F476061

General Info

Members Datasets Scaffolds Average Seq Length
699 329 694 163

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0238233|Ga0501083_0238233_70_630
Length 186
Sequence VKGGETFAPPAPERYNPHQLQWETRTMTIKVGDKVPSAVLMEMQDGGPKPVKTDDLFAGKKVVLFALPGAFTPTCSAKHVPGFVQNFDELKKKGIDEVACVSVNDAFVMGAWGKDQKSDGKVRMLADGNGDFTRAVGLEMDGSRFGMGKRSQRYAMIVDNGVVKELNVEEPGAFSVSSAEHILGQL

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
71 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
72 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
73 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
108 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
109 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
110 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
173 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
213 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
222 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
223 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
226 3300044649 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4E Metagenome Unclassified
227 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
228 3300044651 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC4E Metagenome Unclassified
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
231 3300044660 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1 Metagenome Unclassified
232 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
233 3300044662 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA4E Metagenome Unclassified
234 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
235 3300044665 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC1E Metagenome Unclassified
236 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
237 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
238 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
239 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
240 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048619 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC3E Metagenome Unclassified
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
282 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
320 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
321 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
322 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.43
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 1.86
Rhizoplane 0.86
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1023279 3300001915 Bacteria 956
2 JGI24740J21852_10050168 3300001979 Bacteria 1202
3 JGI24735J21928_10075824 3300002067 Bacteria 963
4 JGI25153J46596_10000638 3300003215 Bacteria 21413
5 Ga0070658_10002507 3300005327 Bacteria 15338
6 Ga0070658_10020976 3300005327 Bacteria 5234
7 Ga0070658_10043431 3300005327 Bacteria 3631
8 Ga0070658_10248743 3300005327 Bacteria 1508
9 Ga0070658_10777845 3300005327 Bacteria 831
10 Ga0070683_100095395 3300005329 Bacteria 2797
11 Ga0070683_100319963 3300005329 Bacteria 1476
12 Ga0070670_100059618 3300005331 Bacteria 3276
13 Ga0068869_100004900 3300005334 Bacteria 8376
14 Ga0068869_100234412 3300005334 Bacteria 1460
15 Ga0070666_10000705 3300005335 Bacteria 20271
16 Ga0070666_10042849 3300005335 Bacteria 3029
17 Ga0070666_10046551 3300005335 Bacteria 2910
18 Ga0070680_100001303 3300005336 Bacteria 18065
19 Ga0070680_100026152 3300005336 Bacteria 4667
20 Ga0070682_101245514 3300005337 Bacteria 630
21 Ga0068868_100283240 3300005338 Bacteria 1403
22 Ga0068868_100421367 3300005338 Bacteria 1156
23 Ga0068868_100898465 3300005338 Bacteria 805
24 Ga0070660_100001448 3300005339 Bacteria 16219
25 Ga0070660_100006467 3300005339 Bacteria 8125
26 Ga0070661_100094609 3300005344 Bacteria 2215
27 Ga0070661_100147573 3300005344 Bacteria 1776
28 Ga0070661_100434221 3300005344 Bacteria 1043
29 Ga0070661_100503339 3300005344 Bacteria 970
30 Ga0070692_10050671 3300005345 Bacteria 2157
31 Ga0070668_100021438 3300005347 Bacteria 4881
32 Ga0070669_100005327 3300005353 Bacteria 9288
33 Ga0070669_100008465 3300005353 Bacteria 7345
34 Ga0070671_100000695 3300005355 Bacteria 24129
35 Ga0070673_100015368 3300005364 Bacteria 5375
36 Ga0070673_100303682 3300005364 Bacteria 1406
37 Ga0070667_100000067 3300005367 Bacteria 133023
38 Ga0070667_100030809 3300005367 Bacteria 4473
39 Ga0070667_101438179 3300005367 Bacteria 647
40 Ga0070709_10075519 3300005434 Bacteria 2186
41 Ga0070714_100131871 3300005435 Bacteria 2234
42 Ga0070714_100749800 3300005435 Bacteria 944
43 Ga0070714_101188842 3300005435 Bacteria 744
44 Ga0070711_100058664 3300005439 Bacteria 2669
45 Ga0070711_100883509 3300005439 Bacteria 762
46 Ga0070663_101507080 3300005455 Bacteria 598
47 Ga0070678_100036663 3300005456 Bacteria 3434
48 Ga0070678_100139137 3300005456 Bacteria 1940
49 Ga0070678_100724715 3300005456 Bacteria 898
50 Ga0070681_10127599 3300005458 Bacteria 2477
51 Ga0070681_10141566 3300005458 Bacteria 2335
52 Ga0070681_10361582 3300005458 Bacteria 1362
53 Ga0068867_100001185 3300005459 Bacteria 17878
54 Ga0070679_100033836 3300005530 Bacteria 5061
55 Ga0070679_100113247 3300005530 Bacteria 2698
56 Ga0070679_100285106 3300005530 Bacteria 1604
57 Ga0070684_100125515 3300005535 Bacteria 2311
58 Ga0070697_101285489 3300005536 Bacteria 653
59 Ga0068853_100004020 3300005539 Bacteria 11310
60 Ga0068853_100050778 3300005539 Bacteria 3568
61 Ga0068853_100229881 3300005539 Bacteria 1696
62 Ga0068853_100423464 3300005539 Bacteria 1249
63 Ga0068853_100686852 3300005539 Bacteria 976
64 Ga0068853_100716685 3300005539 Bacteria 955
65 Ga0070672_100520815 3300005543 Bacteria 1030
66 Ga0070686_100001243 3300005544 Bacteria 14469
67 Ga0070686_100313039 3300005544 Bacteria 1168
68 Ga0070695_100022943 3300005545 Bacteria 3830
69 Ga0070693_100733174 3300005547 Bacteria 727
70 Ga0070665_100000054 3300005548 Bacteria 244426
71 Ga0070665_100000381 3300005548 Bacteria 65638
72 Ga0070665_100022694 3300005548 Bacteria 6318
73 Ga0070665_100073535 3300005548 Bacteria 3424
74 Ga0070665_100197740 3300005548 Bacteria 2011
75 Ga0070665_100303207 3300005548 Bacteria 1600
76 Ga0070665_100510600 3300005548 Bacteria 1213
77 Ga0070665_101245034 3300005548 Bacteria 754
78 Ga0068855_100003927 3300005563 Bacteria 18145
79 Ga0068855_100009886 3300005563 Bacteria 11506
80 Ga0068855_100014131 3300005563 Bacteria 9618
81 Ga0068855_100199426 3300005563 Bacteria 2254
82 Ga0068855_101386048 3300005563 Bacteria 725
83 Ga0070664_100200182 3300005564 Bacteria 1782
84 Ga0070664_100706132 3300005564 Bacteria 940
85 Ga0070664_101081989 3300005564 Bacteria 755
86 Ga0068857_100004348 3300005577 Bacteria 11963
87 Ga0068857_100012392 3300005577 Bacteria 7421
88 Ga0068857_100016119 3300005577 Bacteria 6546
89 Ga0068857_100072280 3300005577 Bacteria 3074
90 Ga0068857_100260184 3300005577 Bacteria 1592
91 Ga0068854_101030895 3300005578 Bacteria 730
92 Ga0068856_100049908 3300005614 Bacteria 4124
93 Ga0068856_100053267 3300005614 Bacteria 3989
94 Ga0068856_100183712 3300005614 Bacteria 2105
95 Ga0068856_100305833 3300005614 Bacteria 1608
96 Ga0068856_100341055 3300005614 Bacteria 1516
97 Ga0070702_100600551 3300005615 Bacteria 825
98 Ga0068852_100011185 3300005616 Bacteria 6741
99 Ga0068852_100120461 3300005616 Bacteria 2401
100 Ga0068852_101477709 3300005616 Bacteria 702
101 Ga0068859_100001205 3300005617 Bacteria 26395
102 Ga0068864_100159765 3300005618 Bacteria 2048
103 Ga0068864_100309543 3300005618 Bacteria 1481
104 Ga0068866_10021161 3300005718 Bacteria 2992
105 Ga0068851_10078834 3300005834 Bacteria 1716
106 Ga0068870_10229807 3300005840 Bacteria 1140
107 Ga0068870_10234827 3300005840 Bacteria 1129
108 Ga0068863_100000038 3300005841 Bacteria 161477
109 Ga0068863_100028623 3300005841 Bacteria 5319
110 Ga0068863_100038586 3300005841 Bacteria 4543
111 Ga0068863_100061246 3300005841 Bacteria 3558
112 Ga0068858_100008493 3300005842 Bacteria 9869
113 Ga0068858_100075974 3300005842 Bacteria 3121
114 Ga0068858_100084085 3300005842 Bacteria 2960
115 Ga0068858_100201926 3300005842 Bacteria 1880
116 Ga0068858_100749396 3300005842 Bacteria 951
117 Ga0068860_100009064 3300005843 Bacteria 9902
118 Ga0068860_100983943 3300005843 Bacteria 861
119 Ga0068862_100159020 3300005844 Bacteria 2016
120 Ga0068862_100401047 3300005844 Bacteria 1283
121 Ga0068862_100415732 3300005844 Bacteria 1261
122 Ga0070716_100069799 3300006173 Bacteria 2061
123 Ga0070716_100231774 3300006173 Bacteria 1247
124 Ga0070716_100868279 3300006173 Bacteria 704
125 Ga0070712_100002269 3300006175 Bacteria 11837
126 Ga0097621_100000201 3300006237 Bacteria 38886
127 Ga0097621_100242673 3300006237 Bacteria 1575
128 Ga0097621_100483268 3300006237 Bacteria 1120
129 Ga0068871_100000805 3300006358 Bacteria 21096
130 Ga0068871_100105402 3300006358 Bacteria 2366
131 Ga0068871_100355575 3300006358 Bacteria 1296
132 Ga0068871_101253175 3300006358 Bacteria 696
133 Ga0075428_100167037 3300006844 Bacteria 2387
134 Ga0075430_100256307 3300006846 Bacteria 1449
135 Ga0075431_100133138 3300006847 Bacteria 2564
136 Ga0075434_100055652 3300006871 Bacteria 3931
137 Ga0075434_100898451 3300006871 Bacteria 901
138 Ga0075429_100524725 3300006880 Bacteria 1038
139 Ga0068865_100004736 3300006881 Bacteria 8219
140 Ga0068865_100178257 3300006881 Bacteria 1635
141 Ga0075436_100051561 3300006914 Bacteria 2839
142 Ga0075436_100106589 3300006914 Bacteria 1955
143 Ga0097620_100001205 3300006931 Bacteria 26395
144 Ga0099825_1002016 3300006941 Eukaryota 26637
145 Ga0099824_1002564 3300006942 Eukaryota 26613
146 Ga0099822_1000027 3300006943 Eukaryota 64204
147 Ga0099823_1001895 3300006944 Eukaryota 18167
148 Ga0099826_10002277 3300006948 Eukaryota 12280
149 Ga0075435_100250145 3300007076 Bacteria 1509
150 Ga0099794_10416545 3300007265 Bacteria 702
151 Ga0105240_10004317 3300009093 Bacteria 21704
152 Ga0105240_10023171 3300009093 Bacteria 8221
153 Ga0105240_10032760 3300009093 Bacteria 6724
154 Ga0105240_10070676 3300009093 Bacteria 4318
