386 | Ga0207640_102373863 | 159 |
| 265 | 3300025986 | Ga0207658_10000089 | Ga0207658_1000008958 | 159 |
| 266 | 3300025986 | Ga0207658_10006836 | Ga0207658_100068362 | 159 |
| 267 | 3300025986 | Ga0207658_10007746 | Ga0207658_100077467 | 159 |
| 268 | 3300026023 | Ga0207677_10875223 | Ga0207677_108752231 | 159 |
| 269 | 3300026035 | Ga0207703_10006047 | Ga0207703_100060473 | 159 |
| 270 | 3300026035 | Ga0207703_10041321 | Ga0207703_100413212 | 159 |
| 271 | 3300026035 | Ga0207703_10043135 | Ga0207703_100431354 | 159 |
| 272 | 3300026041 | Ga0207639_10010833 | Ga0207639_100108335 | 159 |
| 273 | 3300026041 | Ga0207639_10073939 | Ga0207639_100739392 | 159 |
| 274 | 3300026041 | Ga0207639_10240310 | Ga0207639_102403102 | 159 |
| 275 | 3300026078 | Ga0207702_10005060 | Ga0207702_1000506011 | 159 |
| 276 | 3300026078 | Ga0207702_10116163 | Ga0207702_101161633 | 159 |
| 277 | 3300026078 | Ga0207702_10538844 | Ga0207702_105388442 | 159 |
| 278 | 3300026088 | Ga0207641_10000060 | Ga0207641_1000006088 | 159 |
| 279 | 3300026088 | Ga0207641_10010427 | Ga0207641_100104275 | 159 |
| 280 | 3300026088 | Ga0207641_10146807 | Ga0207641_101468073 | 159 |
| 281 | 3300026095 | Ga0207676_10152784 | Ga0207676_101527842 | 159 |
| 282 | 3300026116 | Ga0207674_10000261 | Ga0207674_100002615 | 159 |
| 283 | 3300026116 | Ga0207674_10011586 | Ga0207674_100115864 | 159 |
| 284 | 3300026116 | Ga0207674_10093073 | Ga0207674_100930732 | 159 |
| 285 | 3300026116 | Ga0207674_11107586 | Ga0207674_111075862 | 159 |
| 286 | 3300026118 | Ga0207675_100274698 | Ga0207675_1002746982 | 159 |
| 287 | 3300026142 | Ga0207698_10148203 | Ga0207698_101482033 | 159 |
| 288 | 3300026142 | Ga0207698_11341091 | Ga0207698_113410911 | 159 |
| 289 | 3300028379 | Ga0268266_10000134 | Ga0268266_100001349 | 159 |
| 290 | 3300028379 | Ga0268266_10000900 | Ga0268266_1000090022 | 159 |
| 291 | 3300028379 | Ga0268266_10068046 | Ga0268266_100680463 | 159 |
| 292 | 3300028380 | Ga0268265_11139781 | Ga0268265_111397812 | 159 |
| 293 | 3300028381 | Ga0268264_10018140 | Ga0268264_100181404 | 159 |
| 294 | 3300028381 | Ga0268264_10919491 | Ga0268264_109194912 | 159 |
| 295 | 3300028573 | Ga0265334_10012178 | Ga0265334_100121783 | 159 |
| 296 | 3300028577 | Ga0265318_10000153 | Ga0265318_1000015364 | 159 |
| 297 | 3300028800 | Ga0265338_10000005 | Ga0265338_10000005316 | 159 |
| 298 | 3300028800 | Ga0265338_10039930 | Ga0265338_100399306 | 159 |
| 299 | 3300028800 | Ga0265338_10080605 | Ga0265338_100806053 | 159 |
| 300 | 3300031235 | Ga0265330_10238357 | Ga0265330_102383571 | 159 |
| 301 | 3300031238 | Ga0265332_10018787 | Ga0265332_100187873 | 159 |
| 302 | 3300031240 | Ga0265320_10001113 | Ga0265320_1000111311 | 159 |
| 303 | 3300031240 | Ga0265320_10251965 | Ga0265320_102519651 | 159 |
| 304 | 3300031241 | Ga0265325_10000005 | Ga0265325_10000005201 | 159 |
| 305 | 3300031241 | Ga0265325_10000830 | Ga0265325_1000083013 | 159 |
| 306 | 3300031241 | Ga0265325_10011932 | Ga0265325_100119321 | 159 |
| 307 | 3300031241 | Ga0265325_10016545 | Ga0265325_100165453 | 159 |
| 308 | 3300031241 | Ga0265325_10228549 | Ga0265325_102285491 | 159 |
| 309 | 3300031247 | Ga0265340_10111090 | Ga0265340_101110901 | 159 |
| 310 | 3300031247 | Ga0265340_10312829 | Ga0265340_103128291 | 159 |
| 311 | 3300031249 | Ga0265339_10015788 | Ga0265339_100157882 | 159 |
| 312 | 3300031249 | Ga0265339_10024408 | Ga0265339_100244085 | 159 |
| 313 | 3300031249 | Ga0265339_10049381 | Ga0265339_100493813 | 159 |
| 314 | 3300031249 | Ga0265339_10347490 | Ga0265339_103474901 | 159 |
| 315 | 3300031250 | Ga0265331_10026019 | Ga0265331_100260193 | 159 |
| 316 | 3300031344 | Ga0265316_10215039 | Ga0265316_102150392 | 159 |
| 317 | 3300031344 | Ga0265316_10432863 | Ga0265316_104328632 | 159 |
| 318 | 3300031548 | Ga0307408_100263273 | Ga0307408_1002632732 | 159 |
| 319 | 3300031595 | Ga0265313_10013915 | Ga0265313_100139156 | 159 |
| 320 | 3300031595 | Ga0265313_10096542 | Ga0265313_100965423 | 159 |
| 321 | 3300031595 | Ga0265313_10119040 | Ga0265313_101190402 | 159 |
| 322 | 3300031711 | Ga0265314_10000125 | Ga0265314_10000125106 | 159 |
| 323 | 3300031711 | Ga0265314_10051436 | Ga0265314_100514364 | 159 |