155 Ga0105240_10252235 3300009093 Bacteria 2040
156 Ga0105240_10308211 3300009093 Bacteria 1809
157 Ga0105240_10331445 3300009093 Bacteria 1732
158 Ga0105240_10385267 3300009093 Bacteria 1582
159 Ga0105240_10789476 3300009093 Bacteria 1029
160 Ga0105240_10878369 3300009093 Bacteria 966
161 Ga0105240_11053545 3300009093 Bacteria 867
162 Ga0111539_10001219 3300009094 Bacteria 34227
163 Ga0105245_10054560 3300009098 Bacteria 3589
164 Ga0105245_10109746 3300009098 Bacteria 2564
165 Ga0105245_10222650 3300009098 Bacteria 1821
166 Ga0105247_10111633 3300009101 Bacteria 1760
167 Ga0105247_11270183 3300009101 Bacteria 590
168 Ga0105247_11450259 3300009101 Bacteria 557
169 Ga0105243_10020123 3300009148 Bacteria 5059
170 Ga0105243_10101455 3300009148 Bacteria 2389
171 Ga0105241_10033337 3300009174 Bacteria 3866
172 Ga0105241_10113267 3300009174 Bacteria 2174
173 Ga0105241_10121871 3300009174 Bacteria 2101
174 Ga0105241_10272998 3300009174 Bacteria 1441
175 Ga0105241_10291668 3300009174 Bacteria 1397
176 Ga0105242_10395163 3300009176 Bacteria 1289
177 Ga0105248_10000005 3300009177 Bacteria 673111
178 Ga0105248_10014965 3300009177 Bacteria 8540
179 Ga0105248_10033294 3300009177 Bacteria 5756
180 Ga0105248_10118359 3300009177 Bacteria 2988
181 Ga0105248_10323578 3300009177 Bacteria 1737
182 Ga0105237_10006756 3300009545 Bacteria 12665
183 Ga0105237_10242234 3300009545 Bacteria 1805
184 Ga0105237_10397726 3300009545 Bacteria 1382
185 Ga0105237_10489383 3300009545 Bacteria 1236
186 Ga0105237_10893957 3300009545 Bacteria 895
187 Ga0105238_10000704 3300009551 Bacteria 34914
188 Ga0105238_10013759 3300009551 Bacteria 8177
189 Ga0105238_10141245 3300009551 Bacteria 2385
190 Ga0105238_10147832 3300009551 Bacteria 2326
191 Ga0105238_10210886 3300009551 Bacteria 1918
192 Ga0105238_11377090 3300009551 Bacteria 732
193 Ga0105249_10222999 3300009553 Bacteria 1856
194 Ga0105249_10529415 3300009553 Bacteria 1227
195 Ga0105239_10027086 3300010375 Bacteria 6310
196 Ga0105239_10063655 3300010375 Bacteria 4049
197 Ga0105239_10100032 3300010375 Bacteria 3207
198 Ga0105239_10143688 3300010375 Bacteria 2660
199 Ga0105239_10651718 3300010375 Bacteria 1203
200 Ga0105239_10664047 3300010375 Bacteria 1191
201 Ga0105246_10049099 3300011119 Bacteria 2888
202 Ga0105246_11085335 3300011119 Bacteria 730
203 Ga0105246_11383577 3300011119 Bacteria 656
204 Ga0157373_10000613 3300013100 Bacteria 27891
205 Ga0157371_10250584 3300013102 Bacteria 1275
206 Ga0157370_10006032 3300013104 Bacteria 13471
207 Ga0157370_10014410 3300013104 Bacteria 8083
208 Ga0157370_10201526 3300013104 Bacteria 1846
209 Ga0157370_10344482 3300013104 Bacteria 1374
210 Ga0157369_10016516 3300013105 Bacteria 8299
211 Ga0157369_10031240 3300013105 Bacteria 5867
212 Ga0157369_10352799 3300013105 Bacteria 1528
213 Ga0157369_10489259 3300013105 Bacteria 1273
214 Ga0157369_10534553 3300013105 Bacteria 1212
215 Ga0157374_10062753 3300013296 Bacteria 3484
216 Ga0157374_10607754 3300013296 Bacteria 1104
217 Ga0157374_10738102 3300013296 Bacteria 999
218 Ga0157378_10005318 3300013297 Bacteria 11303
219 Ga0157378_11351682 3300013297 Bacteria 754
220 Ga0157378_12047602 3300013297 Bacteria 623
221 Ga0163162_10052650 3300013306 Bacteria 4089
222 Ga0163162_10067772 3300013306 Bacteria 3619
223 Ga0163162_10068461 3300013306 Bacteria 3601
224 Ga0163162_10166460 3300013306 Bacteria 2328
225 Ga0163162_10237609 3300013306 Bacteria 1953
226 Ga0157372_11290645 3300013307 Bacteria 843
227 Ga0157375_10082607 3300013308 Bacteria 3255
228 Ga0157375_11013685 3300013308 Bacteria 969
229 Ga0157375_12371666 3300013308 Bacteria 633
230 Ga0163163_10000179 3300014325 Bacteria 65182
231 Ga0163163_10020912 3300014325 Bacteria 6171
232 Ga0163163_10053902 3300014325 Bacteria 3972
233 Ga0163163_10465171 3300014325 Bacteria 1325
234 Ga0163163_11268864 3300014325 Bacteria 799
235 Ga0157380_10546460 3300014326 Bacteria 1135
236 Ga0182008_10038277 3300014497 Bacteria 2398
237 Ga0157377_10037725 3300014745 Bacteria 2663
238 Ga0157377_10259400 3300014745 Bacteria 1130
239 Ga0157379_10003257 3300014968 Bacteria 13757
240 Ga0157379_10003407 3300014968 Bacteria 13447
241 Ga0157379_10020902 3300014968 Bacteria 5792
242 Ga0157379_10055597 3300014968 Bacteria 3536
243 Ga0157379_10080886 3300014968 Bacteria 2910
244 Ga0157376_10092811 3300014969 Bacteria 2618
245 Ga0157376_10809119 3300014969 Bacteria 950
246 Ga0157376_11685508 3300014969 Bacteria 669
247 Ga0182007_10029842 3300015262 Bacteria 1866
248 Ga0163161_10709942 3300017792 Bacteria 838
249 Ga0214544_1001531 3300021320 Eukaryota 48286
250 Ga0214542_1001461 3300021321 Eukaryota 48370
251 Ga0214545_1000217 3300021324 Eukaryota 78396
252 Ga0214543_1000639 3300021327 Eukaryota 60739
253 Ga0213876_10000785 3300021384 Bacteria 21620
254 Ga0213876_10283476 3300021384 Bacteria 880
255 Ga0209233_1000015 3300025261 Bacteria 980563
256 Ga0209233_1021831 3300025261 Bacteria 1649
257 Ga0209758_1000013 3300025297 Bacteria 873003
258 Ga0207656_10181223 3300025321 Bacteria 1011
259 Ga0207682_10003025 3300025893 Bacteria 7373
260 Ga0207710_10107847 3300025900 Bacteria 1320
261 Ga0207710_10570345 3300025900 Bacteria 590
262 Ga0207688_10360023 3300025901 Bacteria 897
263 Ga0207680_10002210 3300025903 Bacteria 9087
264 Ga0207680_10002989 3300025903 Bacteria 7926
265 Ga0207680_10208522 3300025903 Bacteria 1335
266 Ga0207680_10828810 3300025903 Bacteria 663
267 Ga0207699_10361200 3300025906 Bacteria 1027
268 Ga0207645_10026965 3300025907 Bacteria 3712
269 Ga0207645_10219597 3300025907 Bacteria 1253
270 Ga0207643_10201751 3300025908 Bacteria 1211
271 Ga0207643_10277955 3300025908 Bacteria 1038
272 Ga0207705_10000679 3300025909 Bacteria 28173
273 Ga0207705_10018233 3300025909 Bacteria 5019
274 Ga0207705_10110402 3300025909 Bacteria 2032
275 Ga0207705_10235696 3300025909 Bacteria 1393
276 Ga0207654_10053426 3300025911 Bacteria 2332
277 Ga0207654_10178341 3300025911 Bacteria 1384
278 Ga0207654_10199457 3300025911 Bacteria 1317
279 Ga0207654_10540629 3300025911 Bacteria 827
280 Ga0207707_10079785 3300025912 Bacteria 2858
281 Ga0207707_10209919 3300025912 Bacteria 1696
282 Ga0207707_10416634 3300025912 Bacteria 1152
283 Ga0207695_10028365 3300025913 Bacteria 6210
284 Ga0207695_10049604 3300025913 Bacteria 4423
285 Ga0207695_10057075 3300025913 Bacteria 4059
286 Ga0207695_10223916 3300025913 Bacteria 1788
287 Ga0207695_10284099 3300025913 Bacteria 1548
288 Ga0207695_10310250 3300025913 Bacteria 1468
289 Ga0207695_10423964 3300025913 Bacteria 1214
290 Ga0207695_10474862 3300025913 Bacteria 1133
291 Ga0207695_10522711 3300025913 Bacteria 1068
292 Ga0207695_10636228 3300025913 Bacteria 948
293 Ga0207695_10843572 3300025913 Bacteria 796
294 Ga0207695_10959787 3300025913 Bacteria 735
295 Ga0207671_10006474 3300025914 Bacteria 10426
296 Ga0207671_10091424 3300025914 Bacteria 2293
297 Ga0207671_10163366 3300025914 Bacteria 1725
298 Ga0207671_10250687 3300025914 Bacteria 1392
299 Ga0207671_10277082 3300025914 Bacteria 1322
300 Ga0207693_10000488 3300025915 Bacteria 35928
301 Ga0207663_10007822 3300025916 Bacteria 5567
302 Ga0207660_10000313 3300025917 Bacteria 31761
303 Ga0207660_10101363 3300025917 Bacteria 2151
304 Ga0207657_10004158 3300025919 Bacteria 15338
305 Ga0207657_10037025 3300025919 Bacteria 4362
306 Ga0207657_10217465 3300025919 Bacteria 1532
307 Ga0207649_10151325 3300025920 Bacteria 1598
308 Ga0207649_10246997 3300025920 Bacteria 1283
309 Ga0207649_10642910 3300025920 Bacteria 819
310 Ga0207649_11546485 3300025920 Bacteria 525
311 Ga0207652_10000662 3300025921 Bacteria 33794
312 Ga0207652_10052661 3300025921 Bacteria 3494
313 Ga0207652_10298442 3300025921 Bacteria 1454
314 Ga0207681_10009037 3300025923 Bacteria 6088
315 Ga0207681_10735055 3300025923 Bacteria 822
316 Ga0207694_10018598 3300025924 Bacteria 5252
317 Ga0207694_10092716 3300025924 Bacteria 2385
318 Ga0207694_10251887 3300025924 Bacteria 1445
319 Ga0207694_10408889 3300025924 Bacteria 1129
320 Ga0207650_10043414 3300025925 Bacteria 3300
321 Ga0207650_10384239 3300025925 Bacteria 1160
322 Ga0207659_10011677 3300025926 Bacteria 5557
323 Ga0207687_10161133 3300025927 Bacteria 1722
324 Ga0207687_10269950 3300025927 Bacteria 1359
325 Ga0207687_10830039 3300025927 Bacteria 789
326 Ga0207700_11019596 3300025928 Bacteria 740
327 Ga0207664_10250170 3300025929 Bacteria 1547
328 Ga0207664_10568077 3300025929 Bacteria 1018
329 Ga0207644_10000370 3300025931 Bacteria 29393
330 Ga0207706_10176101 3300025933 Bacteria 1879
331 Ga0207686_10015274 3300025934 Bacteria 4290
332 Ga0207686_10030132 3300025934 Bacteria 3209
333 Ga0207686_10082942 3300025934 Bacteria 2097
334 Ga0207709_10006920 3300025935 Bacteria 6343
335 Ga0207709_11302266 3300025935 Bacteria 600
336 Ga0207669_10144714 3300025937 Bacteria 1656
337 Ga0207704_10037197 3300025938 Bacteria 2810
338 Ga0207704_10129565 3300025938 Bacteria 1744
339 Ga0207665_10138925 3300025939 Bacteria 1730
340 Ga0207691_11438753 3300025940 Bacteria 565
341 Ga0207711_10000002 3300025941 Bacteria 1228676
342 Ga0207711_10081394 3300025941 Bacteria 2830
343 Ga0207711_10237963 3300025941 Bacteria 1669
344 Ga0207689_10534814 3300025942 Bacteria 984
345 Ga0207689_11685011 3300025942 Bacteria 526
346 Ga0207661_10065598 3300025944 Bacteria 2948
347 Ga0207679_10068284 3300025945 Bacteria 2670
348 Ga0207667_10007290 3300025949 Bacteria 13325
349 Ga0207667_10008750 3300025949 Bacteria 12000
350 Ga0207667_10107093 3300025949 Bacteria 2883
351 Ga0207667_10424553 3300025949 Bacteria 1352
352 Ga0207667_10529176 3300025949 Bacteria 1194
353 Ga0207667_10560967 3300025949 Bacteria 1154
354 Ga0207667_10566987 3300025949 Bacteria 1147
355 Ga0207667_11346983 3300025949 Bacteria 689
356 Ga0207651_10088471 3300025960 Bacteria 2258
357 Ga0207712_10034106 3300025961 Bacteria 3446
358 Ga0207712_10061454 3300025961 Bacteria 2666
359 Ga0207712_10930231 3300025961 Bacteria 769
360 Ga0207668_10000629 3300025972 Bacteria 21816