| 324 | 3300031712 | Ga0265342_10001617 | Ga0265342_100016176 | 159 |
| 325 | 3300031712 | Ga0265342_10017030 | Ga0265342_100170304 | 159 |
| 326 | 3300031824 | Ga0307413_10102252 | Ga0307413_101022522 | 159 |
| 327 | 3300031824 | Ga0307413_10792731 | Ga0307413_107927312 | 159 |
| 328 | 3300031901 | Ga0307406_10353158 | Ga0307406_103531581 | 159 |
| 329 | 3300032004 | Ga0307414_10668725 | Ga0307414_106687251 | 159 |
| 330 | 3300032004 | Ga0307414_10790853 | Ga0307414_107908531 | 159 |
| 331 | 3300035172 | Ga0373955_0093218 | Ga0373955_0093218_684_1166 | 159 |
| 332 | 3300035172 | Ga0373955_0272764 | Ga0373955_0272764_118_600 | 159 |
| 333 | 3300035410 | Ga0373924_0248006 | Ga0373924_0248006_13_495 | 159 |
| 334 | 3300035691 | Ga0373931_0743201 | Ga0373931_0743201_125_607 | 159 |
| 335 | 3300035724 | Ga0373933_0002679 | Ga0373933_0002679_6409_6891 | 159 |
| 336 | 3300035724 | Ga0373933_0076418 | Ga0373933_0076418_1265_1747 | 159 |
| 337 | 3300036401 | Ga0373937_0004365 | Ga0373937_0004365_10010_10492 | 159 |
| 338 | 3300036401 | Ga0373937_0051438 | Ga0373937_0051438_1244_1726 | 159 |
| 339 | 3300036401 | Ga0373937_0074552 | Ga0373937_0074552_1772_2254 | 159 |
| 340 | 3300036401 | Ga0373937_0082163 | Ga0373937_0082163_2280_2813 | 159 |
| 341 | 3300037418 | Ga0395900_0114765 | Ga0395900_0114765_2209_2688 | 159 |
| 342 | 3300037418 | Ga0395900_0127246 | Ga0395900_0127246_644_1123 | 159 |
| 343 | 3300037418 | Ga0395900_1123143 | Ga0395900_1123143_57_545 | 159 |
| 344 | 3300037466 | Ga0395898_0038212 | Ga0395898_0038212_496_996 | 159 |
| 345 | 3300037466 | Ga0395898_0515177 | Ga0395898_0515177_614_1093 | 159 |
| 346 | 3300037471 | Ga0395905_0055927 | Ga0395905_0055927_2383_2862 | 159 |
| 347 | 3300037471 | Ga0395905_0227915 | Ga0395905_0227915_460_942 | 159 |
| 348 | 3300037471 | Ga0395905_0330316 | Ga0395905_0330316_154_636 | 159 |
| 349 | 3300038443 | Ga0395901_0071516 | Ga0395901_0071516_2683_3183 | 159 |
| 350 | 3300038443 | Ga0395901_0293760 | Ga0395901_0293760_610_1089 | 159 |
| 351 | 3300038443 | Ga0395901_0353954 | Ga0395901_0353954_780_1262 | 159 |
| 352 | 3300038443 | Ga0395901_0510728 | Ga0395901_0510728_451_930 | 159 |
| 353 | 3300039437 | Ga0436365_0687864 | Ga0436365_0687864_1910_2392 | 159 |
| 354 | 3300039437 | Ga0436365_0793637 | Ga0436365_0793637_42955_43437 | 159 |
| 355 | 3300039437 | Ga0436365_1183741 | Ga0436365_1183741_7952_8434 | 159 |
| 356 | 3300039453 | Ga0436362_1084872 | Ga0436362_1084872_746_1228 | 159 |
| 357 | 3300041456 | Ga0451795_0209803 | Ga0451795_0209803_43_525 | 159 |
| 358 | 3300044673 | Ga0453683_0912732 | Ga0453683_0912732_17_499 | 159 |
| 359 | 3300044842 | Ga0466957_0059968 | Ga0466957_0059968_1396_1884 | 159 |
| 360 | 3300046459 | Ga0495629_0083349 | Ga0495629_0083349_1543_2031 | 159 |
| 361 | 3300046471 | Ga0495650_0020299 | Ga0495650_0020299_1638_2117 | 159 |
| 362 | 3300046472 | Ga0495580_0011236 | Ga0495580_0011236_4939_5427 | 159 |
| 363 | 3300046473 | Ga0495582_0004184 | Ga0495582_0004184_5577_6065 | 159 |
| 364 | 3300046675 | Ga0495657_0183918 | Ga0495657_0183918_695_1177 | 159 |
| 365 | 3300046679 | Ga0495623_0166054 | Ga0495623_0166054_709_1191 | 159 |
| 366 | 3300046683 | Ga0495658_0000632 | Ga0495658_0000632_12093_12581 | 159 |
| 367 | 3300047315 | Ga0495581_0163435 | Ga0495581_0163435_236_724 | 159 |
| 368 | 3300047315 | Ga0495581_0456796 | Ga0495581_0456796_66_599 | 159 |
| 369 | 3300047322 | Ga0495680_0275584 | Ga0495680_0275584_332_820 | 159 |
| 370 | 3300047471 | Ga0495684_0052598 | Ga0495684_0052598_892_1380 | 159 |
| 371 | 3300047471 | Ga0495684_0361424 | Ga0495684_0361424_505_987 | 159 |
| 372 | 3300048088 | Ga0495602_0136706 | Ga0495602_0136706_478_960 | 159 |
| 373 | 3300048904 | Ga0496101_0257267 | Ga0496101_0257267_77_703 | 159 |
| 374 | 3300048905 | Ga0496102_0000120 | Ga0496102_0000120_67761_68243 | 159 |
| 375 | 3300048906 | Ga0496103_0000154 | Ga0496103_0000154_10290_10772 | 159 |
| 376 | 3300048917 | Ga0496114_0265854 | Ga0496114_0265854_810_1292 | 159 |
| 377 | 3300048919 | Ga0496116_0004809 | Ga0496116_0004809_2569_3051 | 159 |
| 378 | 3300048920 | Ga0496117_0000317 | Ga0496117_0000317_16493_16975 | 159 |
| 379 | 3300048921 | Ga0496118_0000303 | Ga0496118_0000303_16497_16979 | 159 |
| 380 | 3300048922 | Ga0496119_0047407 | Ga0496119_0047407_2179_2661 | 159 |
| 381 | 3300048924 | Ga0496121_0007648 | Ga0496121_0007648_8732_9217 | 159 |
| 382 | 3300048924 | Ga0496121_0045230 | Ga0496121_0045230_3197_3700 | 159 |
| 383 | 3300048925 | Ga0496122_0005688 | Ga0496122_0005688_11363_11845 | 159 |
| 384 | 3300048926 | Ga0496123_0000155 | Ga0496123_0000155_2939_3421 | 159 |
| 385 | 3300048927 | Ga0496124_0000214 | Ga0496124_0000214_44190_44672 | 159 |
| 386 | 3300048928 | Ga0496125_0025348 | Ga0496125_0025348_2868_3350 | 159 |
| 387 | 3300048929 | Ga0496126_0077994 | Ga0496126_0077994_1012_1494 | 159 |
| 388 | 3300049568 | Ga0501031_0024873 | Ga0501031_0024873_743_1228 | 159 |
| 389 | 3300049568 | Ga0501031_0286691 | Ga0501031_0286691_404_889 | 159 |
| 390 | 3300049569 | Ga0501032_0124929 | Ga0501032_0124929_505_990 | 159 |
| 391 | 3300049569 | Ga0501032_0199332 | Ga0501032_0199332_28_510 | 159 |
| 392 | 3300049570 | Ga0501033_0531553 | Ga0501033_0531553_156_641 | 159 |
| 393 | 3300049571 | Ga0501034_0376330 | Ga0501034_0376330_190_675 | 159 |
| 394 | 3300049572 | Ga0501036_0794637 | Ga0501036_0794637_52_537 | 159 |
| 395 | 3300049573 | Ga0501037_0118885 | Ga0501037_0118885_724_1206 | 159 |
| 396 | 3300049574 | Ga0501038_0006992 | Ga0501038_0006992_3634_4116 | 159 |
| 397 | 3300049574 | Ga0501038_0117159 | Ga0501038_0117159_510_992 | 159 |
| 398 | 3300049574 | Ga0501038_0133188 | Ga0501038_0133188_1072_1557 | 159 |
| 399 | 3300049576 | Ga0501040_0461042 | Ga0501040_0461042_304_786 | 159 |
| 400 | 3300049576 | Ga0501040_0735796 | Ga0501040_0735796_23_577 | 159 |
| 401 | 3300049579 | Ga0501043_0391966 | Ga0501043_0391966_28_510 | 159 |
| 402 | 3300049579 | Ga0501043_0645459 | Ga0501043_0645459_106_588 | 159 |
| 403 | 3300049581 | Ga0501047_0009953 | Ga0501047_0009953_1834_2379 | 159 |
| 404 | 3300049581 | Ga0501047_0069635 | Ga0501047_0069635_1722_2204 | 159 |
| 405 | 3300049581 | Ga0501047_0181547 | Ga0501047_0181547_253_735 | 159 |
| 406 | 3300049581 | Ga0501047_0569601 | Ga0501047_0569601_387_869 | 159 |
| 407 | 3300049582 | Ga0501048_0975266 | Ga0501048_0975266_57_539 | 159 |
| 408 | 3300049583 | Ga0501067_0049302 | Ga0501067_0049302_1407_1952 | 159 |
| 409 | 3300049586 | Ga0501070_0000002 | Ga0501070_0000002_307230_307712 | 159 |
| 410 | 3300049586 | Ga0501070_0040470 | Ga0501070_0040470_1177_1659 | 159 |
| 411 | 3300049588 | Ga0501072_0001937 | Ga0501072_0001937_8638_9183 | 159 |
| 412 | 3300049589 | Ga0501073_0027526 | Ga0501073_0027526_2865_3410 | 159 |
| 413 | 3300049589 | Ga0501073_0686601 | Ga0501073_0686601_35_517 | 159 |
| 414 | 3300049590 | Ga0501074_0353404 | Ga0501074_0353404_426_971 | 159 |
| 415 | 3300049590 | Ga0501074_0967029 | Ga0501074_0967029_26_508 | 159 |
| 416 | 3300049591 | Ga0501075_0393093 | Ga0501075_0393093_403_957 | 159 |
| 417 | 3300049668 | Ga0501233_001277 | Ga0501233_001277_1508_1990 | 159 |
| 418 | 3300049741 | Ga0501079_0878652 | Ga0501079_0878652_166_648 | 159 |
| 419 | 3300049742 | Ga0501080_0017903 | Ga0501080_0017903_964_1446 | 159 |
| 420 | 3300049743 | Ga0501081_0235235 | Ga0501081_0235235_22_504 | 159 |
| 421 | 3300049744 | Ga0501083_0238233 | Ga0501083_0238233_70_630 | 159 |
| 422 | 3300049822 | Ga0501035_0017186 | Ga0501035_0017186_4431_4913 | 159 |
| 423 | 3300049822 | Ga0501035_0086374 | Ga0501035_0086374_57_542 | 159 |
| 424 | 3300049822 | Ga0501035_0305338 | Ga0501035_0305338_802_1287 | 159 |
| 425 | 3300049823 | Ga0501044_0010785 | Ga0501044_0010785_371_853 | 159 |
| 426 | 3300049823 | Ga0501044_0049319 | Ga0501044_0049319_3494_3976 | 159 |
| 427 | 3300049823 | Ga0501044_0146524 | Ga0501044_0146524_269_751 | 159 |
| 428 | 3300049823 | Ga0501044_1495748 | Ga0501044_1495748_46_525 | 159 |
| 429 | 3300050507 | nmdc:mga05p37_15849_c1 | nmdc:mga05p37_15849_c1_2225_2713 | 159 |
| 430 | 3300050508 | nmdc:mga09592_419927_c1 | nmdc:mga09592_419927_c1_157_645 | 159 |
| 431 | 3300050509 | nmdc:mga0qj67_36653_c1 | nmdc:mga0qj67_36653_c1_551_1033 | 159 |
| 432 | 3300050510 | nmdc:mga06r32_1276229_c1 | nmdc:mga06r32_1276229_c1_133_621 | 159 |
| 433 | 3300050511 | nmdc:mga08y16_33561_c1 | nmdc:mga08y16_33561_c1_2254_2742 | 159 |