361 Ga0207668_10001707 3300025972 Bacteria 12845
362 Ga0207640_10237386 3300025981 Bacteria 1406
363 Ga0207658_10000089 3300025986 Bacteria 100308
364 Ga0207658_10006836 3300025986 Bacteria 7773
365 Ga0207658_10007746 3300025986 Bacteria 7321
366 Ga0207677_10031216 3300026023 Bacteria 3410
367 Ga0207677_10875223 3300026023 Bacteria 808
368 Ga0207677_11371940 3300026023 Bacteria 650
369 Ga0207703_10006047 3300026035 Bacteria 9680
370 Ga0207703_10041321 3300026035 Bacteria 3693
371 Ga0207703_10043135 3300026035 Bacteria 3619
372 Ga0207703_10075896 3300026035 Bacteria 2787
373 Ga0207703_10960569 3300026035 Bacteria 819
374 Ga0207639_10010833 3300026041 Bacteria 6322
375 Ga0207639_10073939 3300026041 Bacteria 2674
376 Ga0207639_10240310 3300026041 Bacteria 1574
377 Ga0207639_10454425 3300026041 Bacteria 1163
378 Ga0207639_10700342 3300026041 Bacteria 940
379 Ga0207639_10836542 3300026041 Bacteria 859
380 Ga0207678_10003372 3300026067 Bacteria 14408
381 Ga0207678_10310111 3300026067 Bacteria 1357
382 Ga0207702_10005060 3300026078 Bacteria 11576
383 Ga0207702_10116163 3300026078 Bacteria 2388
384 Ga0207702_10119069 3300026078 Bacteria 2360
385 Ga0207702_10224640 3300026078 Bacteria 1751
386 Ga0207702_10538844 3300026078 Bacteria 1141
387 Ga0207641_10000060 3300026088 Bacteria 161514
388 Ga0207641_10010427 3300026088 Bacteria 7636
389 Ga0207641_10015268 3300026088 Bacteria 6294
390 Ga0207641_10146807 3300026088 Bacteria 2133
391 Ga0207648_10147353 3300026089 Bacteria 2076
392 Ga0207648_10658283 3300026089 Bacteria 968
393 Ga0207676_10152784 3300026095 Bacteria 1990
394 Ga0207674_10000261 3300026116 Bacteria 66008
395 Ga0207674_10011586 3300026116 Bacteria 9903
396 Ga0207674_10059522 3300026116 Bacteria 3865
397 Ga0207674_10093073 3300026116 Bacteria 3003
398 Ga0207674_10172710 3300026116 Bacteria 2114
399 Ga0207674_11107586 3300026116 Bacteria 761
400 Ga0207674_11606368 3300026116 Bacteria 619
401 Ga0207675_100274698 3300026118 Bacteria 1636
402 Ga0207675_100553816 3300026118 Bacteria 1149
403 Ga0207683_10009569 3300026121 Bacteria 8263
404 Ga0207683_10053764 3300026121 Bacteria 3531
405 Ga0207683_10173954 3300026121 Bacteria 1951
406 Ga0207698_10148203 3300026142 Bacteria 2033
407 Ga0207698_10387555 3300026142 Bacteria 1331
408 Ga0207698_10766806 3300026142 Bacteria 964
409 Ga0207698_10890989 3300026142 Bacteria 896
410 Ga0207698_11247741 3300026142 Bacteria 758
411 Ga0207698_11341091 3300026142 Bacteria 730
412 Ga0209389_1038111 3300027296 Eukaryota 3795
413 Ga0209589_1000067 3300027357 Eukaryota 100489
414 Ga0209489_100273 3300027361 Eukaryota 89325
415 Ga0209700_104513 3300027363 Eukaryota 24977
416 Ga0268266_10000134 3300028379 Bacteria 143139
417 Ga0268266_10000900 3300028379 Bacteria 38445
418 Ga0268266_10033242 3300028379 Bacteria 4385
419 Ga0268266_10057693 3300028379 Bacteria 3341
420 Ga0268266_10060669 3300028379 Bacteria 3260
421 Ga0268266_10068046 3300028379 Bacteria 3083
422 Ga0268266_10091907 3300028379 Bacteria 2662
423 Ga0268266_10143383 3300028379 Bacteria 2145
424 Ga0268266_10254808 3300028379 Bacteria 1624
425 Ga0268266_10604439 3300028379 Bacteria 1053
426 Ga0268265_10393218 3300028380 Bacteria 1279
427 Ga0268265_11139781 3300028380 Bacteria 775
428 Ga0268264_10018140 3300028381 Bacteria 5755
429 Ga0268264_10919491 3300028381 Bacteria 879
430 Ga0265334_10012178 3300028573 Bacteria 3614
431 Ga0265318_10000153 3300028577 Bacteria 62095
432 Ga0307517_10171693 3300028786 Bacteria 1424
433 Ga0265338_10000005 3300028800 Bacteria 571137
434 Ga0265338_10032597 3300028800 Bacteria 5075
435 Ga0265338_10039930 3300028800 Bacteria 4416
436 Ga0265338_10080605 3300028800 Bacteria 2734
437 Ga0265330_10176508 3300031235 Bacteria 905
438 Ga0265330_10238357 3300031235 Bacteria 767
439 Ga0265332_10018787 3300031238 Bacteria 3051
440 Ga0265328_10068693 3300031239 Bacteria 1302
441 Ga0265320_10001113 3300031240 Bacteria 19838
442 Ga0265320_10251965 3300031240 Bacteria 783
443 Ga0265325_10000005 3300031241 Bacteria 321343
444 Ga0265325_10000830 3300031241 Bacteria 22349
445 Ga0265325_10011932 3300031241 Bacteria 4981
446 Ga0265325_10016545 3300031241 Bacteria 4123
447 Ga0265325_10228549 3300031241 Bacteria 849
448 Ga0265329_10052504 3300031242 Bacteria 1297
449 Ga0265340_10111090 3300031247 Bacteria 1267
450 Ga0265340_10312829 3300031247 Bacteria 696
451 Ga0265339_10015788 3300031249 Bacteria 4517
452 Ga0265339_10024408 3300031249 Bacteria 3484
453 Ga0265339_10049381 3300031249 Bacteria 2304
454 Ga0265339_10088546 3300031249 Bacteria 1626
455 Ga0265339_10347490 3300031249 Bacteria 700
456 Ga0265331_10026019 3300031250 Bacteria 2948
457 Ga0265331_10036411 3300031250 Bacteria 2416
458 Ga0265316_10215039 3300031344 Bacteria 1420
459 Ga0265316_10432863 3300031344 Bacteria 945
460 Ga0307408_100263273 3300031548 Bacteria 1428
461 Ga0265313_10013915 3300031595 Bacteria 4791
462 Ga0265313_10096542 3300031595 Bacteria 1318
463 Ga0265313_10119040 3300031595 Bacteria 1154
464 Ga0265314_10000125 3300031711 Bacteria 118671
465 Ga0265314_10021623 3300031711 Bacteria 4941
466 Ga0265314_10051436 3300031711 Bacteria 2869
467 Ga0265342_10001617 3300031712 Bacteria 20801
468 Ga0265342_10017030 3300031712 Bacteria 4734
469 Ga0265342_10281841 3300031712 Bacteria 879
470 Ga0307516_10024687 3300031730 Bacteria 6137
471 Ga0307516_10039905 3300031730 Bacteria 4676
472 Ga0307405_10057716 3300031731 Bacteria 2440
473 Ga0307413_10027871 3300031824 Bacteria 3138
474 Ga0307413_10102252 3300031824 Bacteria 1897
475 Ga0307413_10792731 3300031824 Bacteria 795
476 Ga0307406_10072962 3300031901 Bacteria 2255
477 Ga0307406_10353158 3300031901 Bacteria 1150
478 Ga0307407_10517553 3300031903 Bacteria 877
479 Ga0307412_11363634 3300031911 Bacteria 640
480 Ga0307409_100075408 3300031995 Bacteria 2700
481 Ga0307414_10061820 3300032004 Bacteria 2654
482 Ga0307414_10668725 3300032004 Bacteria 937
483 Ga0307414_10790853 3300032004 Bacteria 864
484 Ga0307411_10063962 3300032005 Bacteria 2461
485 Ga0307415_100113471 3300032126 Bacteria 2015
486 Ga0373928_0161920 3300035084 Bacteria 626
487 Ga0373946_0038848 3300035171 Bacteria 1941
488 Ga0373955_0093218 3300035172 Bacteria 1719
489 Ga0373955_0272764 3300035172 Bacteria 1017
490 Ga0373924_0248006 3300035410 Bacteria 788
491 Ga0373931_0743201 3300035691 Bacteria 651
492 Ga0373933_0002679 3300035724 Bacteria 9969
493 Ga0373933_0076418 3300035724 Bacteria 2046
494 Ga0373937_0004365 3300036401 Bacteria 12006
495 Ga0373937_0051438 3300036401 Bacteria 3776
496 Ga0373937_0074552 3300036401 Bacteria 3131
497 Ga0373937_0082163 3300036401 Bacteria 2981
498 Ga0310109_019444 3300036534 Eukaryota 918
499 Ga0310110_021455 3300036535 Eukaryota 889
500 Ga0395899_0011095 3300037312 Bacteria 6901
501 Ga0395899_0074090 3300037312 Bacteria 2488
502 Ga0395899_0086188 3300037312 Bacteria 2281
503 Ga0395899_0233569 3300037312 Bacteria 1268
504 Ga0395900_0024869 3300037418 Bacteria 6129
505 Ga0395900_0102843 3300037418 Bacteria 2934
506 Ga0395900_0114765 3300037418 Bacteria 2764
507 Ga0395900_0127246 3300037418 Bacteria 2612
508 Ga0395900_0549490 3300037418 Bacteria 1099
509 Ga0395900_0595163 3300037418 Bacteria 1047
510 Ga0395900_1123143 3300037418 Bacteria 703
511 Ga0395898_0006786 3300037466 Bacteria 12186
512 Ga0395898_0038212 3300037466 Bacteria 4759
513 Ga0395898_0046410 3300037466 Bacteria 4267
514 Ga0395898_0515177 3300037466 Bacteria 1137
515 Ga0395898_0542756 3300037466 Bacteria 1104
516 Ga0395905_0055927 3300037471 Bacteria 3693
517 Ga0395905_0227915 3300037471 Bacteria 1743
518 Ga0395905_0330316 3300037471 Bacteria 1415
519 Ga0395905_1343235 3300037471 Bacteria 619
520 Ga0395901_0023404 3300038443 Bacteria 6332
521 Ga0395901_0051788 3300038443 Bacteria 4267
522 Ga0395901_0071516 3300038443 Bacteria 3615
523 Ga0395901_0293760 3300038443 Bacteria 1686
524 Ga0395901_0353954 3300038443 Bacteria 1515
525 Ga0395901_0510728 3300038443 Bacteria 1222
526 Ga0395901_0957278 3300038443 Bacteria 834
527 Ga0436365_0687864 3300039437 Bacteria 8538
528 Ga0436365_0793637 3300039437 Bacteria 44268
529 Ga0436365_1009922 3300039437 Bacteria 2518
530 Ga0436365_1183741 3300039437 Bacteria 9800
531 Ga0436362_0450835 3300039453 Bacteria 642
532 Ga0436362_1084872 3300039453 Bacteria 1242
533 Ga0451795_0209803 3300041456 Bacteria 782
534 Ga0451802_2092102 3300041460 Bacteria 574
535 Ga0451849_1157771 3300041505 Eukaryota 1001
536 Ga0451853_1465112 3300041512 Bacteria 955
537 Ga0466988_0030677 3300044536 Eukaryota 3052
538 Ga0466988_0069378 3300044536 Eukaryota 2080
539 Ga0466984_0007546 3300044649 Eukaryota 6752
540 Ga0466986_0055896 3300044650 Eukaryota 2729
541 Ga0466985_0114239 3300044651 Eukaryota 1837
542 Ga0466985_0115163 3300044651 Eukaryota 1828
543 Ga0466969_0222997 3300044656 Eukaryota 857
544 Ga0466973_0020269 3300044659 Eukaryota 6353
545 Ga0466973_0025791 3300044659 Eukaryota 5641
546 Ga0466974_0037893 3300044660 Eukaryota 3182
547 Ga0466974_0166001 3300044660 Eukaryota 1414
548 Ga0466975_0066076 3300044661 Eukaryota 2582
549 Ga0466975_0083820 3300044661 Eukaryota 2272
550 Ga0466976_0056825 3300044662 Eukaryota 2368
551 Ga0466976_0151782 3300044662 Eukaryota 1397
552 Ga0466989_0015759 3300044663 Eukaryota 4224
553 Ga0466989_0102508 3300044663 Eukaryota 1757
554 Ga0466987_0072631 3300044665 Eukaryota 2169
555 Ga0466977_0017853 3300044666 Eukaryota 4307
556 Ga0466977_0036505 3300044666 Eukaryota 3175
557 Ga0466980_0048423 3300044668 Eukaryota 2973
558 Ga0466980_0078768 3300044668 Eukaryota 2287
559 Ga0466981_0036148 3300044669 Eukaryota 3536
560 Ga0466981_0071562 3300044669 Eukaryota 2485
561 Ga0466978_0072563 3300044671 Eukaryota 2148
562 Ga0466978_0078562 3300044671 Eukaryota 2059
563 Ga0466982_0065105 3300044672 Eukaryota 2246
564 Ga0466982_0070489 3300044672 Eukaryota 2158
565 Ga0453683_0912732 3300044673 Bacteria 581
566 Ga0466963_0168677 3300044694 Bacteria 1525
567 Ga0466964_0479701 3300044706 Bacteria 664
568 Ga0466957_0059968 3300044842 Bacteria 2333