| 434 | 3300050512 | nmdc:mga0n895_178635_c1 | nmdc:mga0n895_178635_c1_1476_1958 | 159 |
| 435 | 3300050513 | nmdc:mga0rr50_72149_c1 | nmdc:mga0rr50_72149_c1_1309_1791 | 159 |
| 436 | 3300050514 | nmdc:mga08x19_11131_c1 | nmdc:mga08x19_11131_c1_4600_5082 | 159 |
| 437 | 3300050514 | nmdc:mga08x19_95181_c1 | nmdc:mga08x19_95181_c1_832_1314 | 159 |
| 438 | 3300053085 | Ga0495619_0536545 | Ga0495619_0536545_157_639 | 159 |
| 439 | 3300053087 | Ga0500643_003843 | Ga0500643_003843_2894_3376 | 159 |
| 440 | 3300053087 | Ga0500643_006651 | Ga0500643_006651_2897_3379 | 159 |
| 441 | 3300053091 | Ga0500647_0003634 | Ga0500647_0003634_985_1467 | 159 |
| 442 | 3300053096 | Ga0500641_0217153 | Ga0500641_0217153_42_530 | 159 |
| 443 | 3300053108 | Ga0500562_001061 | Ga0500562_001061_128_610 | 159 |
| 444 | 3300053119 | Ga0500595_084723 | Ga0500595_084723_312_794 | 159 |
| 445 | 3300053136 | Ga0500559_0020879 | Ga0500559_0020879_807_1289 | 159 |
| 446 | 3300053140 | Ga0500573_0000034 | Ga0500573_0000034_12936_13415 | 159 |
| 447 | 3300053154 | Ga0500619_018685 | Ga0500619_018685_1086_1568 | 159 |
| 448 | 3300053730 | Ga0500645_052097 | Ga0500645_052097_661_1143 | 159 |
| 449 | 3300054114 | Ga0501084_0336011 | Ga0501084_0336011_741_1223 | 159 |
| 450 | 3300054114 | Ga0501084_0441751 | Ga0501084_0441751_258_740 | 159 |
| 451 | 3300003215 | JGI25153J46596_10000638 | JGI25153J46596_1000063814 | 160 |
| 452 | 3300005329 | Ga0070683_100095395 | Ga0070683_1000953954 | 160 |
| 453 | 3300005329 | Ga0070683_100319963 | Ga0070683_1003199632 | 160 |
| 454 | 3300005334 | Ga0068869_100004900 | Ga0068869_1000049005 | 160 |
| 455 | 3300005335 | Ga0070666_10042849 | Ga0070666_100428494 | 160 |
| 456 | 3300005337 | Ga0070682_101245514 | Ga0070682_1012455141 | 160 |
| 457 | 3300005338 | Ga0068868_100283240 | Ga0068868_1002832402 | 160 |
| 458 | 3300005338 | Ga0068868_100421367 | Ga0068868_1004213672 | 160 |
| 459 | 3300005339 | Ga0070660_100006467 | Ga0070660_1000064674 | 160 |
| 460 | 3300005344 | Ga0070661_100434221 | Ga0070661_1004342211 | 160 |
| 461 | 3300005364 | Ga0070673_100015368 | Ga0070673_1000153682 | 160 |
| 462 | 3300005455 | Ga0070663_101507080 | Ga0070663_1015070801 | 160 |
| 463 | 3300005456 | Ga0070678_100036663 | Ga0070678_1000366632 | 160 |
| 464 | 3300005456 | Ga0070678_100139137 | Ga0070678_1001391372 | 160 |
| 465 | 3300005456 | Ga0070678_100724715 | Ga0070678_1007247151 | 160 |
| 466 | 3300005459 | Ga0068867_100001185 | Ga0068867_1000011858 | 160 |
| 467 | 3300005530 | Ga0070679_100285106 | Ga0070679_1002851062 | 160 |
| 468 | 3300005535 | Ga0070684_100125515 | Ga0070684_1001255152 | 160 |
| 469 | 3300005539 | Ga0068853_100686852 | Ga0068853_1006868521 | 160 |
| 470 | 3300005543 | Ga0070672_100520815 | Ga0070672_1005208152 | 160 |
| 471 | 3300005544 | Ga0070686_100313039 | Ga0070686_1003130392 | 160 |
| 472 | 3300005548 | Ga0070665_100073535 | Ga0070665_1000735353 | 160 |
| 473 | 3300005548 | Ga0070665_100303207 | Ga0070665_1003032073 | 160 |
| 474 | 3300005548 | Ga0070665_100510600 | Ga0070665_1005106002 | 160 |
| 475 | 3300005564 | Ga0070664_100706132 | Ga0070664_1007061321 | 160 |
| 476 | 3300005564 | Ga0070664_101081989 | Ga0070664_1010819891 | 160 |
| 477 | 3300005614 | Ga0068856_100049908 | Ga0068856_1000499085 | 160 |
| 478 | 3300005614 | Ga0068856_100183712 | Ga0068856_1001837122 | 160 |
| 479 | 3300005615 | Ga0070702_100600551 | Ga0070702_1006005512 | 160 |
| 480 | 3300005618 | Ga0068864_100309543 | Ga0068864_1003095431 | 160 |
| 481 | 3300005718 | Ga0068866_10021161 | Ga0068866_100211612 | 160 |
| 482 | 3300005834 | Ga0068851_10078834 | Ga0068851_100788342 | 160 |
| 483 | 3300005840 | Ga0068870_10229807 | Ga0068870_102298072 | 160 |
| 484 | 3300005840 | Ga0068870_10234827 | Ga0068870_102348272 | 160 |
| 485 | 3300005841 | Ga0068863_100028623 | Ga0068863_1000286232 | 160 |
| 486 | 3300005842 | Ga0068858_100084085 | Ga0068858_1000840852 | 160 |
| 487 | 3300005842 | Ga0068858_100201926 | Ga0068858_1002019262 | 160 |
| 488 | 3300005844 | Ga0068862_100401047 | Ga0068862_1004010472 | 160 |
| 489 | 3300005844 | Ga0068862_100415732 | Ga0068862_1004157322 | 160 |