569 Ga0451576_0019052 3300045051 Bacteria 7499
570 Ga0466967_1294603 3300045976 Bacteria 726
571 Ga0495617_042718 3300046452 Bacteria 1515
572 Ga0495629_0083349 3300046459 Bacteria 2232
573 Ga0495650_0020299 3300046471 Bacteria 3243
574 Ga0495580_0011236 3300046472 Bacteria 6928
575 Ga0495582_0004184 3300046473 Bacteria 8114
576 Ga0495606_0119410 3300046507 Bacteria 1580
577 Ga0495621_0385877 3300046539 Bacteria 592
578 Ga0495622_0010955 3300046557 Bacteria 4184
579 Ga0495635_0814671 3300046663 Bacteria 601
580 Ga0495657_0183918 3300046675 Bacteria 1281
581 Ga0495623_0166054 3300046679 Bacteria 1293
582 Ga0495658_0000632 3300046683 Bacteria 19106
583 Ga0495658_0365489 3300046683 Bacteria 918
584 Ga0495669_0461817 3300046684 Bacteria 617
585 Ga0495649_0034458 3300046694 Bacteria 2786
586 Ga0495581_0163435 3300047315 Bacteria 1301
587 Ga0495581_0456796 3300047315 Bacteria 744
588 Ga0495672_0204681 3300047320 Bacteria 985
589 Ga0495680_0275584 3300047322 Bacteria 1187
590 Ga0495684_0052598 3300047471 Bacteria 3108
591 Ga0495684_0361424 3300047471 Bacteria 1028
592 Ga0495602_0136706 3300048088 Bacteria 1946
593 Ga0495602_0767391 3300048088 Bacteria 650
594 Ga0466979_0010527 3300048619 Eukaryota 6600
595 Ga0466979_0048386 3300048619 Eukaryota 3266
596 Ga0496101_0257267 3300048904 Bacteria 1361
597 Ga0496102_0000120 3300048905 Bacteria 112432
598 Ga0496103_0000154 3300048906 Bacteria 72239
599 Ga0496114_0265854 3300048917 Bacteria 1511
600 Ga0496116_0004809 3300048919 Bacteria 12742
601 Ga0496117_0000317 3300048920 Bacteria 84472
602 Ga0496118_0000303 3300048921 Bacteria 85332
603 Ga0496119_0047407 3300048922 Bacteria 2674
604 Ga0496121_0007648 3300048924 Bacteria 12982
605 Ga0496121_0010270 3300048924 Bacteria 10593
606 Ga0496121_0045230 3300048924 Bacteria 3785
607 Ga0496122_0005688 3300048925 Bacteria 14715
608 Ga0496123_0000155 3300048926 Bacteria 139646
609 Ga0496124_0000214 3300048927 Bacteria 113007
610 Ga0496125_0025348 3300048928 Bacteria 5432
611 Ga0496126_0077994 3300048929 Bacteria 2936
612 Ga0466983_0004857 3300048986 Eukaryota 9155
613 Ga0501305_034668 3300049161 Eukaryota 801
614 Ga0501031_0024873 3300049568 Bacteria 3905
615 Ga0501031_0286691 3300049568 Bacteria 1068
616 Ga0501032_0124929 3300049569 Bacteria 1700
617 Ga0501032_0199332 3300049569 Bacteria 1306
618 Ga0501032_0682897 3300049569 Bacteria 651
619 Ga0501033_0113198 3300049570 Bacteria 1973
620 Ga0501033_0531553 3300049570 Bacteria 811
621 Ga0501034_0067731 3300049571 Unclassified 3582
622 Ga0501034_0376330 3300049571 Bacteria 1345
623 Ga0501034_1160135 3300049571 Bacteria 652
624 Ga0501036_0794637 3300049572 Bacteria 779
625 Ga0501037_0118885 3300049573 Bacteria 1901
626 Ga0501038_0006992 3300049574 Bacteria 10421
627 Ga0501038_0117159 3300049574 Bacteria 2200
628 Ga0501038_0133188 3300049574 Bacteria 2038
629 Ga0501038_0145189 3300049574 Bacteria 1938
630 Ga0501040_0461042 3300049576 Bacteria 915
631 Ga0501040_0735796 3300049576 Bacteria 713
632 Ga0501043_0391966 3300049579 Bacteria 1050
633 Ga0501043_0645459 3300049579 Bacteria 778
634 Ga0501046_0224897 3300049580 Bacteria 1388
635 Ga0501047_0009953 3300049581 Bacteria 8992
636 Ga0501047_0042416 3300049581 Bacteria 4397
637 Ga0501047_0069635 3300049581 Bacteria 3388
638 Ga0501047_0181547 3300049581 Bacteria 1971
639 Ga0501047_0563871 3300049581 Bacteria 962
640 Ga0501047_0569601 3300049581 Bacteria 956
641 Ga0501048_0975266 3300049582 Bacteria 610
642 Ga0501067_0049302 3300049583 Bacteria 2333
643 Ga0501070_0000002 3300049586 Bacteria 347524
644 Ga0501070_0040470 3300049586 Bacteria 3886
645 Ga0501072_0001937 3300049588 Bacteria 15425
646 Ga0501073_0027526 3300049589 Bacteria 4065
647 Ga0501073_0686601 3300049589 Bacteria 706
648 Ga0501074_0353404 3300049590 Bacteria 1043
649 Ga0501074_0967029 3300049590 Bacteria 599
650 Ga0501075_0393093 3300049591 Bacteria 1057
651 Ga0501233_001277 3300049668 Bacteria 4302
652 Ga0501079_0878652 3300049741 Bacteria 706
653 Ga0501080_0017903 3300049742 Bacteria 6558
654 Ga0501081_0235235 3300049743 Bacteria 1335
655 Ga0501083_0203977 3300049744 Unclassified 1289
656 Ga0501083_0238233 3300049744 Bacteria 1185
657 Ga0501035_0017186 3300049822 Bacteria 6667
658 Ga0501035_0064526 3300049822 Bacteria 3255
659 Ga0501035_0086374 3300049822 Bacteria 2764
660 Ga0501035_0305338 3300049822 Bacteria 1340
661 Ga0501044_0007426 3300049823 Bacteria 12057
662 Ga0501044_0010785 3300049823 Bacteria 9916
663 Ga0501044_0049319 3300049823 Bacteria 4346
664 Ga0501044_0146524 3300049823 Bacteria 2346
665 Ga0501044_1495748 3300049823 Bacteria 540
666 nmdc:mga05p37_15849_c1 3300050507 Bacteria 3724
667 nmdc:mga09592_419927_c1 3300050508 Bacteria 1155
668 nmdc:mga0qj67_36653_c1 3300050509 Bacteria 3838
669 nmdc:mga06r32_1276229_c1 3300050510 Bacteria 679
670 nmdc:mga08y16_33561_c1 3300050511 Bacteria 5390
671 nmdc:mga0n895_178635_c1 3300050512 Bacteria 2154
672 nmdc:mga0rr50_72149_c1 3300050513 Bacteria 2636
673 nmdc:mga08x19_11131_c1 3300050514 Bacteria 5414
674 nmdc:mga08x19_95181_c1 3300050514 Bacteria 1970
675 Ga0495619_0536545 3300053085 Bacteria 803
676 Ga0500643_000003 3300053087 Bacteria 876659
677 Ga0500643_003843 3300053087 Bacteria 6992
678 Ga0500643_006651 3300053087 Bacteria 4795
679 Ga0500647_0003634 3300053091 Bacteria 6042
680 Ga0500641_0217153 3300053096 Bacteria 812
681 Ga0500562_001061 3300053108 Bacteria 6752
682 Ga0500594_0064491 3300053118 Bacteria 1064
683 Ga0500595_005398 3300053119 Bacteria 5586
684 Ga0500595_028127 3300053119 Bacteria 1919
685 Ga0500595_084723 3300053119 Bacteria 924
686 Ga0500642_0077198 3300053130 Bacteria 1525
687 Ga0500559_0020879 3300053136 Bacteria 2772
688 Ga0500573_0000034 3300053140 Bacteria 113547
689 Ga0500573_0000068 3300053140 Bacteria 61479
690 Ga0500619_018685 3300053154 Bacteria 1951
691 Ga0500645_052097 3300053730 Bacteria 1193
692 Ga0501084_0336011 3300054114 Bacteria 1276
693 Ga0501084_0441751 3300054114 Bacteria 1100
694 Ga0501082_0020270 3300060353 Bacteria 5732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044536 Ga0466988_0030677 Ga0466988_0030677_1855_2271 135
2 3300044650 Ga0466986_0055896 Ga0466986_0055896_904_1320 135
3 3300044651 Ga0466985_0115163 Ga0466985_0115163_787_1203 135
4 3300044659 Ga0466973_0025791 Ga0466973_0025791_3776_4192 135
5 3300044660 Ga0466974_0166001 Ga0466974_0166001_415_831 135
6 3300044661 Ga0466975_0083820 Ga0466975_0083820_1057_1473 135
7 3300044662 Ga0466976_0056825 Ga0466976_0056825_797_1213 135
8 3300044663 Ga0466989_0102508 Ga0466989_0102508_650_1066 135
9 3300044665 Ga0466987_0072631 Ga0466987_0072631_1114_1530 135
10 3300044666 Ga0466977_0036505 Ga0466977_0036505_1936_2352 135
11 3300044668 Ga0466980_0048423 Ga0466980_0048423_825_1241 135
12 3300044669 Ga0466981_0036148 Ga0466981_0036148_2185_2601 135
13 3300044671 Ga0466978_0078562 Ga0466978_0078562_1079_1495 135
14 3300044672 Ga0466982_0065105 Ga0466982_0065105_1313_1729 135
15 3300048619 Ga0466979_0010527 Ga0466979_0010527_4220_4636 135
16 3300048986 Ga0466983_0004857 Ga0466983_0004857_3798_4214 135
17 3300006941 Ga0099825_1002016 Ga0099825_10020168 153
18 3300006942 Ga0099824_1002564 Ga0099824_10025647 153
19 3300027361 Ga0209489_100273 Ga0209489_1002732 153
20 3300027363 Ga0209700_104513 Ga0209700_10451314 153
21 3300031712 Ga0265342_10281841 Ga0265342_102818412 155
22 3300049161 Ga0501305_034668 Ga0501305_034668_288_776 155
23 iso_pu_bacteria 2643221598 2643998321 155
24 iso_pu_bacteria 2643221614 2644086820 155
25 iso_pu_bacteria 2643221661 2644341774 155
26 iso_pu_bacteria 2643221666 2644368061 155
27 iso_pu_bacteria 2891373044 2891376351 155
28 3300009101 Ga0105247_11270183 Ga0105247_112701831 156
29 3300009545 Ga0105237_10893957 Ga0105237_108939572 156
30 3300013306 Ga0163162_10068461 Ga0163162_100684612 156
31 3300014325 Ga0163163_10000179 Ga0163163_1000017914 156
32 3300014968 Ga0157379_10003407 Ga0157379_100034075 156
33 3300025900 Ga0207710_10570345 Ga0207710_105703451 156
34 3300053119 Ga0500595_005398 Ga0500595_005398_1230_1715 156
35 3300005334 Ga0068869_100234412 Ga0068869_1002344122 157
36 3300005364 Ga0070673_100303682 Ga0070673_1003036822 157
37 3300005435 Ga0070714_101188842 Ga0070714_1011888422 157
38 3300006173 Ga0070716_100868279 Ga0070716_1008682791 157
39 3300013297 Ga0157378_10005318 Ga0157378_100053184 157
40 3300025929 Ga0207664_10568077 Ga0207664_105680772 157
41 3300025942 Ga0207689_11685011 Ga0207689_116850111 157
42 3300025960 Ga0207651_10088471 Ga0207651_100884712 157
43 3300035084 Ga0373928_0161920 Ga0373928_0161920_19_507 157
44 3300049569 Ga0501032_0682897 Ga0501032_0682897_10_498 157
45 3300049570 Ga0501033_0113198 Ga0501033_0113198_1070_1558 157
46 3300049571 Ga0501034_1160135 Ga0501034_1160135_12_500 157
47 3300049574 Ga0501038_0145189 Ga0501038_0145189_166_654 157
48 3300049581 Ga0501047_0042416 Ga0501047_0042416_3292_3780 157
49 3300049823 Ga0501044_0007426 Ga0501044_0007426_7764_8252 157
50 3300005327 Ga0070658_10043431 Ga0070658_100434314 158
51 3300005367 Ga0070667_101438179 Ga0070667_1014381791 158
52 3300005539 Ga0068853_100423464 Ga0068853_1004234642 158
53 3300005539 Ga0068853_100716685 Ga0068853_1007166851 158
54 3300005548 Ga0070665_100022694 Ga0070665_1000226942 158
55 3300005548 Ga0070665_101245034 Ga0070665_1012450342 158
56 3300005563 Ga0068855_100014131 Ga0068855_1000141315 158
57 3300005577 Ga0068857_100016119 Ga0068857_1000161197 158
58 3300005616 Ga0068852_101477709 Ga0068852_1014777091 158
59 3300006881 Ga0068865_100178257 Ga0068865_1001782572 158
60 3300006943 Ga0099822_1000027 Ga0099822_100002737 158
61 3300006944 Ga0099823_1001895 Ga0099823_100189518 158
62 3300006948 Ga0099826_10002277 Ga0099826_1000227718 158
63 3300009093 Ga0105240_10023171 Ga0105240_100231715 158
64 3300009093 Ga0105240_10032760 Ga0105240_100327602 158
65 3300009174 Ga0105241_10291668 Ga0105241_102916682 158
66 3300009176 Ga0105242_10395163 Ga0105242_103951632 158
67 3300009545 Ga0105237_10397726 Ga0105237_103977262 158