| 490 | 3300006237 | Ga0097621_100000201 | Ga0097621_10000020130 | 160 |
| 491 | 3300006237 | Ga0097621_100242673 | Ga0097621_1002426732 | 160 |
| 492 | 3300006358 | Ga0068871_100000805 | Ga0068871_1000008052 | 160 |
| 493 | 3300006358 | Ga0068871_100105402 | Ga0068871_1001054022 | 160 |
| 494 | 3300006358 | Ga0068871_100355575 | Ga0068871_1003555752 | 160 |
| 495 | 3300006358 | Ga0068871_101253175 | Ga0068871_1012531751 | 160 |
| 496 | 3300006881 | Ga0068865_100004736 | Ga0068865_1000047362 | 160 |
| 497 | 3300009093 | Ga0105240_10070676 | Ga0105240_100706765 | 160 |
| 498 | 3300009093 | Ga0105240_10252235 | Ga0105240_102522353 | 160 |
| 499 | 3300009093 | Ga0105240_10878369 | Ga0105240_108783691 | 160 |
| 500 | 3300009093 | Ga0105240_11053545 | Ga0105240_110535452 | 160 |
| 501 | 3300009098 | Ga0105245_10054560 | Ga0105245_100545601 | 160 |
| 502 | 3300009098 | Ga0105245_10109746 | Ga0105245_101097463 | 160 |
| 503 | 3300009101 | Ga0105247_10111633 | Ga0105247_101116333 | 160 |
| 504 | 3300009148 | Ga0105243_10020123 | Ga0105243_100201235 | 160 |
| 505 | 3300009148 | Ga0105243_10101455 | Ga0105243_101014553 | 160 |
| 506 | 3300009174 | Ga0105241_10113267 | Ga0105241_101132672 | 160 |
| 507 | 3300009174 | Ga0105241_10121871 | Ga0105241_101218712 | 160 |
| 508 | 3300009177 | Ga0105248_10033294 | Ga0105248_100332945 | 160 |
| 509 | 3300009177 | Ga0105248_10323578 | Ga0105248_103235782 | 160 |
| 510 | 3300009545 | Ga0105237_10242234 | Ga0105237_102422343 | 160 |
| 511 | 3300009551 | Ga0105238_11377090 | Ga0105238_113770902 | 160 |
| 512 | 3300009553 | Ga0105249_10222999 | Ga0105249_102229992 | 160 |
| 513 | 3300010375 | Ga0105239_10063655 | Ga0105239_100636552 | 160 |
| 514 | 3300010375 | Ga0105239_10651718 | Ga0105239_106517182 | 160 |
| 515 | 3300010375 | Ga0105239_10664047 | Ga0105239_106640472 | 160 |
| 516 | 3300011119 | Ga0105246_10049099 | Ga0105246_100490992 | 160 |
| 517 | 3300011119 | Ga0105246_11085335 | Ga0105246_110853351 | 160 |
| 518 | 3300011119 | Ga0105246_11383577 | Ga0105246_113835771 | 160 |
| 519 | 3300013104 | Ga0157370_10201526 | Ga0157370_102015263 | 160 |
| 520 | 3300013105 | Ga0157369_10031240 | Ga0157369_100312404 | 160 |
| 521 | 3300013296 | Ga0157374_10607754 | Ga0157374_106077541 | 160 |
| 522 | 3300013297 | Ga0157378_11351682 | Ga0157378_113516821 | 160 |
| 523 | 3300013306 | Ga0163162_10067772 | Ga0163162_100677723 | 160 |
| 524 | 3300013306 | Ga0163162_10237609 | Ga0163162_102376093 | 160 |
| 525 | 3300013308 | Ga0157375_10082607 | Ga0157375_100826074 | 160 |
| 526 | 3300013308 | Ga0157375_11013685 | Ga0157375_110136851 | 160 |
| 527 | 3300014325 | Ga0163163_10465171 | Ga0163163_104651712 | 160 |
| 528 | 3300014325 | Ga0163163_11268864 | Ga0163163_112688641 | 160 |
| 529 | 3300014326 | Ga0157380_10546460 | Ga0157380_105464602 | 160 |
| 530 | 3300014745 | Ga0157377_10037725 | Ga0157377_100377252 | 160 |
| 531 | 3300014745 | Ga0157377_10259400 | Ga0157377_102594002 | 160 |
| 532 | 3300014968 | Ga0157379_10080886 | Ga0157379_100808862 | 160 |
| 533 | 3300014969 | Ga0157376_10092811 | Ga0157376_100928113 | 160 |
| 534 | 3300017792 | Ga0163161_10709942 | Ga0163161_107099422 | 160 |
| 535 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015858 | 160 |
| 536 | 3300025261 | Ga0209233_1021831 | Ga0209233_10218312 | 160 |
| 537 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013265 | 160 |
| 538 | 3300025321 | Ga0207656_10181223 | Ga0207656_101812232 | 160 |
| 539 | 3300025900 | Ga0207710_10107847 | Ga0207710_101078471 | 160 |
| 540 | 3300025901 | Ga0207688_10360023 | Ga0207688_103600232 | 160 |
| 541 | 3300025903 | Ga0207680_10208522 | Ga0207680_102085222 | 160 |
| 542 | 3300025903 | Ga0207680_10828810 | Ga0207680_108288101 | 160 |
| 543 | 3300025907 | Ga0207645_10026965 | Ga0207645_100269653 | 160 |
| 544 | 3300025907 | Ga0207645_10219597 | Ga0207645_102195972 | 160 |
| 545 | 3300025908 | Ga0207643_10201751 | Ga0207643_102017512 | 160 |
| 546 | 3300025908 | Ga0207643_10277955 | Ga0207643_102779552 | 160 |
| 547 | 3300025911 | Ga0207654_10199457 | Ga0207654_101994572 | 160 |
| 548 | 3300025911 | Ga0207654_10540629 | Ga0207654_105406291 | 160 |
| 549 | 3300025913 | Ga0207695_10049604 | Ga0207695_100496042 | 160 |
| 550 | 3300025913 | Ga0207695_10423964 | Ga0207695_104239642 | 160 |
| 551 | 3300025913 | Ga0207695_10636228 | Ga0207695_106362281 | 160 |
| 552 | 3300025913 | Ga0207695_10843572 | Ga0207695_108435721 | 160 |
| 553 | 3300025914 | Ga0207671_10163366 | Ga0207671_101633662 | 160 |
| 554 | 3300025914 | Ga0207671_10250687 | Ga0207671_102506872 | 160 |
| 555 | 3300025919 | Ga0207657_10037025 | Ga0207657_100370252 | 160 |
| 556 | 3300025920 | Ga0207649_10642910 | Ga0207649_106429102 | 160 |
| 557 | 3300025921 | Ga0207652_10298442 | Ga0207652_102984423 | 160 |
| 558 | 3300025923 | Ga0207681_10735055 | Ga0207681_107350552 | 160 |
| 559 | 3300025924 | Ga0207694_10408889 | Ga0207694_104088892 | 160 |
| 560 | 3300025925 | Ga0207650_10384239 | Ga0207650_103842391 | 160 |
| 561 | 3300025926 | Ga0207659_10011677 | Ga0207659_100116775 | 160 |
| 562 | 3300025927 | Ga0207687_10161133 | Ga0207687_101611331 | 160 |
| 563 | 3300025927 | Ga0207687_10269950 | Ga0207687_102699502 | 160 |
| 564 | 3300025933 | Ga0207706_10176101 | Ga0207706_101761013 | 160 |
| 565 | 3300025934 | Ga0207686_10015274 | Ga0207686_100152742 | 160 |
| 566 | 3300025934 | Ga0207686_10030132 | Ga0207686_100301322 | 160 |
| 567 | 3300025934 | Ga0207686_10082942 | Ga0207686_100829422 | 160 |
| 568 | 3300025935 | Ga0207709_10006920 | Ga0207709_100069202 | 160 |
| 569 | 3300025935 | Ga0207709_11302266 | Ga0207709_113022661 | 160 |
| 570 | 3300025937 | Ga0207669_10144714 | Ga0207669_101447142 | 160 |
| 571 | 3300025938 | Ga0207704_10129565 | Ga0207704_101295653 | 160 |
| 572 | 3300025940 | Ga0207691_11438753 | Ga0207691_114387531 | 160 |
| 573 | 3300025941 | Ga0207711_10237963 | Ga0207711_102379632 | 160 |
| 574 | 3300025944 | Ga0207661_10065598 | Ga0207661_100655982 | 160 |
| 575 | 3300025949 | Ga0207667_10107093 | Ga0207667_101070934 | 160 |
| 576 | 3300025961 | Ga0207712_10034106 | Ga0207712_100341062 | 160 |
| 577 | 3300025961 | Ga0207712_10061454 | Ga0207712_100614542 | 160 |
| 578 | 3300026023 | Ga0207677_10031216 | Ga0207677_100312162 | 160 |
| 579 | 3300026023 | Ga0207677_11371940 | Ga0207677_113719401 | 160 |
| 580 | 3300026035 | Ga0207703_10075896 | Ga0207703_100758963 | 160 |
| 581 | 3300026035 | Ga0207703_10960569 | Ga0207703_109605692 | 160 |
| 582 | 3300026067 | Ga0207678_10310111 | Ga0207678_103101112 | 160 |
| 583 | 3300026078 | Ga0207702_10119069 | Ga0207702_101190691 | 160 |
| 584 | 3300026078 | Ga0207702_10224640 | Ga0207702_102246402 | 160 |
| 585 | 3300026088 | Ga0207641_10015268 | Ga0207641_100152681 | 160 |
| 586 | 3300026089 | Ga0207648_10147353 | Ga0207648_101473532 | 160 |
| 587 | 3300026089 | Ga0207648_10658283 | Ga0207648_106582832 | 160 |
| 588 | 3300026118 | Ga0207675_100553816 | Ga0207675_1005538162 | 160 |
| 589 | 3300026121 | Ga0207683_10009569 | Ga0207683_100095698 | 160 |
| 590 | 3300026121 | Ga0207683_10053764 | Ga0207683_100537645 | 160 |
| 591 | 3300026121 | Ga0207683_10173954 | Ga0207683_101739542 | 160 |
| 592 | 3300026142 | Ga0207698_10766806 | Ga0207698_107668062 | 160 |
| 593 | 3300028379 | Ga0268266_10033242 | Ga0268266_100332422 | 160 |
| 594 | 3300028379 | Ga0268266_10060669 | Ga0268266_100606692 | 160 |
| 595 | 3300028379 | Ga0268266_10091907 | Ga0268266_100919074 | 160 |
| 596 | 3300028379 | Ga0268266_10254808 | Ga0268266_102548082 | 160 |
| 597 | 3300028379 | Ga0268266_10604439 | Ga0268266_106044392 | 160 |
| 598 | 3300028380 | Ga0268265_10393218 | Ga0268265_103932182 | 160 |
| 599 | 3300028786 | Ga0307517_10171693 | Ga0307517_101716932 | 160 |
| 600 | 3300028800 | Ga0265338_10032597 | Ga0265338_100325972 | 160 |
| 601 | 3300031235 | Ga0265330_10176508 | Ga0265330_101765081 | 160 |
| 602 | 3300031239 | Ga0265328_10068693 | Ga0265328_100686932 | 160 |
| 603 | 3300031249 | Ga0265339_10088546 | Ga0265339_100885463 | 160 |
| 604 | 3300031250 | Ga0265331_10036411 | Ga0265331_100364112 | 160 |
| 605 | 3300031711 | Ga0265314_10021623 | Ga0265314_100216232 | 160 |
| 606 | 3300031730 | Ga0307516_10024687 | Ga0307516_100246872 | 160 |
| 607 | 3300031730 | Ga0307516_10039905 | Ga0307516_100399052 | 160 |
| 608 | 3300035171 | Ga0373946_0038848 | Ga0373946_0038848_1134_1640 | 160 |
| 609 | 3300037471 | Ga0395905_1343235 | Ga0395905_1343235_66_557 | 160 |