68 3300009551 Ga0105238_10013759 Ga0105238_100137595 158
69 3300009551 Ga0105238_10141245 Ga0105238_101412452 158
70 3300009551 Ga0105238_10147832 Ga0105238_101478322 158
71 3300010375 Ga0105239_10143688 Ga0105239_101436882 158
72 3300013296 Ga0157374_10738102 Ga0157374_107381021 158
73 3300013307 Ga0157372_11290645 Ga0157372_112906452 158
74 3300014969 Ga0157376_10809119 Ga0157376_108091192 158
75 3300014969 Ga0157376_11685508 Ga0157376_116855081 158
76 3300021320 Ga0214544_1001531 Ga0214544_10015319 158
77 3300021321 Ga0214542_1001461 Ga0214542_10014619 158
78 3300021324 Ga0214545_1000217 Ga0214545_100021744 158
79 3300021327 Ga0214543_1000639 Ga0214543_100063931 158
80 3300025909 Ga0207705_10110402 Ga0207705_101104022 158
81 3300025913 Ga0207695_10057075 Ga0207695_100570754 158
82 3300025913 Ga0207695_10223916 Ga0207695_102239162 158
83 3300025913 Ga0207695_10959787 Ga0207695_109597871 158
84 3300025914 Ga0207671_10091424 Ga0207671_100914242 158
85 3300025924 Ga0207694_10092716 Ga0207694_100927162 158
86 3300025938 Ga0207704_10037197 Ga0207704_100371975 158
87 3300025949 Ga0207667_10529176 Ga0207667_105291762 158
88 3300025949 Ga0207667_10566987 Ga0207667_105669872 158
89 3300026041 Ga0207639_10454425 Ga0207639_104544252 158
90 3300026041 Ga0207639_10700342 Ga0207639_107003422 158
91 3300026041 Ga0207639_10836542 Ga0207639_108365421 158
92 3300026116 Ga0207674_10172710 Ga0207674_101727102 158
93 3300026116 Ga0207674_11606368 Ga0207674_116063681 158
94 3300026142 Ga0207698_10890989 Ga0207698_108909892 158
95 3300027296 Ga0209389_1038111 Ga0209389_10381113 158
96 3300027357 Ga0209589_1000067 Ga0209589_100006715 158
97 3300028379 Ga0268266_10057693 Ga0268266_100576932 158
98 3300028379 Ga0268266_10143383 Ga0268266_101433832 158
99 3300031242 Ga0265329_10052504 Ga0265329_100525042 158
100 3300036534 Ga0310109_019444 Ga0310109_019444_191_892 158
101 3300036535 Ga0310110_021455 Ga0310110_021455_27_728 158
102 3300037312 Ga0395899_0011095 Ga0395899_0011095_1404_1883 158
103 3300037418 Ga0395900_0024869 Ga0395900_0024869_3289_3768 158
104 3300037466 Ga0395898_0006786 Ga0395898_0006786_7419_7898 158
105 3300038443 Ga0395901_0023404 Ga0395901_0023404_1937_2416 158
106 3300041505 Ga0451849_1157771 Ga0451849_1157771_169_753 158
107 3300045976 Ga0466967_1294603 Ga0466967_1294603_63_545 158
108 3300005327 Ga0070658_10002507 Ga0070658_1000250711 159
109 3300005327 Ga0070658_10248743 Ga0070658_102487432 159
110 3300005331 Ga0070670_100059618 Ga0070670_1000596182 159
111 3300005335 Ga0070666_10000705 Ga0070666_100007058 159
112 3300005335 Ga0070666_10046551 Ga0070666_100465511 159
113 3300005336 Ga0070680_100026152 Ga0070680_1000261522 159
114 3300005338 Ga0068868_100898465 Ga0068868_1008984651 159
115 3300005344 Ga0070661_100094609 Ga0070661_1000946093 159
116 3300005344 Ga0070661_100503339 Ga0070661_1005033391 159
117 3300005347 Ga0070668_100021438 Ga0070668_1000214382 159
118 3300005353 Ga0070669_100005327 Ga0070669_1000053272 159
119 3300005353 Ga0070669_100008465 Ga0070669_1000084654 159
120 3300005355 Ga0070671_100000695 Ga0070671_10000069512 159
121 3300005367 Ga0070667_100000067 Ga0070667_10000006775 159
122 3300005367 Ga0070667_100030809 Ga0070667_1000308092 159
123 3300005434 Ga0070709_10075519 Ga0070709_100755191 159
124 3300005435 Ga0070714_100131871 Ga0070714_1001318713 159
125 3300005435 Ga0070714_100749800 Ga0070714_1007498001 159
126 3300005439 Ga0070711_100058664 Ga0070711_1000586643 159
127 3300005439 Ga0070711_100883509 Ga0070711_1008835091 159
128 3300005458 Ga0070681_10127599 Ga0070681_101275992 159
129 3300005458 Ga0070681_10141566 Ga0070681_101415661 159
130 3300005458 Ga0070681_10361582 Ga0070681_103615822 159
131 3300005530 Ga0070679_100113247 Ga0070679_1001132473 159
132 3300005536 Ga0070697_101285489 Ga0070697_1012854891 159
133 3300005539 Ga0068853_100004020 Ga0068853_1000040207 159
134 3300005539 Ga0068853_100050778 Ga0068853_1000507783 159
135 3300005539 Ga0068853_100229881 Ga0068853_1002298812 159
136 3300005544 Ga0070686_100001243 Ga0070686_10000124317 159
137 3300005545 Ga0070695_100022943 Ga0070695_1000229433 159
138 3300005547 Ga0070693_100733174 Ga0070693_1007331741 159
139 3300005548 Ga0070665_100000054 Ga0070665_100000054121 159
140 3300005548 Ga0070665_100000381 Ga0070665_10000038150 159
141 3300005548 Ga0070665_100197740 Ga0070665_1001977401 159
142 3300005563 Ga0068855_100009886 Ga0068855_1000098863 159
143 3300005563 Ga0068855_100199426 Ga0068855_1001994263 159
144 3300005563 Ga0068855_101386048 Ga0068855_1013860481 159
145 3300005564 Ga0070664_100200182 Ga0070664_1002001822 159
146 3300005577 Ga0068857_100004348 Ga0068857_1000043483 159
147 3300005577 Ga0068857_100012392 Ga0068857_1000123924 159
148 3300005577 Ga0068857_100072280 Ga0068857_1000722803 159
149 3300005578 Ga0068854_101030895 Ga0068854_1010308951 159
150 3300005614 Ga0068856_100053267 Ga0068856_1000532671 159
151 3300005614 Ga0068856_100305833 Ga0068856_1003058332 159
152 3300005616 Ga0068852_100011185 Ga0068852_1000111856 159
153 3300005616 Ga0068852_100120461 Ga0068852_1001204613 159
154 3300005617 Ga0068859_100001205 Ga0068859_1000012053 159
155 3300005618 Ga0068864_100159765 Ga0068864_1001597653 159
156 3300005841 Ga0068863_100000038 Ga0068863_10000003873 159
157 3300005841 Ga0068863_100038586 Ga0068863_1000385863 159
158 3300005841 Ga0068863_100061246 Ga0068863_1000612464 159
159 3300005842 Ga0068858_100008493 Ga0068858_10000849310 159
160 3300005842 Ga0068858_100075974 Ga0068858_1000759744 159
161 3300005842 Ga0068858_100749396 Ga0068858_1007493962 159
162 3300005843 Ga0068860_100009064 Ga0068860_1000090647 159
163 3300005843 Ga0068860_100983943 Ga0068860_1009839432 159
164 3300005844 Ga0068862_100159020 Ga0068862_1001590203 159
165 3300006173 Ga0070716_100069799 Ga0070716_1000697992 159
166 3300006173 Ga0070716_100231774 Ga0070716_1002317743 159
167 3300006175 Ga0070712_100002269 Ga0070712_1000022695 159
168 3300006237 Ga0097621_100483268 Ga0097621_1004832682 159
169 3300006844 Ga0075428_100167037 Ga0075428_1001670372 159
170 3300006846 Ga0075430_100256307 Ga0075430_1002563072 159
171 3300006847 Ga0075431_100133138 Ga0075431_1001331381 159
172 3300006871 Ga0075434_100055652 Ga0075434_1000556522 159
173 3300006871 Ga0075434_100898451 Ga0075434_1008984511 159
174 3300006880 Ga0075429_100524725 Ga0075429_1005247252 159
175 3300006914 Ga0075436_100051561 Ga0075436_1000515615 159
176 3300006914 Ga0075436_100106589 Ga0075436_1001065893 159
177 3300006931 Ga0097620_100001205 Ga0097620_1000012053 159
178 3300007076 Ga0075435_100250145 Ga0075435_1002501452 159
179 3300007265 Ga0099794_10416545 Ga0099794_104165452 159
180 3300009093 Ga0105240_10004317 Ga0105240_1000431712 159
181 3300009093 Ga0105240_10308211 Ga0105240_103082111 159
182 3300009093 Ga0105240_10331445 Ga0105240_103314452 159
183 3300009093 Ga0105240_10385267 Ga0105240_103852674 159
184 3300009093 Ga0105240_10789476 Ga0105240_107894761 159
185 3300009094 Ga0111539_10001219 Ga0111539_100012198 159
186 3300009098 Ga0105245_10222650 Ga0105245_102226502 159
187 3300009101 Ga0105247_11450259 Ga0105247_114502591 159
188 3300009174 Ga0105241_10033337 Ga0105241_100333376 159
189 3300009174 Ga0105241_10272998 Ga0105241_102729983 159
190 3300009177 Ga0105248_10000005 Ga0105248_10000005587 159
191 3300009177 Ga0105248_10014965 Ga0105248_100149656 159
192 3300009177 Ga0105248_10118359 Ga0105248_101183592 159
193 3300009545 Ga0105237_10006756 Ga0105237_100067567 159
194 3300009545 Ga0105237_10489383 Ga0105237_104893832 159
195 3300009551 Ga0105238_10000704 Ga0105238_1000070427 159
196 3300009551 Ga0105238_10210886 Ga0105238_102108862 159
197 3300009553 Ga0105249_10529415 Ga0105249_105294152 159
198 3300010375 Ga0105239_10027086 Ga0105239_100270866 159
199 3300010375 Ga0105239_10100032 Ga0105239_101000323 159
200 3300013100 Ga0157373_10000613 Ga0157373_100006139 159
201 3300013104 Ga0157370_10014410 Ga0157370_100144105 159
202 3300013104 Ga0157370_10344482 Ga0157370_103444822 159
203 3300013105 Ga0157369_10016516 Ga0157369_100165165 159
204 3300013105 Ga0157369_10352799 Ga0157369_103527992 159
205 3300013105 Ga0157369_10534553 Ga0157369_105345532 159
206 3300013296 Ga0157374_10062753 Ga0157374_100627533 159
207 3300013297 Ga0157378_12047602 Ga0157378_120476021 159
208 3300013306 Ga0163162_10052650 Ga0163162_100526504 159
209 3300013306 Ga0163162_10166460 Ga0163162_101664603 159
210 3300013308 Ga0157375_12371666 Ga0157375_123716661 159
211 3300014325 Ga0163163_10020912 Ga0163163_100209123 159
212 3300014325 Ga0163163_10053902 Ga0163163_100539023 159
213 3300014497 Ga0182008_10038277 Ga0182008_100382774 159
214 3300014968 Ga0157379_10003257 Ga0157379_100032577 159
215 3300014968 Ga0157379_10020902 Ga0157379_100209023 159
216 3300014968 Ga0157379_10055597 Ga0157379_100555975 159
217 3300015262 Ga0182007_10029842 Ga0182007_100298422 159
218 3300021384 Ga0213876_10000785 Ga0213876_1000078516 159
219 3300021384 Ga0213876_10283476 Ga0213876_102834762 159
220 3300025893 Ga0207682_10003025 Ga0207682_100030252 159
221 3300025903 Ga0207680_10002210 Ga0207680_100022104 159
222 3300025903 Ga0207680_10002989 Ga0207680_100029893 159
223 3300025906 Ga0207699_10361200 Ga0207699_103612001 159
224 3300025909 Ga0207705_10018233 Ga0207705_100182335 159
225 3300025909 Ga0207705_10235696 Ga0207705_102356962 159
226 3300025911 Ga0207654_10053426 Ga0207654_100534263 159
227 3300025911 Ga0207654_10178341 Ga0207654_101783413 159
228 3300025912 Ga0207707_10209919 Ga0207707_102099192 159
229 3300025912 Ga0207707_10416634 Ga0207707_104166341 159
230 3300025913 Ga0207695_10028365 Ga0207695_100283655 159
231 3300025913 Ga0207695_10284099 Ga0207695_102840991 159
232 3300025913 Ga0207695_10310250 Ga0207695_103102502 159
233 3300025913 Ga0207695_10474862 Ga0207695_104748622 159
234 3300025913 Ga0207695_10522711 Ga0207695_105227112 159
235 3300025914 Ga0207671_10006474 Ga0207671_100064743 159
236 3300025914 Ga0207671_10277082 Ga0207671_102770822 159
237 3300025915 Ga0207693_10000488 Ga0207693_100004889 159
238 3300025916 Ga0207663_10007822 Ga0207663_100078223 159
239 3300025917 Ga0207660_10101363 Ga0207660_101013632 159
240 3300025919 Ga0207657_10217465 Ga0207657_102174652 159
241 3300025920 Ga0207649_10151325 Ga0207649_101513252 159
242 3300025920 Ga0207649_11546485 Ga0207649_115464851 159
243 3300025921 Ga0207652_10052661 Ga0207652_100526612 159
244 3300025923 Ga0207681_10009037 Ga0207681_100090372 159
245 3300025924 Ga0207694_10018598 Ga0207694_100185985 159
246 3300025924 Ga0207694_10251887 Ga0207694_102518872 159
247 3300025925 Ga0207650_10043414 Ga0207650_100434143 159
248 3300025927 Ga0207687_10830039 Ga0207687_108300392 159
249 3300025928 Ga0207700_11019596 Ga0207700_110195961 159
250 3300025929 Ga0207664_10250170 Ga0207664_102501702 159
251 3300025931 Ga0207644_10000370 Ga0207644_1000037031 159
252 3300025939 Ga0207665_10138925 Ga0207665_101389252 159
253 3300025941 Ga0207711_10000002 Ga0207711_10000002585 159
254 3300025941 Ga0207711_10081394 Ga0207711_100813943 159
255 3300025942 Ga0207689_10534814 Ga0207689_105348142 159
256 3300025945 Ga0207679_10068284 Ga0207679_100682843 159
257 3300025949 Ga0207667_10008750 Ga0207667_100087505 159
258 3300025949 Ga0207667_10424553 Ga0207667_104245532 159
259 3300025949 Ga0207667_10560967 Ga0207667_105609672 159
260 3300025949 Ga0207667_11346983 Ga0207667_113469831 159
261 3300025961 Ga0207712_10930231 Ga0207712_109302311 159
262 3300025972 Ga0207668_10000629 Ga0207668_100006298 159
263 3300025972 Ga0207668_10001707 Ga0207668_100017074 159
264 3300025981 Ga0207640_10237386 Ga0207640_102373863 159
265 3300025986 Ga0207658_10000089 Ga0207658_1000008958 159
266 3300025986 Ga0207658_10006836 Ga0207658_100068362 159
267 3300025986 Ga0207658_10007746 Ga0207658_100077467 159
268 3300026023 Ga0207677_10875223 Ga0207677_108752231 159
269 3300026035 Ga0207703_10006047 Ga0207703_100060473 159
270 3300026035 Ga0207703_10041321 Ga0207703_100413212 159
271 3300026035 Ga0207703_10043135 Ga0207703_100431354 159
272 3300026041 Ga0207639_10010833 Ga0207639_100108335 159
273 3300026041 Ga0207639_10073939 Ga0207639_100739392 159
274 3300026041 Ga0207639_10240310 Ga0207639_102403102 159
275 3300026078 Ga0207702_10005060 Ga0207702_1000506011 159
276 3300026078 Ga0207702_10116163 Ga0207702_101161633 159
277 3300026078 Ga0207702_10538844 Ga0207702_105388442 159
278 3300026088 Ga0207641_10000060 Ga0207641_1000006088 159
279 3300026088 Ga0207641_10010427 Ga0207641_100104275 159
280 3300026088 Ga0207641_10146807 Ga0207641_101468073 159
281 3300026095 Ga0207676_10152784 Ga0207676_101527842 159
282 3300026116 Ga0207674_10000261 Ga0207674_100002615 159
283 3300026116 Ga0207674_10011586 Ga0207674_100115864 159
284 3300026116 Ga0207674_10093073 Ga0207674_100930732 159
285 3300026116 Ga0207674_11107586 Ga0207674_111075862 159
286 3300026118 Ga0207675_100274698 Ga0207675_1002746982 159
287 3300026142 Ga0207698_10148203 Ga0207698_101482033 159
288 3300026142 Ga0207698_11341091 Ga0207698_113410911 159
289 3300028379 Ga0268266_10000134 Ga0268266_100001349 159
290 3300028379 Ga0268266_10000900 Ga0268266_1000090022 159
291 3300028379 Ga0268266_10068046 Ga0268266_100680463 159
292 3300028380 Ga0268265_11139781 Ga0268265_111397812 159
293 3300028381 Ga0268264_10018140 Ga0268264_100181404 159
294 3300028381 Ga0268264_10919491 Ga0268264_109194912 159
295 3300028573 Ga0265334_10012178 Ga0265334_100121783 159
296 3300028577 Ga0265318_10000153 Ga0265318_1000015364 159
297 3300028800 Ga0265338_10000005 Ga0265338_10000005316 159
298 3300028800 Ga0265338_10039930 Ga0265338_100399306 159
299 3300028800 Ga0265338_10080605 Ga0265338_100806053 159
300 3300031235 Ga0265330_10238357 Ga0265330_102383571 159
301 3300031238 Ga0265332_10018787 Ga0265332_100187873 159
302 3300031240 Ga0265320_10001113 Ga0265320_1000111311 159
303 3300031240 Ga0265320_10251965 Ga0265320_102519651 159
304 3300031241 Ga0265325_10000005 Ga0265325_10000005201 159
305 3300031241 Ga0265325_10000830 Ga0265325_1000083013 159
306 3300031241 Ga0265325_10011932 Ga0265325_100119321 159
307 3300031241 Ga0265325_10016545 Ga0265325_100165453 159
308 3300031241 Ga0265325_10228549 Ga0265325_102285491 159
309 3300031247 Ga0265340_10111090 Ga0265340_101110901 159
310 3300031247 Ga0265340_10312829 Ga0265340_103128291 159
311 3300031249 Ga0265339_10015788 Ga0265339_100157882 159
312 3300031249 Ga0265339_10024408 Ga0265339_100244085 159
313 3300031249 Ga0265339_10049381 Ga0265339_100493813 159
314 3300031249 Ga0265339_10347490 Ga0265339_103474901 159
315 3300031250 Ga0265331_10026019 Ga0265331_100260193 159
316 3300031344 Ga0265316_10215039 Ga0265316_102150392 159
317 3300031344 Ga0265316_10432863 Ga0265316_104328632 159
318 3300031548 Ga0307408_100263273 Ga0307408_1002632732 159
319 3300031595 Ga0265313_10013915 Ga0265313_100139156 159
320 3300031595 Ga0265313_10096542 Ga0265313_100965423 159
321 3300031595 Ga0265313_10119040 Ga0265313_101190402 159
322 3300031711 Ga0265314_10000125 Ga0265314_10000125106 159
323 3300031711 Ga0265314_10051436 Ga0265314_100514364 159
324 3300031712 Ga0265342_10001617 Ga0265342_100016176 159
325 3300031712 Ga0265342_10017030 Ga0265342_100170304 159
326 3300031824 Ga0307413_10102252 Ga0307413_101022522 159
327 3300031824 Ga0307413_10792731 Ga0307413_107927312 159
328 3300031901 Ga0307406_10353158 Ga0307406_103531581 159
329 3300032004 Ga0307414_10668725 Ga0307414_106687251 159
330 3300032004 Ga0307414_10790853 Ga0307414_107908531 159
331 3300035172 Ga0373955_0093218 Ga0373955_0093218_684_1166 159
332 3300035172 Ga0373955_0272764 Ga0373955_0272764_118_600 159
333 3300035410 Ga0373924_0248006 Ga0373924_0248006_13_495 159
334 3300035691 Ga0373931_0743201 Ga0373931_0743201_125_607 159
335 3300035724 Ga0373933_0002679 Ga0373933_0002679_6409_6891 159
336 3300035724 Ga0373933_0076418 Ga0373933_0076418_1265_1747 159
337 3300036401 Ga0373937_0004365 Ga0373937_0004365_10010_10492 159
338 3300036401 Ga0373937_0051438 Ga0373937_0051438_1244_1726 159
339 3300036401 Ga0373937_0074552 Ga0373937_0074552_1772_2254 159
340 3300036401 Ga0373937_0082163 Ga0373937_0082163_2280_2813 159
341 3300037418 Ga0395900_0114765 Ga0395900_0114765_2209_2688 159
342 3300037418 Ga0395900_0127246 Ga0395900_0127246_644_1123 159
343 3300037418 Ga0395900_1123143 Ga0395900_1123143_57_545 159
344 3300037466 Ga0395898_0038212 Ga0395898_0038212_496_996 159
345 3300037466 Ga0395898_0515177 Ga0395898_0515177_614_1093 159
346 3300037471 Ga0395905_0055927 Ga0395905_0055927_2383_2862 159
347 3300037471 Ga0395905_0227915 Ga0395905_0227915_460_942 159
348 3300037471 Ga0395905_0330316 Ga0395905_0330316_154_636 159
349 3300038443 Ga0395901_0071516 Ga0395901_0071516_2683_3183 159
350 3300038443 Ga0395901_0293760 Ga0395901_0293760_610_1089 159
351 3300038443 Ga0395901_0353954 Ga0395901_0353954_780_1262 159
352 3300038443 Ga0395901_0510728 Ga0395901_0510728_451_930 159
353 3300039437 Ga0436365_0687864 Ga0436365_0687864_1910_2392 159
354 3300039437 Ga0436365_0793637 Ga0436365_0793637_42955_43437 159
355 3300039437 Ga0436365_1183741 Ga0436365_1183741_7952_8434 159
356 3300039453 Ga0436362_1084872 Ga0436362_1084872_746_1228 159
357 3300041456 Ga0451795_0209803 Ga0451795_0209803_43_525 159
358 3300044673 Ga0453683_0912732 Ga0453683_0912732_17_499 159
359 3300044842 Ga0466957_0059968 Ga0466957_0059968_1396_1884 159
360 3300046459 Ga0495629_0083349 Ga0495629_0083349_1543_2031 159
361 3300046471 Ga0495650_0020299 Ga0495650_0020299_1638_2117 159
362 3300046472 Ga0495580_0011236 Ga0495580_0011236_4939_5427 159
363 3300046473 Ga0495582_0004184 Ga0495582_0004184_5577_6065 159
364 3300046675 Ga0495657_0183918 Ga0495657_0183918_695_1177 159
365 3300046679 Ga0495623_0166054 Ga0495623_0166054_709_1191 159
366 3300046683 Ga0495658_0000632 Ga0495658_0000632_12093_12581 159
367 3300047315 Ga0495581_0163435 Ga0495581_0163435_236_724 159
368 3300047315 Ga0495581_0456796 Ga0495581_0456796_66_599 159
369 3300047322 Ga0495680_0275584 Ga0495680_0275584_332_820 159
370 3300047471 Ga0495684_0052598 Ga0495684_0052598_892_1380 159
371 3300047471 Ga0495684_0361424 Ga0495684_0361424_505_987 159
372 3300048088 Ga0495602_0136706 Ga0495602_0136706_478_960 159
373 3300048904 Ga0496101_0257267 Ga0496101_0257267_77_703 159
374 3300048905 Ga0496102_0000120 Ga0496102_0000120_67761_68243 159
375 3300048906 Ga0496103_0000154 Ga0496103_0000154_10290_10772 159
376 3300048917 Ga0496114_0265854 Ga0496114_0265854_810_1292 159
377 3300048919 Ga0496116_0004809 Ga0496116_0004809_2569_3051 159
378 3300048920 Ga0496117_0000317 Ga0496117_0000317_16493_16975 159
379 3300048921 Ga0496118_0000303 Ga0496118_0000303_16497_16979 159
380 3300048922 Ga0496119_0047407 Ga0496119_0047407_2179_2661 159
381 3300048924 Ga0496121_0007648 Ga0496121_0007648_8732_9217 159
382 3300048924 Ga0496121_0045230 Ga0496121_0045230_3197_3700 159
383 3300048925 Ga0496122_0005688 Ga0496122_0005688_11363_11845 159
384 3300048926 Ga0496123_0000155 Ga0496123_0000155_2939_3421 159
385 3300048927 Ga0496124_0000214 Ga0496124_0000214_44190_44672 159
386 3300048928 Ga0496125_0025348 Ga0496125_0025348_2868_3350 159
387 3300048929 Ga0496126_0077994 Ga0496126_0077994_1012_1494 159
388 3300049568 Ga0501031_0024873 Ga0501031_0024873_743_1228 159
389 3300049568 Ga0501031_0286691 Ga0501031_0286691_404_889 159
390 3300049569 Ga0501032_0124929 Ga0501032_0124929_505_990 159
391 3300049569 Ga0501032_0199332 Ga0501032_0199332_28_510 159
392 3300049570 Ga0501033_0531553 Ga0501033_0531553_156_641 159
393 3300049571 Ga0501034_0376330 Ga0501034_0376330_190_675 159
394 3300049572 Ga0501036_0794637 Ga0501036_0794637_52_537 159
395 3300049573 Ga0501037_0118885 Ga0501037_0118885_724_1206 159
396 3300049574 Ga0501038_0006992 Ga0501038_0006992_3634_4116 159
397 3300049574 Ga0501038_0117159 Ga0501038_0117159_510_992 159
398 3300049574 Ga0501038_0133188 Ga0501038_0133188_1072_1557 159
399 3300049576 Ga0501040_0461042 Ga0501040_0461042_304_786 159
400 3300049576 Ga0501040_0735796 Ga0501040_0735796_23_577 159
401 3300049579 Ga0501043_0391966 Ga0501043_0391966_28_510 159
402 3300049579 Ga0501043_0645459 Ga0501043_0645459_106_588 159
403 3300049581 Ga0501047_0009953 Ga0501047_0009953_1834_2379 159
404 3300049581 Ga0501047_0069635 Ga0501047_0069635_1722_2204 159
405 3300049581 Ga0501047_0181547 Ga0501047_0181547_253_735 159
406 3300049581 Ga0501047_0569601 Ga0501047_0569601_387_869 159
407 3300049582 Ga0501048_0975266 Ga0501048_0975266_57_539 159
408 3300049583 Ga0501067_0049302 Ga0501067_0049302_1407_1952 159
409 3300049586 Ga0501070_0000002 Ga0501070_0000002_307230_307712 159
410 3300049586 Ga0501070_0040470 Ga0501070_0040470_1177_1659 159
411 3300049588 Ga0501072_0001937 Ga0501072_0001937_8638_9183 159
412 3300049589 Ga0501073_0027526 Ga0501073_0027526_2865_3410 159
413 3300049589 Ga0501073_0686601 Ga0501073_0686601_35_517 159
414 3300049590 Ga0501074_0353404 Ga0501074_0353404_426_971 159
415 3300049590 Ga0501074_0967029 Ga0501074_0967029_26_508 159
416 3300049591 Ga0501075_0393093 Ga0501075_0393093_403_957 159
417 3300049668 Ga0501233_001277 Ga0501233_001277_1508_1990 159
418 3300049741 Ga0501079_0878652 Ga0501079_0878652_166_648 159
419 3300049742 Ga0501080_0017903 Ga0501080_0017903_964_1446 159
420 3300049743 Ga0501081_0235235 Ga0501081_0235235_22_504 159
421 3300049744 Ga0501083_0238233 Ga0501083_0238233_70_630 159
422 3300049822 Ga0501035_0017186 Ga0501035_0017186_4431_4913 159
423 3300049822 Ga0501035_0086374 Ga0501035_0086374_57_542 159
424 3300049822 Ga0501035_0305338 Ga0501035_0305338_802_1287 159
425 3300049823 Ga0501044_0010785 Ga0501044_0010785_371_853 159
426 3300049823 Ga0501044_0049319 Ga0501044_0049319_3494_3976 159
427 3300049823 Ga0501044_0146524 Ga0501044_0146524_269_751 159
428 3300049823 Ga0501044_1495748 Ga0501044_1495748_46_525 159
429 3300050507 nmdc:mga05p37_15849_c1 nmdc:mga05p37_15849_c1_2225_2713 159
430 3300050508 nmdc:mga09592_419927_c1 nmdc:mga09592_419927_c1_157_645 159
431 3300050509 nmdc:mga0qj67_36653_c1 nmdc:mga0qj67_36653_c1_551_1033 159
432 3300050510 nmdc:mga06r32_1276229_c1 nmdc:mga06r32_1276229_c1_133_621 159
433 3300050511 nmdc:mga08y16_33561_c1 nmdc:mga08y16_33561_c1_2254_2742 159
434 3300050512 nmdc:mga0n895_178635_c1 nmdc:mga0n895_178635_c1_1476_1958 159
435 3300050513 nmdc:mga0rr50_72149_c1 nmdc:mga0rr50_72149_c1_1309_1791 159
436 3300050514 nmdc:mga08x19_11131_c1 nmdc:mga08x19_11131_c1_4600_5082 159
437 3300050514 nmdc:mga08x19_95181_c1 nmdc:mga08x19_95181_c1_832_1314 159
438 3300053085 Ga0495619_0536545 Ga0495619_0536545_157_639 159
439 3300053087 Ga0500643_003843 Ga0500643_003843_2894_3376 159
440 3300053087 Ga0500643_006651 Ga0500643_006651_2897_3379 159
441 3300053091 Ga0500647_0003634 Ga0500647_0003634_985_1467 159
442 3300053096 Ga0500641_0217153 Ga0500641_0217153_42_530 159
443 3300053108 Ga0500562_001061 Ga0500562_001061_128_610 159
444 3300053119 Ga0500595_084723 Ga0500595_084723_312_794 159
445 3300053136 Ga0500559_0020879 Ga0500559_0020879_807_1289 159
446 3300053140 Ga0500573_0000034 Ga0500573_0000034_12936_13415 159
447 3300053154 Ga0500619_018685 Ga0500619_018685_1086_1568 159
448 3300053730 Ga0500645_052097 Ga0500645_052097_661_1143 159
449 3300054114 Ga0501084_0336011 Ga0501084_0336011_741_1223 159
450 3300054114 Ga0501084_0441751 Ga0501084_0441751_258_740 159
451 3300003215 JGI25153J46596_10000638 JGI25153J46596_1000063814 160
452 3300005329 Ga0070683_100095395 Ga0070683_1000953954 160
453 3300005329 Ga0070683_100319963 Ga0070683_1003199632 160
454 3300005334 Ga0068869_100004900 Ga0068869_1000049005 160
455 3300005335 Ga0070666_10042849 Ga0070666_100428494 160
456 3300005337 Ga0070682_101245514 Ga0070682_1012455141 160
457 3300005338 Ga0068868_100283240 Ga0068868_1002832402 160
458 3300005338 Ga0068868_100421367 Ga0068868_1004213672 160
459 3300005339 Ga0070660_100006467 Ga0070660_1000064674 160
460 3300005344 Ga0070661_100434221 Ga0070661_1004342211 160
461 3300005364 Ga0070673_100015368 Ga0070673_1000153682 160
462 3300005455 Ga0070663_101507080 Ga0070663_1015070801 160
463 3300005456 Ga0070678_100036663 Ga0070678_1000366632 160
464 3300005456 Ga0070678_100139137 Ga0070678_1001391372 160
465 3300005456 Ga0070678_100724715 Ga0070678_1007247151 160
466 3300005459 Ga0068867_100001185 Ga0068867_1000011858 160
467 3300005530 Ga0070679_100285106 Ga0070679_1002851062 160
468 3300005535 Ga0070684_100125515 Ga0070684_1001255152 160
469 3300005539 Ga0068853_100686852 Ga0068853_1006868521 160
470 3300005543 Ga0070672_100520815 Ga0070672_1005208152 160
471 3300005544 Ga0070686_100313039 Ga0070686_1003130392 160
472 3300005548 Ga0070665_100073535 Ga0070665_1000735353 160
473 3300005548 Ga0070665_100303207 Ga0070665_1003032073 160
474 3300005548 Ga0070665_100510600 Ga0070665_1005106002 160
475 3300005564 Ga0070664_100706132 Ga0070664_1007061321 160
476 3300005564 Ga0070664_101081989 Ga0070664_1010819891 160
477 3300005614 Ga0068856_100049908 Ga0068856_1000499085 160
478 3300005614 Ga0068856_100183712 Ga0068856_1001837122 160
479 3300005615 Ga0070702_100600551 Ga0070702_1006005512 160
480 3300005618 Ga0068864_100309543 Ga0068864_1003095431 160
481 3300005718 Ga0068866_10021161 Ga0068866_100211612 160
482 3300005834 Ga0068851_10078834 Ga0068851_100788342 160
483 3300005840 Ga0068870_10229807 Ga0068870_102298072 160
484 3300005840 Ga0068870_10234827 Ga0068870_102348272 160
485 3300005841 Ga0068863_100028623 Ga0068863_1000286232 160
486 3300005842 Ga0068858_100084085 Ga0068858_1000840852 160
487 3300005842 Ga0068858_100201926 Ga0068858_1002019262 160
488 3300005844 Ga0068862_100401047 Ga0068862_1004010472 160
489 3300005844 Ga0068862_100415732 Ga0068862_1004157322 160
490 3300006237 Ga0097621_100000201 Ga0097621_10000020130 160
491 3300006237 Ga0097621_100242673 Ga0097621_1002426732 160
492 3300006358 Ga0068871_100000805 Ga0068871_1000008052 160
493 3300006358 Ga0068871_100105402 Ga0068871_1001054022 160
494 3300006358 Ga0068871_100355575 Ga0068871_1003555752 160
495 3300006358 Ga0068871_101253175 Ga0068871_1012531751 160
496 3300006881 Ga0068865_100004736 Ga0068865_1000047362 160
497 3300009093 Ga0105240_10070676 Ga0105240_100706765 160
498 3300009093 Ga0105240_10252235 Ga0105240_102522353 160
499 3300009093 Ga0105240_10878369 Ga0105240_108783691 160
500 3300009093 Ga0105240_11053545 Ga0105240_110535452 160
501 3300009098 Ga0105245_10054560 Ga0105245_100545601 160
502 3300009098 Ga0105245_10109746 Ga0105245_101097463 160
503 3300009101 Ga0105247_10111633 Ga0105247_101116333 160
504 3300009148 Ga0105243_10020123 Ga0105243_100201235 160
505 3300009148 Ga0105243_10101455 Ga0105243_101014553 160
506 3300009174 Ga0105241_10113267 Ga0105241_101132672 160
507 3300009174 Ga0105241_10121871 Ga0105241_101218712 160
508 3300009177 Ga0105248_10033294 Ga0105248_100332945 160
509 3300009177 Ga0105248_10323578 Ga0105248_103235782 160
510 3300009545 Ga0105237_10242234 Ga0105237_102422343 160
511 3300009551 Ga0105238_11377090 Ga0105238_113770902 160
512 3300009553 Ga0105249_10222999 Ga0105249_102229992 160
513 3300010375 Ga0105239_10063655 Ga0105239_100636552 160
514 3300010375 Ga0105239_10651718 Ga0105239_106517182 160
515 3300010375 Ga0105239_10664047 Ga0105239_106640472 160
516 3300011119 Ga0105246_10049099 Ga0105246_100490992 160
517 3300011119 Ga0105246_11085335 Ga0105246_110853351 160
518 3300011119 Ga0105246_11383577 Ga0105246_113835771 160
519 3300013104 Ga0157370_10201526 Ga0157370_102015263 160
520 3300013105 Ga0157369_10031240 Ga0157369_100312404 160
521 3300013296 Ga0157374_10607754 Ga0157374_106077541 160
522 3300013297 Ga0157378_11351682 Ga0157378_113516821 160
523 3300013306 Ga0163162_10067772 Ga0163162_100677723 160
524 3300013306 Ga0163162_10237609 Ga0163162_102376093 160
525 3300013308 Ga0157375_10082607 Ga0157375_100826074 160
526 3300013308 Ga0157375_11013685 Ga0157375_110136851 160
527 3300014325 Ga0163163_10465171 Ga0163163_104651712 160
528 3300014325 Ga0163163_11268864 Ga0163163_112688641 160
529 3300014326 Ga0157380_10546460 Ga0157380_105464602 160
530 3300014745 Ga0157377_10037725 Ga0157377_100377252 160
531 3300014745 Ga0157377_10259400 Ga0157377_102594002 160
532 3300014968 Ga0157379_10080886 Ga0157379_100808862 160
533 3300014969 Ga0157376_10092811 Ga0157376_100928113 160
534 3300017792 Ga0163161_10709942 Ga0163161_107099422 160
535 3300025261 Ga0209233_1000015 Ga0209233_1000015858 160
536 3300025261 Ga0209233_1021831 Ga0209233_10218312 160
537 3300025297 Ga0209758_1000013 Ga0209758_1000013265 160
538 3300025321 Ga0207656_10181223 Ga0207656_101812232 160
539 3300025900 Ga0207710_10107847 Ga0207710_101078471 160
540 3300025901 Ga0207688_10360023 Ga0207688_103600232 160
541 3300025903 Ga0207680_10208522 Ga0207680_102085222 160
542 3300025903 Ga0207680_10828810 Ga0207680_108288101 160
543 3300025907 Ga0207645_10026965 Ga0207645_100269653 160
544 3300025907 Ga0207645_10219597 Ga0207645_102195972 160
545 3300025908 Ga0207643_10201751 Ga0207643_102017512 160
546 3300025908 Ga0207643_10277955 Ga0207643_102779552 160
547 3300025911 Ga0207654_10199457 Ga0207654_101994572 160
548 3300025911 Ga0207654_10540629 Ga0207654_105406291 160
549 3300025913 Ga0207695_10049604 Ga0207695_100496042 160
550 3300025913 Ga0207695_10423964 Ga0207695_104239642 160
551 3300025913 Ga0207695_10636228 Ga0207695_106362281 160
552 3300025913 Ga0207695_10843572 Ga0207695_108435721 160
553 3300025914 Ga0207671_10163366 Ga0207671_101633662 160
554 3300025914 Ga0207671_10250687 Ga0207671_102506872 160
555 3300025919 Ga0207657_10037025 Ga0207657_100370252 160
556 3300025920 Ga0207649_10642910 Ga0207649_106429102 160
557 3300025921 Ga0207652_10298442 Ga0207652_102984423 160
558 3300025923 Ga0207681_10735055 Ga0207681_107350552 160
559 3300025924 Ga0207694_10408889 Ga0207694_104088892 160
560 3300025925 Ga0207650_10384239 Ga0207650_103842391 160
561 3300025926 Ga0207659_10011677 Ga0207659_100116775 160
562 3300025927 Ga0207687_10161133 Ga0207687_101611331 160
563 3300025927 Ga0207687_10269950 Ga0207687_102699502 160
564 3300025933 Ga0207706_10176101 Ga0207706_101761013 160
565 3300025934 Ga0207686_10015274 Ga0207686_100152742 160
566 3300025934 Ga0207686_10030132 Ga0207686_100301322 160
567 3300025934 Ga0207686_10082942 Ga0207686_100829422 160
568 3300025935 Ga0207709_10006920 Ga0207709_100069202 160
569 3300025935 Ga0207709_11302266 Ga0207709_113022661 160
570 3300025937 Ga0207669_10144714 Ga0207669_101447142 160
571 3300025938 Ga0207704_10129565 Ga0207704_101295653 160
572 3300025940 Ga0207691_11438753 Ga0207691_114387531 160
573 3300025941 Ga0207711_10237963 Ga0207711_102379632 160
574 3300025944 Ga0207661_10065598 Ga0207661_100655982 160
575 3300025949 Ga0207667_10107093 Ga0207667_101070934 160
576 3300025961 Ga0207712_10034106 Ga0207712_100341062 160
577 3300025961 Ga0207712_10061454 Ga0207712_100614542 160
578 3300026023 Ga0207677_10031216 Ga0207677_100312162 160
579 3300026023 Ga0207677_11371940 Ga0207677_113719401 160
580 3300026035 Ga0207703_10075896 Ga0207703_100758963 160
581 3300026035 Ga0207703_10960569 Ga0207703_109605692 160
582 3300026067 Ga0207678_10310111 Ga0207678_103101112 160
583 3300026078 Ga0207702_10119069 Ga0207702_101190691 160
584 3300026078 Ga0207702_10224640 Ga0207702_102246402 160
585 3300026088 Ga0207641_10015268 Ga0207641_100152681 160
586 3300026089 Ga0207648_10147353 Ga0207648_101473532 160
587 3300026089 Ga0207648_10658283 Ga0207648_106582832 160
588 3300026118 Ga0207675_100553816 Ga0207675_1005538162 160
589 3300026121 Ga0207683_10009569 Ga0207683_100095698 160
590 3300026121 Ga0207683_10053764 Ga0207683_100537645 160
591 3300026121 Ga0207683_10173954 Ga0207683_101739542 160
592 3300026142 Ga0207698_10766806 Ga0207698_107668062 160
593 3300028379 Ga0268266_10033242 Ga0268266_100332422 160
594 3300028379 Ga0268266_10060669 Ga0268266_100606692 160
595 3300028379 Ga0268266_10091907 Ga0268266_100919074 160
596 3300028379 Ga0268266_10254808 Ga0268266_102548082 160
597 3300028379 Ga0268266_10604439 Ga0268266_106044392 160
598 3300028380 Ga0268265_10393218 Ga0268265_103932182 160
599 3300028786 Ga0307517_10171693 Ga0307517_101716932 160
600 3300028800 Ga0265338_10032597 Ga0265338_100325972 160
601 3300031235 Ga0265330_10176508 Ga0265330_101765081 160
602 3300031239 Ga0265328_10068693 Ga0265328_100686932 160
603 3300031249 Ga0265339_10088546 Ga0265339_100885463 160
604 3300031250 Ga0265331_10036411 Ga0265331_100364112 160
605 3300031711 Ga0265314_10021623 Ga0265314_100216232 160
606 3300031730 Ga0307516_10024687 Ga0307516_100246872 160
607 3300031730 Ga0307516_10039905 Ga0307516_100399052 160
608 3300035171 Ga0373946_0038848 Ga0373946_0038848_1134_1640 160
609 3300037471 Ga0395905_1343235 Ga0395905_1343235_66_557 160
610 3300039437 Ga0436365_1009922 Ga0436365_1009922_431_922 160
611 3300039453 Ga0436362_0450835 Ga0436362_0450835_99_590 160
612 3300041460 Ga0451802_2092102 Ga0451802_2092102_44_535 160
613 3300041512 Ga0451853_1465112 Ga0451853_1465112_428_919 160
614 3300044536 Ga0466988_0069378 Ga0466988_0069378_588_1280 160
615 3300044649 Ga0466984_0007546 Ga0466984_0007546_5536_6228 160
616 3300044651 Ga0466985_0114239 Ga0466985_0114239_1114_1806 160
617 3300044656 Ga0466969_0222997 Ga0466969_0222997_147_839 160
618 3300044659 Ga0466973_0020269 Ga0466973_0020269_1153_1848 160
619 3300044660 Ga0466974_0037893 Ga0466974_0037893_594_1286 160
620 3300044661 Ga0466975_0066076 Ga0466975_0066076_402_1094 160
621 3300044662 Ga0466976_0151782 Ga0466976_0151782_308_1000 160
622 3300044663 Ga0466989_0015759 Ga0466989_0015759_2840_3532 160
623 3300044666 Ga0466977_0017853 Ga0466977_0017853_1291_1983 160
624 3300044668 Ga0466980_0078768 Ga0466980_0078768_679_1371 160
625 3300044669 Ga0466981_0071562 Ga0466981_0071562_291_983 160
626 3300044671 Ga0466978_0072563 Ga0466978_0072563_1088_1780 160
627 3300044672 Ga0466982_0070489 Ga0466982_0070489_565_1260 160
628 3300045051 Ga0451576_0019052 Ga0451576_0019052_888_1373 160
629 3300046452 Ga0495617_042718 Ga0495617_042718_338_829 160
630 3300046507 Ga0495606_0119410 Ga0495606_0119410_673_1164 160
631 3300046539 Ga0495621_0385877 Ga0495621_0385877_62_553 160
632 3300046557 Ga0495622_0010955 Ga0495622_0010955_2531_3022 160
633 3300046663 Ga0495635_0814671 Ga0495635_0814671_10_513 160
634 3300046683 Ga0495658_0365489 Ga0495658_0365489_325_828 160
635 3300046684 Ga0495669_0461817 Ga0495669_0461817_86_574 160
636 3300046694 Ga0495649_0034458 Ga0495649_0034458_48_539 160
637 3300047320 Ga0495672_0204681 Ga0495672_0204681_93_584 160
638 3300048088 Ga0495602_0767391 Ga0495602_0767391_28_519 160
639 3300048619 Ga0466979_0048386 Ga0466979_0048386_390_1085 160
640 3300048924 Ga0496121_0010270 Ga0496121_0010270_1737_2228 160
641 3300049571 Ga0501034_0067731 Ga0501034_0067731_662_1147 160
642 3300049580 Ga0501046_0224897 Ga0501046_0224897_867_1370 160
643 3300049581 Ga0501047_0563871 Ga0501047_0563871_437_940 160
644 3300049744 Ga0501083_0203977 Ga0501083_0203977_401_886 160
645 3300049822 Ga0501035_0064526 Ga0501035_0064526_2317_2820 160
646 3300053087 Ga0500643_000003 Ga0500643_000003_615522_616007 160
647 3300053118 Ga0500594_0064491 Ga0500594_0064491_371_856 160
648 3300053119 Ga0500595_028127 Ga0500595_028127_816_1307 160
649 3300053130 Ga0500642_0077198 Ga0500642_0077198_969_1460 160
650 3300053140 Ga0500573_0000068 Ga0500573_0000068_10488_10979 160
651 3300060353 Ga0501082_0020270 Ga0501082_0020270_5211_5696 160
652 3300001915 JGI24741J21665_1023279 JGI24741J21665_10232792 162
653 3300001979 JGI24740J21852_10050168 JGI24740J21852_100501682 162
654 3300002067 JGI24735J21928_10075824 JGI24735J21928_100758242 162
655 3300005327 Ga0070658_10020976 Ga0070658_100209763 162
656 3300005327 Ga0070658_10777845 Ga0070658_107778452 162
657 3300005336 Ga0070680_100001303 Ga0070680_10000130313 162
658 3300005339 Ga0070660_100001448 Ga0070660_1000014486 162
659 3300005344 Ga0070661_100147573 Ga0070661_1001475731 162
660 3300005345 Ga0070692_10050671 Ga0070692_100506713 162
661 3300005530 Ga0070679_100033836 Ga0070679_1000338365 162
662 3300005563 Ga0068855_100003927 Ga0068855_10000392713 162
663 3300005577 Ga0068857_100260184 Ga0068857_1002601842 162
664 3300005614 Ga0068856_100341055 Ga0068856_1003410553 162
665 3300013102 Ga0157371_10250584 Ga0157371_102505842 162
666 3300013104 Ga0157370_10006032 Ga0157370_100060325 162
667 3300013105 Ga0157369_10489259 Ga0157369_104892591 162
668 3300025909 Ga0207705_10000679 Ga0207705_100006797 162
669 3300025912 Ga0207707_10079785 Ga0207707_100797853 162
670 3300025917 Ga0207660_10000313 Ga0207660_1000031313 162
671 3300025919 Ga0207657_10004158 Ga0207657_1000415812 162
672 3300025920 Ga0207649_10246997 Ga0207649_102469971 162
673 3300025921 Ga0207652_10000662 Ga0207652_1000066218 162
674 3300025949 Ga0207667_10007290 Ga0207667_100072906 162
675 3300026067 Ga0207678_10003372 Ga0207678_1000337212 162
676 3300026116 Ga0207674_10059522 Ga0207674_100595224 162
677 3300026142 Ga0207698_10387555 Ga0207698_103875552 162
678 3300026142 Ga0207698_11247741 Ga0207698_112477412 162
679 3300031731 Ga0307405_10057716 Ga0307405_100577163 162
680 3300031824 Ga0307413_10027871 Ga0307413_100278713 162
681 3300031901 Ga0307406_10072962 Ga0307406_100729621 162
682 3300031903 Ga0307407_10517553 Ga0307407_105175532 162
683 3300031911 Ga0307412_11363634 Ga0307412_113636341 162
684 3300031995 Ga0307409_100075408 Ga0307409_1000754083 162
685 3300032004 Ga0307414_10061820 Ga0307414_100618202 162
686 3300032005 Ga0307411_10063962 Ga0307411_100639623 162
687 3300032126 Ga0307415_100113471 Ga0307415_1001134712 162
688 3300037312 Ga0395899_0074090 Ga0395899_0074090_1903_2391 162
689 3300037312 Ga0395899_0086188 Ga0395899_0086188_102_590 162
690 3300037312 Ga0395899_0233569 Ga0395899_0233569_63_551 162
691 3300037418 Ga0395900_0102843 Ga0395900_0102843_1898_2386 162
692 3300037418 Ga0395900_0549490 Ga0395900_0549490_549_1037 162
693 3300037418 Ga0395900_0595163 Ga0395900_0595163_89_577 162
694 3300037466 Ga0395898_0046410 Ga0395898_0046410_63_551 162
695 3300037466 Ga0395898_0542756 Ga0395898_0542756_554_1042 162
696 3300038443 Ga0395901_0051788 Ga0395901_0051788_63_551 162
697 3300038443 Ga0395901_0957278 Ga0395901_0957278_17_505 162
698 3300044694 Ga0466963_0168677 Ga0466963_0168677_763_1251 162
699 3300044706 Ga0466964_0479701 Ga0466964_0479701_135_623 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

30

183

0.91

PF00578

AhpC-TSA

AhpC/TSA family

31

166

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9744 1 158
4f82-assembly1.cif.gz_B x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia 0.9733 1 157
5k2j-assembly3.cif.gz_F crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9715 2 160
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9691 2 159
5k1g-assembly1.cif.gz_A-2 crystal structure of reduced prx3 from vibrio vulnificus 0.964 2 160
ID Description Score Start End Superfamily
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9733 1 157 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9718 1 158 3.40.30.10
3umaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.958 1 158 3.40.30.10
af_A0A0R4J5B9_27_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9432 1 158 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9424 1 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A411Z8W1-F1-model_v4 deleted 0.9862 37 158
AF-A0A0D8HLX4-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9855 1 158 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A520IFE1-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9855 50 158 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A529ZFL4-F1-model_v4 deleted 0.9852 30 158
AF-A0A0N0K1I8-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9839 2 158 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
95.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map