| 610 | 3300039437 | Ga0436365_1009922 | Ga0436365_1009922_431_922 | 160 |
| 611 | 3300039453 | Ga0436362_0450835 | Ga0436362_0450835_99_590 | 160 |
| 612 | 3300041460 | Ga0451802_2092102 | Ga0451802_2092102_44_535 | 160 |
| 613 | 3300041512 | Ga0451853_1465112 | Ga0451853_1465112_428_919 | 160 |
| 614 | 3300044536 | Ga0466988_0069378 | Ga0466988_0069378_588_1280 | 160 |
| 615 | 3300044649 | Ga0466984_0007546 | Ga0466984_0007546_5536_6228 | 160 |
| 616 | 3300044651 | Ga0466985_0114239 | Ga0466985_0114239_1114_1806 | 160 |
| 617 | 3300044656 | Ga0466969_0222997 | Ga0466969_0222997_147_839 | 160 |
| 618 | 3300044659 | Ga0466973_0020269 | Ga0466973_0020269_1153_1848 | 160 |
| 619 | 3300044660 | Ga0466974_0037893 | Ga0466974_0037893_594_1286 | 160 |
| 620 | 3300044661 | Ga0466975_0066076 | Ga0466975_0066076_402_1094 | 160 |
| 621 | 3300044662 | Ga0466976_0151782 | Ga0466976_0151782_308_1000 | 160 |
| 622 | 3300044663 | Ga0466989_0015759 | Ga0466989_0015759_2840_3532 | 160 |
| 623 | 3300044666 | Ga0466977_0017853 | Ga0466977_0017853_1291_1983 | 160 |
| 624 | 3300044668 | Ga0466980_0078768 | Ga0466980_0078768_679_1371 | 160 |
| 625 | 3300044669 | Ga0466981_0071562 | Ga0466981_0071562_291_983 | 160 |
| 626 | 3300044671 | Ga0466978_0072563 | Ga0466978_0072563_1088_1780 | 160 |
| 627 | 3300044672 | Ga0466982_0070489 | Ga0466982_0070489_565_1260 | 160 |
| 628 | 3300045051 | Ga0451576_0019052 | Ga0451576_0019052_888_1373 | 160 |
| 629 | 3300046452 | Ga0495617_042718 | Ga0495617_042718_338_829 | 160 |
| 630 | 3300046507 | Ga0495606_0119410 | Ga0495606_0119410_673_1164 | 160 |
| 631 | 3300046539 | Ga0495621_0385877 | Ga0495621_0385877_62_553 | 160 |
| 632 | 3300046557 | Ga0495622_0010955 | Ga0495622_0010955_2531_3022 | 160 |
| 633 | 3300046663 | Ga0495635_0814671 | Ga0495635_0814671_10_513 | 160 |
| 634 | 3300046683 | Ga0495658_0365489 | Ga0495658_0365489_325_828 | 160 |
| 635 | 3300046684 | Ga0495669_0461817 | Ga0495669_0461817_86_574 | 160 |
| 636 | 3300046694 | Ga0495649_0034458 | Ga0495649_0034458_48_539 | 160 |
| 637 | 3300047320 | Ga0495672_0204681 | Ga0495672_0204681_93_584 | 160 |
| 638 | 3300048088 | Ga0495602_0767391 | Ga0495602_0767391_28_519 | 160 |
| 639 | 3300048619 | Ga0466979_0048386 | Ga0466979_0048386_390_1085 | 160 |
| 640 | 3300048924 | Ga0496121_0010270 | Ga0496121_0010270_1737_2228 | 160 |
| 641 | 3300049571 | Ga0501034_0067731 | Ga0501034_0067731_662_1147 | 160 |
| 642 | 3300049580 | Ga0501046_0224897 | Ga0501046_0224897_867_1370 | 160 |
| 643 | 3300049581 | Ga0501047_0563871 | Ga0501047_0563871_437_940 | 160 |
| 644 | 3300049744 | Ga0501083_0203977 | Ga0501083_0203977_401_886 | 160 |
| 645 | 3300049822 | Ga0501035_0064526 | Ga0501035_0064526_2317_2820 | 160 |
| 646 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_615522_616007 | 160 |
| 647 | 3300053118 | Ga0500594_0064491 | Ga0500594_0064491_371_856 | 160 |
| 648 | 3300053119 | Ga0500595_028127 | Ga0500595_028127_816_1307 | 160 |
| 649 | 3300053130 | Ga0500642_0077198 | Ga0500642_0077198_969_1460 | 160 |
| 650 | 3300053140 | Ga0500573_0000068 | Ga0500573_0000068_10488_10979 | 160 |
| 651 | 3300060353 | Ga0501082_0020270 | Ga0501082_0020270_5211_5696 | 160 |
| 652 | 3300001915 | JGI24741J21665_1023279 | JGI24741J21665_10232792 | 162 |
| 653 | 3300001979 | JGI24740J21852_10050168 | JGI24740J21852_100501682 | 162 |
| 654 | 3300002067 | JGI24735J21928_10075824 | JGI24735J21928_100758242 | 162 |
| 655 | 3300005327 | Ga0070658_10020976 | Ga0070658_100209763 | 162 |
| 656 | 3300005327 | Ga0070658_10777845 | Ga0070658_107778452 | 162 |
| 657 | 3300005336 | Ga0070680_100001303 | Ga0070680_10000130313 | 162 |
| 658 | 3300005339 | Ga0070660_100001448 | Ga0070660_1000014486 | 162 |
| 659 | 3300005344 | Ga0070661_100147573 | Ga0070661_1001475731 | 162 |
| 660 | 3300005345 | Ga0070692_10050671 | Ga0070692_100506713 | 162 |
| 661 | 3300005530 | Ga0070679_100033836 | Ga0070679_1000338365 | 162 |
| 662 | 3300005563 | Ga0068855_100003927 | Ga0068855_10000392713 | 162 |
| 663 | 3300005577 | Ga0068857_100260184 | Ga0068857_1002601842 | 162 |
| 664 | 3300005614 | Ga0068856_100341055 | Ga0068856_1003410553 | 162 |
| 665 | 3300013102 | Ga0157371_10250584 | Ga0157371_102505842 | 162 |
| 666 | 3300013104 | Ga0157370_10006032 | Ga0157370_100060325 | 162 |
| 667 | 3300013105 | Ga0157369_10489259 | Ga0157369_104892591 | 162 |
| 668 | 3300025909 | Ga0207705_10000679 | Ga0207705_100006797 | 162 |
| 669 | 3300025912 | Ga0207707_10079785 | Ga0207707_100797853 | 162 |
| 670 | 3300025917 | Ga0207660_10000313 | Ga0207660_1000031313 | 162 |
| 671 | 3300025919 | Ga0207657_10004158 | Ga0207657_1000415812 | 162 |
| 672 | 3300025920 | Ga0207649_10246997 | Ga0207649_102469971 | 162 |
| 673 | 3300025921 | Ga0207652_10000662 | Ga0207652_1000066218 | 162 |
| 674 | 3300025949 | Ga0207667_10007290 | Ga0207667_100072906 | 162 |
| 675 | 3300026067 | Ga0207678_10003372 | Ga0207678_1000337212 | 162 |
| 676 | 3300026116 | Ga0207674_10059522 | Ga0207674_100595224 | 162 |
| 677 | 3300026142 | Ga0207698_10387555 | Ga0207698_103875552 | 162 |
| 678 | 3300026142 | Ga0207698_11247741 | Ga0207698_112477412 | 162 |
| 679 | 3300031731 | Ga0307405_10057716 | Ga0307405_100577163 | 162 |
| 680 | 3300031824 | Ga0307413_10027871 | Ga0307413_100278713 | 162 |
| 681 | 3300031901 | Ga0307406_10072962 | Ga0307406_100729621 | 162 |
| 682 | 3300031903 | Ga0307407_10517553 | Ga0307407_105175532 | 162 |
| 683 | 3300031911 | Ga0307412_11363634 | Ga0307412_113636341 | 162 |
| 684 | 3300031995 | Ga0307409_100075408 | Ga0307409_1000754083 | 162 |
| 685 | 3300032004 | Ga0307414_10061820 | Ga0307414_100618202 | 162 |
| 686 | 3300032005 | Ga0307411_10063962 | Ga0307411_100639623 | 162 |
| 687 | 3300032126 | Ga0307415_100113471 | Ga0307415_1001134712 | 162 |
| 688 | 3300037312 | Ga0395899_0074090 | Ga0395899_0074090_1903_2391 | 162 |
| 689 | 3300037312 | Ga0395899_0086188 | Ga0395899_0086188_102_590 | 162 |
| 690 | 3300037312 | Ga0395899_0233569 | Ga0395899_0233569_63_551 | 162 |
| 691 | 3300037418 | Ga0395900_0102843 | Ga0395900_0102843_1898_2386 | 162 |
| 692 | 3300037418 | Ga0395900_0549490 | Ga0395900_0549490_549_1037 | 162 |
| 693 | 3300037418 | Ga0395900_0595163 | Ga0395900_0595163_89_577 | 162 |
| 694 | 3300037466 | Ga0395898_0046410 | Ga0395898_0046410_63_551 | 162 |
| 695 | 3300037466 | Ga0395898_0542756 | Ga0395898_0542756_554_1042 | 162 |
| 696 | 3300038443 | Ga0395901_0051788 | Ga0395901_0051788_63_551 | 162 |
| 697 | 3300038443 | Ga0395901_0957278 | Ga0395901_0957278_17_505 | 162 |
| 698 | 3300044694 | Ga0466963_0168677 | Ga0466963_0168677_763_1251 | 162 |
| 699 | 3300044706 | Ga0466964_0479701 | Ga0466964_0479701_135_623 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3uma-assembly3.cif.gz_C | crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti | 0.9744 | 1 | 158 |
| 4f82-assembly1.cif.gz_B | x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia | 0.9733 | 1 | 157 |
| 5k2j-assembly3.cif.gz_F | crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus | 0.9715 | 2 | 160 |
| 5k2j-assembly4.cif.gz_H | crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus | 0.9691 | 2 | 159 |
| 5k1g-assembly1.cif.gz_A-2 | crystal structure of reduced prx3 from vibrio vulnificus | 0.964 | 2 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f82B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9733 | 1 | 157 | 3.40.30.10 |
| af_Q54N76_3_172_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9718 | 1 | 158 | 3.40.30.10 |
| 3umaA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.958 | 1 | 158 | 3.40.30.10 |
| af_A0A0R4J5B9_27_197_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9432 | 1 | 158 | 3.40.30.10 |
| af_Q54N76_3_172_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9424 | 1 | 158 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A411Z8W1-F1-model_v4 | deleted | 0.9862 | 37 | 158 |
|
| AF-A0A0D8HLX4-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 0.9855 | 1 | 158 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A520IFE1-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 0.9855 | 50 | 158 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A529ZFL4-F1-model_v4 | deleted | 0.9852 | 30 | 158 |
|
| AF-A0A0N0K1I8-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 0.9839 | 2 | 158 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar