F476052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 367 | 623 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300046665|Ga0495661_0232153|Ga0495661_0232153_327_935 |
| Length | 202 |
| Sequence | MGNTCSGSCAIPASADRRAAAMQITPTALPDVLLIEPRVFGDDRGFFFESFNERAFDQAVGRQVRFVQDNHSRSSKNVLRGLHYQVEQAQGKLVRVVHGEVFDVAVDIRRSSPTFGQWVGEVLSAENKRQLWIPEGFAHGFVTLSDSAEFLYKTTDFWAPAFERCIRWDDSDLSIDWHLNGQPLVSAKDAVGLALRDAETFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 4 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 5 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 6 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 7 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 8 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 9 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 10 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 11 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 12 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 13 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 14 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 15 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 16 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 17 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 18 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 19 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 20 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 21 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 22 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 23 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 24 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 25 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 26 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 27 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 28 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 29 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 30 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 31 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 32 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 33 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 34 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 35 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 36 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 37 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 38 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 39 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 40 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 41 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 42 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 43 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 44 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 45 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 46 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 47 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 48 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 49 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 50 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 51 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 52 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 53 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 54 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 55 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 56 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 57 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 58 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 59 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 60 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 61 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 62 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 63 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 64 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 65 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 66 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 67 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 68 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 69 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 70 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 71 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 72 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 73 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 74 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 75 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 76 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 77 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 80 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 81 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 82 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 83 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 92 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 95 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 97 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 112 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 118 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 125 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 126 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 127 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 128 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 129 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 135 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 147 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 164 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 214 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 215 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 236 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 250 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 251 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 252 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 253 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 342 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 359 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 360 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 363 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 364 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 365 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 366 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 367 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.13 |
| Metatranscriptomes | 0 |
| Isolates | 10.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.14 |
| Endosphere | 22.6 |
| Nodule | 1.29 |
| Rhizoplane | 5.44 |
| Rhizosphere | 55.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C3528 | 2010549000 | Bacteria | 1213 |
| 2 | SwRhRL2b_contig_1879625 | 2162886007 | Bacteria | 3964 |
| 3 | SwRhRL2b_contig_2217296 | 2162886007 | Bacteria | 1137 |
| 4 | SwRhRL2b_contig_3824893 | 2162886007 | Bacteria | 1592 |
| 5 | JGI25162J39368_1000398 | 3300002737 | Bacteria | 36350 |
| 6 | JGI25152J39213_1000008 | 3300002773 | Bacteria | 154537 |
| 7 | JGI25150J39212_1000076 | 3300002774 | Bacteria | 59132 |
| 8 | JGI25150J39212_1000172 | 3300002774 | Bacteria | 36457 |
| 9 | JGI25150J39212_1000274 | 3300002774 | Bacteria | 27353 |
| 10 | JGI25150J39212_1005658 | 3300002774 | Bacteria | 2649 |
| 11 | JGI25159J45721_1000129 | 3300002987 | Bacteria | 36238 |
| 12 | JGI25159J45721_1000145 | 3300002987 | Bacteria | 32623 |
| 13 | JGI25159J45721_1002216 | 3300002987 | Bacteria | 7528 |
| 14 | JGI25151J46595_10000276 | 3300003187 | Bacteria | 59132 |
| 15 | JGI25151J46595_10000338 | 3300003187 | Bacteria | 50270 |
| 16 | JGI25153J46596_10003185 | 3300003215 | Bacteria | 9238 |
| 17 | JGI25153J46596_10011038 | 3300003215 | Bacteria | 4027 |
| 18 | JGI25153J46596_10014309 | 3300003215 | Bacteria | 3305 |
| 19 | JGI25153J46596_10049132 | 3300003215 | Bacteria | 1226 |
| 20 | rootH2_10028477 | 3300003320 | Bacteria | 18356 |
| 21 | rootL2_10060118 | 3300003322 | Bacteria | 2538 |
| 22 | JGI25160J50197_1000286 | 3300003354 | Bacteria | 36574 |
| 23 | JGI25160J50197_1000327 | 3300003354 | Bacteria | 32616 |
| 24 | JGI25161J50226_1000217 | 3300003374 | Bacteria | 36238 |
| 25 | JGI25161J50226_1000245 | 3300003374 | Bacteria | 32623 |
| 26 | JGI25161J50226_1010753 | 3300003374 | Bacteria | 1198 |
| 27 | Ga0055542_1000069 | 3300003762 | Bacteria | 148278 |
| 28 | Ga0055529_1000127 | 3300003763 | Bacteria | 109148 |
| 29 | Ga0055526_1000111 | 3300003771 | Bacteria | 71834 |
| 30 | Ga0055526_1000179 | 3300003771 | Bacteria | 56199 |
| 31 | Ga0055526_1000496 | 3300003771 | Bacteria | 31280 |
| 32 | Ga0055526_1001794 | 3300003771 | Bacteria | 14879 |
| 33 | Ga0055526_1002293 | 3300003771 | Bacteria | 13057 |
| 34 | Ga0055526_1012287 | 3300003771 | Bacteria | 3752 |
| 35 | Ga0055537_1000056 | 3300003773 | Bacteria | 81623 |
| 36 | Ga0055537_1000791 | 3300003773 | Bacteria | 15837 |
| 37 | Ga0055537_1003205 | 3300003773 | Bacteria | 5110 |
| 38 | Ga0055537_1003941 | 3300003773 | Bacteria | 4403 |
| 39 | Ga0055524_1000591 | 3300003775 | Bacteria | 26287 |
| 40 | Ga0055524_1000980 | 3300003775 | Bacteria | 17808 |
| 41 | Ga0055524_1001112 | 3300003775 | Bacteria | 16237 |
| 42 | Ga0055524_1001231 | 3300003775 | Bacteria | 15109 |
| 43 | Ga0055524_1002638 | 3300003775 | Bacteria | 9122 |
| 44 | Ga0055524_1026523 | 3300003775 | Bacteria | 1787 |
| 45 | Ga0055536_1000103 | 3300003781 | Bacteria | 73706 |
| 46 | Ga0055534_1000104 | 3300003784 | Bacteria | 64767 |
| 47 | Ga0055534_1000158 | 3300003784 | Bacteria | 50846 |
| 48 | Ga0055534_1000329 | 3300003784 | Bacteria | 31280 |
| 49 | Ga0055534_1000822 | 3300003784 | Bacteria | 14343 |
| 50 | Ga0055534_1000952 | 3300003784 | Bacteria | 12859 |
| 51 | Ga0055534_1021360 | 3300003784 | Bacteria | 1083 |
| 52 | Ga0055528_1000601 | 3300003790 | Bacteria | 27069 |
| 53 | Ga0055530_10000151 | 3300003791 | Bacteria | 62528 |
| 54 | Ga0055530_10000178 | 3300003791 | Bacteria | 58060 |
| 55 | Ga0055540_1000101 | 3300003792 | Bacteria | 96054 |
| 56 | Ga0055531_10000174 | 3300003794 | Bacteria | 72464 |
| 57 | Ga0055531_10013762 | 3300003794 | Bacteria | 3706 |
| 58 | Ga0058692_1000490 | 3300003856 | Bacteria | 17685 |
| 59 | Ga0058692_1001598 | 3300003856 | Bacteria | 8162 |
| 60 | Ga0055543_1000267 | 3300004625 | Bacteria | 38844 |
| 61 | Ga0055543_1000325 | 3300004625 | Bacteria | 32876 |
| 62 | Ga0055543_1008837 | 3300004625 | Bacteria | 2204 |
| 63 | Ga0065165_1000447 | 3300005262 | Bacteria | 64800 |
| 64 | Ga0065165_1000898 | 3300005262 | Bacteria | 38426 |
| 65 | Ga0065165_1001062 | 3300005262 | Bacteria | 32876 |
| 66 | Ga0065165_1016545 | 3300005262 | Bacteria | 2756 |
| 67 | Ga0065714_10002526 | 3300005288 | Bacteria | 26791 |
| 68 | Ga0065704_10001570 | 3300005289 | Bacteria | 10573 |
| 69 | Ga0065704_10070567 | 3300005289 | Bacteria | 20333 |
| 70 | Ga0070658_10422706 | 3300005327 | Bacteria | 1146 |
| 71 | Ga0070670_100032783 | 3300005331 | Bacteria | 4475 |
| 72 | Ga0070670_100576979 | 3300005331 | Bacteria | 1005 |
| 73 | Ga0070666_10004342 | 3300005335 | Bacteria | 8632 |
| 74 | Ga0070682_100000795 | 3300005337 | Bacteria | 18531 |
| 75 | Ga0068868_100215876 | 3300005338 | Bacteria | 1605 |
| 76 | Ga0070660_100222944 | 3300005339 | Bacteria | 1533 |
| 77 | Ga0070687_100009410 | 3300005343 | Bacteria | 4186 |
| 78 | Ga0070675_100278573 | 3300005354 | Bacteria | 1469 |
| 79 | Ga0070671_100000012 | 3300005355 | Bacteria | 196420 |
| 80 | Ga0070671_100948049 | 3300005355 | Bacteria | 753 |
| 81 | Ga0070701_10385638 | 3300005438 | Bacteria | 884 |
| 82 | Ga0068867_100269682 | 3300005459 | Bacteria | 1391 |
| 83 | Ga0070698_100263494 | 3300005471 | Bacteria | 1656 |
| 84 | Ga0068853_100142053 | 3300005539 | Bacteria | 2156 |
| 85 | Ga0070672_100538345 | 3300005543 | Bacteria | 1013 |
| 86 | Ga0070686_100049493 | 3300005544 | Bacteria | 2667 |
| 87 | Ga0070693_100001806 | 3300005547 | Bacteria | 9757 |
| 88 | Ga0070665_100005528 | 3300005548 | Bacteria | 12998 |
| 89 | Ga0070665_100323843 | 3300005548 | Bacteria | 1545 |
| 90 | Ga0070704_100248249 | 3300005549 | Bacteria | 1460 |
| 91 | Ga0068855_100000144 | 3300005563 | Bacteria | 91639 |
| 92 | Ga0068855_100035221 | 3300005563 | Bacteria | 5963 |
| 93 | Ga0068855_101338699 | 3300005563 | Bacteria | 740 |
| 94 | Ga0070664_100394565 | 3300005564 | Bacteria | 1265 |
| 95 | Ga0068854_100449288 | 3300005578 | Bacteria | 1076 |
| 96 | Ga0068852_100006976 | 3300005616 | Bacteria | 8219 |
| 97 | Ga0068859_100004124 | 3300005617 | Bacteria | 14825 |
| 98 | Ga0068864_100205820 | 3300005618 | Bacteria | 1810 |
| 99 | Ga0068862_100011562 | 3300005844 | Bacteria | 7282 |
| 100 | Ga0068862_100772574 | 3300005844 | Bacteria | 936 |
| 101 | Ga0075363_100264774 | 3300006048 | Bacteria | 992 |
| 102 | Ga0075364_10060956 | 3300006051 | Bacteria | 2474 |
| 103 | Ga0075364_10298526 | 3300006051 | Bacteria | 1096 |
| 104 | Ga0075364_10663066 | 3300006051 | Bacteria | 712 |
| 105 | Ga0075432_10092112 | 3300006058 | Bacteria | 1111 |
| 106 | Ga0075362_10158592 | 3300006177 | Bacteria | 1088 |
| 107 | Ga0075367_10526924 | 3300006178 | Bacteria | 750 |
| 108 | Ga0075369_10015675 | 3300006186 | Bacteria | 3046 |
| 109 | Ga0075369_10455122 | 3300006186 | Bacteria | 606 |
| 110 | Ga0075366_10018405 | 3300006195 | Bacteria | 4032 |
| 111 | Ga0075366_10066774 | 3300006195 | Bacteria | 2140 |
| 112 | Ga0075370_10040275 | 3300006353 | Bacteria | 2635 |
| 113 | Ga0075433_10266402 | 3300006852 | Bacteria | 1519 |
| 114 | Ga0097620_100004126 | 3300006931 | Bacteria | 14825 |
| 115 | Ga0099824_1026038 | 3300006942 | Bacteria | 3088 |
| 116 | Ga0099822_1046929 | 3300006943 | Bacteria | 1993 |
| 117 | Ga0079104_1000282 | 3300006946 | Bacteria | 65218 |
| 118 | Ga0079104_1037413 | 3300006946 | Bacteria | 1156 |
| 119 | Ga0075435_100017559 | 3300007076 | Bacteria | 5419 |
| 120 | Ga0075435_100305428 | 3300007076 | Bacteria | 1361 |
| 121 | Ga0105251_10042977 | 3300009011 | Bacteria | 2190 |
| 122 | Ga0105244_10000347 | 3300009036 | Bacteria | 43582 |
| 123 | Ga0105244_10006364 | 3300009036 | Bacteria | 7665 |
| 124 | Ga0105244_10010873 | 3300009036 | Bacteria | 5493 |
| 125 | Ga0105244_10287233 | 3300009036 | Bacteria | 763 |
| 126 | Ga0105244_10299592 | 3300009036 | Bacteria | 744 |
| 127 | Ga0105250_10001034 | 3300009092 | Bacteria | 15954 |
| 128 | Ga0105250_10002475 | 3300009092 | Bacteria | 9269 |
| 129 | Ga0105241_10002877 | 3300009174 | Bacteria | 12858 |
| 130 | Ga0105242_10774441 | 3300009176 | Bacteria | 947 |
| 131 | Ga0105248_10003226 | 3300009177 | Bacteria | 18084 |
| 132 | Ga0105248_10537975 | 3300009177 | Bacteria | 1318 |
| 133 | Ga0105248_10704064 | 3300009177 | Unclassified | 1140 |
| 134 | Ga0105237_10025046 | 3300009545 | Bacteria | 6103 |
| 135 | Ga0105238_10002448 | 3300009551 | Bacteria | 18618 |
| 136 | Ga0105238_10027216 | 3300009551 | Bacteria | 5826 |
| 137 | Ga0157339_1021528 | 3300012505 | Bacteria | 689 |
| 138 | Ga0157327_1028226 | 3300012512 | Bacteria | 683 |
| 139 | Ga0157373_10004231 | 3300013100 | Bacteria | 10835 |
| 140 | Ga0157373_10018184 | 3300013100 | Bacteria | 5119 |
| 141 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 142 | Ga0157370_10008528 | 3300013104 | Bacteria | 11047 |
| 143 | Ga0157370_10403969 | 3300013104 | Bacteria | 1257 |
| 144 | Ga0157369_10000100 | 3300013105 | Bacteria | 118782 |
| 145 | Ga0157369_10060128 | 3300013105 | Bacteria | 4098 |
| 146 | Ga0157378_10240880 | 3300013297 | Unclassified | 1728 |
| 147 | Ga0157378_10747615 | 3300013297 | Bacteria | 1000 |
| 148 | Ga0163162_10465200 | 3300013306 | Bacteria | 1396 |
| 149 | Ga0157372_10284242 | 3300013307 | Bacteria | 1924 |
| 150 | Ga0157375_10002678 | 3300013308 | Bacteria | 15429 |
| 151 | Ga0157380_10402195 | 3300014326 | Bacteria | 1300 |
| 152 | Ga0182008_10049743 | 3300014497 | Bacteria | 2080 |
| 153 | Ga0157376_10877342 | 3300014969 | Bacteria | 914 |
| 154 | Ga0182006_1024123 | 3300015261 | Bacteria | 2511 |
| 155 | Ga0182006_1059355 | 3300015261 | Bacteria | 1448 |
| 156 | Ga0182006_1158742 | 3300015261 | Bacteria | 763 |
| 157 | Ga0182007_10003645 | 3300015262 | Bacteria | 7217 |
| 158 | Ga0182005_1000490 | 3300015265 | Bacteria | 20417 |
| 159 | Ga0163161_10088440 | 3300017792 | Bacteria | 2290 |
| 160 | Ga0213872_10015084 | 3300021361 | Bacteria | 3595 |
| 161 | Ga0213872_10118779 | 3300021361 | Bacteria | 1170 |
| 162 | Ga0213872_10133125 | 3300021361 | Bacteria | 1094 |
| 163 | Ga0209436_100116 | 3300025208 | Bacteria | 39369 |
| 164 | Ga0209436_100135 | 3300025208 | Bacteria | 36415 |
| 165 | Ga0207427_100372 | 3300025231 | Bacteria | 27308 |
| 166 | Ga0209437_100113 | 3300025233 | Bacteria | 211240 |
| 167 | Ga0209437_102331 | 3300025233 | Bacteria | 3715 |
| 168 | Ga0209258_101792 | 3300025242 | Bacteria | 6574 |
| 169 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 170 | Ga0207425_1000050 | 3300025245 | Bacteria | 177008 |
| 171 | Ga0207425_1000063 | 3300025245 | Bacteria | 134014 |
| 172 | Ga0207425_1000150 | 3300025245 | Bacteria | 59533 |
| 173 | Ga0207425_1007633 | 3300025245 | Bacteria | 2834 |
| 174 | Ga0209646_1000047 | 3300025246 | Bacteria | 323416 |
| 175 | Ga0209026_1006080 | 3300025250 | Bacteria | 3061 |
| 176 | Ga0209026_1032525 | 3300025250 | Bacteria | 771 |
| 177 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 178 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 179 | Ga0209129_1000240 | 3300025258 | Bacteria | 59750 |
| 180 | Ga0209129_1000808 | 3300025258 | Bacteria | 19776 |
| 181 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 182 | Ga0209565_1000296 | 3300025263 | Bacteria | 47631 |
| 183 | Ga0209565_1000303 | 3300025263 | Bacteria | 46261 |
| 184 | Ga0209565_1000367 | 3300025263 | Bacteria | 38709 |
| 185 | Ga0209565_1000421 | 3300025263 | Bacteria | 34378 |
| 186 | Ga0209565_1000439 | 3300025263 | Bacteria | 33341 |
| 187 | Ga0209565_1007902 | 3300025263 | Bacteria | 2822 |
| 188 | Ga0209565_1009277 | 3300025263 | Bacteria | 2513 |
| 189 | Ga0209565_1012079 | 3300025263 | Bacteria | 2074 |
| 190 | Ga0209565_1014026 | 3300025263 | Bacteria | 1856 |
| 191 | Ga0209565_1022865 | 3300025263 | Bacteria | 1290 |
| 192 | Ga0209455_1000051 | 3300025272 | Bacteria | 369818 |
| 193 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 194 | Ga0209673_1001496 | 3300025273 | Bacteria | 21716 |
| 195 | Ga0209673_1001877 | 3300025273 | Bacteria | 16952 |
| 196 | Ga0209673_1004263 | 3300025273 | Bacteria | 7774 |
| 197 | Ga0209130_1000518 | 3300025284 | Bacteria | 38858 |
| 198 | Ga0209130_1000574 | 3300025284 | Bacteria | 35904 |
| 199 | Ga0209130_1000951 | 3300025284 | Bacteria | 22947 |
| 200 | Ga0209130_1004663 | 3300025284 | Bacteria | 5088 |
| 201 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 202 | Ga0209675_1000078 | 3300025291 | Bacteria | 156111 |
| 203 | Ga0209675_1000268 | 3300025291 | Bacteria | 49787 |
| 204 | Ga0209675_1000418 | 3300025291 | Bacteria | 34762 |
| 205 | Ga0209675_1006590 | 3300025291 | Bacteria | 4624 |
| 206 | Ga0209675_1063491 | 3300025291 | Bacteria | 723 |
| 207 | Ga0209676_1000121 | 3300025292 | Bacteria | 198920 |
| 208 | Ga0209676_1001995 | 3300025292 | Bacteria | 16152 |
| 209 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 210 | Ga0209025_1000660 | 3300025294 | Bacteria | 59750 |
| 211 | Ga0209025_1000978 | 3300025294 | Bacteria | 42664 |
| 212 | Ga0209025_1018169 | 3300025294 | Bacteria | 4010 |
| 213 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 214 | Ga0209564_1000064 | 3300025295 | Bacteria | 316431 |
| 215 | Ga0209564_1000133 | 3300025295 | Bacteria | 189140 |
| 216 | Ga0209564_1000595 | 3300025295 | Bacteria | 56670 |
| 217 | Ga0209564_1000908 | 3300025295 | Bacteria | 38758 |
| 218 | Ga0209564_1001027 | 3300025295 | Bacteria | 34378 |
| 219 | Ga0209564_1001062 | 3300025295 | Bacteria | 33341 |
| 220 | Ga0209564_1003283 | 3300025295 | Bacteria | 11274 |
| 221 | Ga0209758_1000288 | 3300025297 | Bacteria | 99096 |
| 222 | Ga0209758_1000550 | 3300025297 | Bacteria | 59495 |
| 223 | Ga0209758_1000596 | 3300025297 | Bacteria | 56305 |
| 224 | Ga0209758_1011529 | 3300025297 | Bacteria | 5102 |
| 225 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 226 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 227 | Ga0209050_1000261 | 3300025298 | Bacteria | 112823 |
| 228 | Ga0209050_1000341 | 3300025298 | Bacteria | 92696 |
| 229 | Ga0209256_1000013 | 3300025299 | Bacteria | 689442 |
| 230 | Ga0209256_1000079 | 3300025299 | Bacteria | 225382 |
| 231 | Ga0209256_1000179 | 3300025299 | Bacteria | 123865 |
| 232 | Ga0209256_1000638 | 3300025299 | Bacteria | 47804 |
| 233 | Ga0209256_1000757 | 3300025299 | Bacteria | 42054 |
| 234 | Ga0209256_1021080 | 3300025299 | Bacteria | 2014 |
| 235 | Ga0207426_1000506 | 3300025302 | Bacteria | 57538 |
| 236 | Ga0207426_1000657 | 3300025302 | Bacteria | 42328 |
| 237 | Ga0209051_1000087 | 3300025303 | Bacteria | 181248 |
| 238 | Ga0209051_1040326 | 3300025303 | Bacteria | 1675 |
| 239 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 240 | Ga0209257_1000622 | 3300025304 | Bacteria | 57122 |
| 241 | Ga0209257_1009247 | 3300025304 | Bacteria | 5335 |
| 242 | Ga0207696_1000622 | 3300025711 | Bacteria | 26024 |
| 243 | Ga0207696_1001317 | 3300025711 | Bacteria | 13720 |
| 244 | Ga0207696_1003531 | 3300025711 | Bacteria | 7069 |
| 245 | Ga0207655_1000447 | 3300025728 | Bacteria | 54492 |
| 246 | Ga0207655_1004471 | 3300025728 | Bacteria | 9905 |
| 247 | Ga0207655_1014426 | 3300025728 | Bacteria | 4465 |
| 248 | Ga0207713_1008284 | 3300025735 | Bacteria | 6008 |
| 249 | Ga0207680_10006161 | 3300025903 | Bacteria | 5786 |
| 250 | Ga0207705_10137204 | 3300025909 | Bacteria | 1824 |
| 251 | Ga0207705_10223464 | 3300025909 | Bacteria | 1431 |
| 252 | Ga0207654_10046515 | 3300025911 | Bacteria | 2475 |
| 253 | Ga0207695_10004200 | 3300025913 | Bacteria | 19788 |
| 254 | Ga0207671_10001118 | 3300025914 | Bacteria | 32324 |
| 255 | Ga0207662_10027622 | 3300025918 | Bacteria | 3276 |
| 256 | Ga0207657_10018187 | 3300025919 | Bacteria | 6723 |
| 257 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 258 | Ga0207694_10000707 | 3300025924 | Bacteria | 29983 |
| 259 | Ga0207650_10083927 | 3300025925 | Bacteria | 2420 |
| 260 | Ga0207644_10000036 | 3300025931 | Bacteria | 128383 |
| 261 | Ga0207709_10275550 | 3300025935 | Bacteria | 1240 |
| 262 | Ga0207711_10002081 | 3300025941 | Bacteria | 18081 |
| 263 | Ga0207711_11000920 | 3300025941 | Bacteria | 775 |
| 264 | Ga0207679_10412825 | 3300025945 | Bacteria | 1190 |
| 265 | Ga0207667_10001831 | 3300025949 | Bacteria | 26716 |
| 266 | Ga0207667_10027997 | 3300025949 | Bacteria | 6125 |
| 267 | Ga0207712_10318975 | 3300025961 | Bacteria | 1281 |
| 268 | Ga0207640_10398918 | 3300025981 | Bacteria | 1120 |
| 269 | Ga0207658_10104911 | 3300025986 | Bacteria | 2222 |
| 270 | Ga0207677_10192871 | 3300026023 | Bacteria | 1613 |
| 271 | Ga0207703_10990084 | 3300026035 | Bacteria | 806 |
| 272 | Ga0207708_11222837 | 3300026075 | Bacteria | 657 |
| 273 | Ga0207648_10171549 | 3300026089 | Bacteria | 1918 |
| 274 | Ga0207683_10102528 | 3300026121 | Bacteria | 2555 |
| 275 | Ga0207698_10004561 | 3300026142 | Bacteria | 8453 |
| 276 | Ga0209281_1000257 | 3300027111 | Bacteria | 103090 |
| 277 | Ga0209389_1000089 | 3300027296 | Bacteria | 83505 |
| 278 | Ga0209371_1000015 | 3300027312 | Bacteria | 659640 |
| 279 | Ga0209371_1000078 | 3300027312 | Bacteria | 190779 |
| 280 | Ga0209371_1000466 | 3300027312 | Bacteria | 39817 |
| 281 | Ga0209589_1000148 | 3300027357 | Bacteria | 77222 |
| 282 | Ga0209489_100512 | 3300027361 | Bacteria | 72878 |
| 283 | Ga0207428_10289982 | 3300027907 | Bacteria | 1213 |
| 284 | Ga0268266_10001076 | 3300028379 | Bacteria | 34200 |
| 285 | Ga0268265_10002115 | 3300028380 | Bacteria | 15403 |
| 286 | Ga0265334_10000027 | 3300028573 | Bacteria | 116133 |
| 287 | Ga0265323_10086967 | 3300028653 | Bacteria | 1049 |
| 288 | Ga0307515_10112647 | 3300028794 | Bacteria | 3163 |
| 289 | Ga0265324_10011133 | 3300029957 | Bacteria | 3439 |
| 290 | Ga0268256_1000018 | 3300030500 | Bacteria | 594572 |
| 291 | Ga0268256_1000298 | 3300030500 | Bacteria | 49771 |
| 292 | Ga0268256_1000423 | 3300030500 | Bacteria | 38191 |
| 293 | Ga0265328_10011567 | 3300031239 | Bacteria | 3521 |
| 294 | Ga0265328_10069420 | 3300031239 | Bacteria | 1295 |
| 295 | Ga0265340_10272824 | 3300031247 | Unclassified | 752 |
| 296 | Ga0265331_10000390 | 3300031250 | Bacteria | 45388 |
| 297 | Ga0265331_10028041 | 3300031250 | Bacteria | 2818 |
| 298 | Ga0265327_10000271 | 3300031251 | Bacteria | 102433 |
| 299 | Ga0265327_10000859 | 3300031251 | Bacteria | 45360 |
| 300 | Ga0265327_10001921 | 3300031251 | Bacteria | 23986 |
| 301 | Ga0265316_10017747 | 3300031344 | Bacteria | 6138 |
| 302 | Ga0307513_10155047 | 3300031456 | Bacteria | 2192 |
| 303 | Ga0307408_100000382 | 3300031548 | Bacteria | 40475 |
| 304 | Ga0307408_100001644 | 3300031548 | Bacteria | 16490 |
| 305 | Ga0307408_100012140 | 3300031548 | Bacteria | 5702 |
| 306 | Ga0307408_100102955 | 3300031548 | Bacteria | 2178 |
| 307 | Ga0265314_10011583 | 3300031711 | Bacteria | 7264 |
| 308 | Ga0265342_10011685 | 3300031712 | Bacteria | 5990 |
| 309 | Ga0316576_10000167 | 3300031727 | Bacteria | 26731 |
| 310 | Ga0316576_10059338 | 3300031727 | Bacteria | 2800 |
| 311 | Ga0316576_10108598 | 3300031727 | Bacteria | 2079 |
| 312 | Ga0316577_10061940 | 3300031733 | Unclassified | 2089 |
| 313 | Ga0316577_10261561 | 3300031733 | Bacteria | 979 |
| 314 | Ga0316577_10305616 | 3300031733 | Bacteria | 901 |
| 315 | Ga0307518_10017110 | 3300031838 | Bacteria | 5201 |
| 316 | Ga0307406_10288850 | 3300031901 | Bacteria | 1254 |
| 317 | Ga0307412_10007201 | 3300031911 | Bacteria | 6314 |
| 318 | Ga0307412_10023225 | 3300031911 | Bacteria | 3812 |
| 319 | Ga0307412_10673466 | 3300031911 | Bacteria | 885 |
| 320 | Ga0307416_100001464 | 3300032002 | Bacteria | 12860 |
| 321 | Ga0307414_10318310 | 3300032004 | Bacteria | 1323 |
| 322 | Ga0316574_0620269 | 3300035398 | Unclassified | 667 |
| 323 | Ga0373937_0036524 | 3300036401 | Bacteria | 4478 |
| 324 | Ga0316582_0067624 | 3300036647 | Bacteria | 2306 |
| 325 | Ga0316582_0133104 | 3300036647 | Bacteria | 1672 |
| 326 | Ga0316584_0047120 | 3300036712 | Bacteria | 3219 |
| 327 | Ga0316584_0253886 | 3300036712 | Bacteria | 1284 |
| 328 | Ga0316584_0598884 | 3300036712 | Bacteria | 765 |
| 329 | Ga0395905_0036982 | 3300037471 | Bacteria | 4586 |
| 330 | Ga0400483_101867 | 3300039062 | Bacteria | 1312 |
| 331 | Ga0400483_176576 | 3300039062 | Bacteria | 1232 |
| 332 | Ga0400483_284223 | 3300039062 | Bacteria | 1360 |
| 333 | Ga0436361_0116812 | 3300039447 | Bacteria | 2976 |
| 334 | Ga0436361_0131464 | 3300039447 | Bacteria | 793 |
| 335 | Ga0436361_0148311 | 3300039447 | Bacteria | 30874 |
| 336 | Ga0436361_0391517 | 3300039447 | Bacteria | 4189 |
| 337 | Ga0436361_0465833 | 3300039447 | Bacteria | 7683 |
| 338 | Ga0436361_0933837 | 3300039447 | Bacteria | 1779 |
| 339 | Ga0436361_1029999 | 3300039447 | Bacteria | 1178 |
| 340 | Ga0439438_000880 | 3300041405 | Bacteria | 13363 |
| 341 | Ga0439438_012055 | 3300041405 | Bacteria | 2665 |
| 342 | Ga0439432_000808 | 3300042006 | Bacteria | 11686 |
| 343 | Ga0439432_024351 | 3300042006 | Bacteria | 1990 |
| 344 | Ga0439452_000010 | 3300042010 | Bacteria | 459139 |
| 345 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 346 | Ga0439452_001209 | 3300042010 | Bacteria | 11045 |
| 347 | Ga0450904_000137 | 3300042139 | Bacteria | 16248 |
| 348 | Ga0450901_000885 | 3300042533 | Bacteria | 3506 |
| 349 | Ga0451577_0000298 | 3300042876 | Bacteria | 96541 |
| 350 | Ga0451577_0000767 | 3300042876 | Bacteria | 48562 |
| 351 | Ga0451577_0333427 | 3300042876 | Bacteria | 1376 |
| 352 | Ga0451577_0473622 | 3300042876 | Bacteria | 1137 |
| 353 | Ga0451577_0637905 | 3300042876 | Bacteria | 966 |
| 354 | Ga0466961_0008258 | 3300044693 | Bacteria | 6632 |
| 355 | Ga0453684_0000076 | 3300044712 | Bacteria | 437513 |
| 356 | Ga0453684_0000194 | 3300044712 | Bacteria | 265783 |
| 357 | Ga0453684_0000273 | 3300044712 | Bacteria | 222658 |
| 358 | Ga0453684_0086174 | 3300044712 | Unclassified | 3899 |
| 359 | Ga0453684_0099325 | 3300044712 | Bacteria | 3565 |
| 360 | Ga0453684_0130664 | 3300044712 | Bacteria | 3013 |
| 361 | Ga0453684_0426102 | 3300044712 | Bacteria | 1481 |
| 362 | Ga0466960_0003091 | 3300044901 | Bacteria | 6370 |
| 363 | Ga0451576_0037228 | 3300045051 | Bacteria | 5154 |
| 364 | Ga0451576_0996313 | 3300045051 | Bacteria | 878 |
| 365 | Ga0495617_017943 | 3300046452 | Bacteria | 2392 |
| 366 | Ga0495617_095509 | 3300046452 | Bacteria | 968 |
| 367 | Ga0495590_0011333 | 3300046457 | Bacteria | 3335 |
| 368 | Ga0495638_0000602 | 3300046460 | Bacteria | 40434 |
| 369 | Ga0495638_0110711 | 3300046460 | Bacteria | 1631 |
| 370 | Ga0495653_0000297 | 3300046463 | Bacteria | 40421 |
| 371 | Ga0495653_0001050 | 3300046463 | Bacteria | 21257 |
| 372 | Ga0495653_0006111 | 3300046463 | Bacteria | 9871 |
| 373 | Ga0495650_0000047 | 3300046471 | Bacteria | 335136 |
| 374 | Ga0495650_0000454 | 3300046471 | Bacteria | 64731 |
| 375 | Ga0495650_0001240 | 3300046471 | Bacteria | 26517 |
| 376 | Ga0495580_0477808 | 3300046472 | Bacteria | 834 |
| 377 | Ga0495605_0000015 | 3300046474 | Bacteria | 300227 |
| 378 | Ga0495605_0020206 | 3300046474 | Bacteria | 3542 |
| 379 | Ga0495605_0080460 | 3300046474 | Bacteria | 1525 |
| 380 | Ga0495584_0000106 | 3300046491 | Bacteria | 57044 |
| 381 | Ga0495584_0010772 | 3300046491 | Bacteria | 4694 |
| 382 | Ga0495584_0017917 | 3300046491 | Bacteria | 3602 |
| 383 | Ga0495584_0068312 | 3300046491 | Bacteria | 1785 |
| 384 | Ga0495585_0005034 | 3300046492 | Bacteria | 8428 |
| 385 | Ga0495585_0026369 | 3300046492 | Bacteria | 3318 |
| 386 | Ga0495585_0029149 | 3300046492 | Bacteria | 3143 |
| 387 | Ga0495585_0260209 | 3300046492 | Bacteria | 863 |
| 388 | Ga0495596_0000075 | 3300046500 | Bacteria | 69681 |
| 389 | Ga0495607_0001974 | 3300046501 | Bacteria | 17288 |
| 390 | Ga0495607_0019971 | 3300046501 | Bacteria | 4243 |
| 391 | Ga0495607_0027201 | 3300046501 | Bacteria | 3540 |
| 392 | Ga0495607_0260646 | 3300046501 | Bacteria | 830 |
| 393 | Ga0495583_0000727 | 3300046506 | Bacteria | 41970 |
| 394 | Ga0495606_0000133 | 3300046507 | Bacteria | 126345 |
| 395 | Ga0495606_0000690 | 3300046507 | Bacteria | 52411 |
| 396 | Ga0495606_0003233 | 3300046507 | Bacteria | 17517 |
| 397 | Ga0495606_0074951 | 3300046507 | Bacteria | 2118 |
| 398 | Ga0495606_0108121 | 3300046507 | Bacteria | 1681 |
| 399 | Ga0495610_0004101 | 3300046512 | Bacteria | 10907 |
| 400 | Ga0495610_0015140 | 3300046512 | Bacteria | 4496 |
| 401 | Ga0495610_0069200 | 3300046512 | Bacteria | 1652 |
| 402 | Ga0495616_0001327 | 3300046513 | Bacteria | 17284 |
| 403 | Ga0495616_0001422 | 3300046513 | Bacteria | 16666 |
| 404 | Ga0495616_0002054 | 3300046513 | Bacteria | 13532 |
| 405 | Ga0495616_0066472 | 3300046513 | Bacteria | 1754 |
| 406 | Ga0495620_0042498 | 3300046515 | Bacteria | 1985 |
| 407 | Ga0495630_0003242 | 3300046517 | Bacteria | 11337 |
| 408 | Ga0495631_0091706 | 3300046518 | Bacteria | 1308 |
| 409 | Ga0495632_0000110 | 3300046519 | Bacteria | 84473 |
| 410 | Ga0495632_0206447 | 3300046519 | Bacteria | 892 |
| 411 | Ga0495632_0245006 | 3300046519 | Bacteria | 805 |
| 412 | Ga0495637_0001219 | 3300046520 | Bacteria | 15608 |
| 413 | Ga0495637_0018102 | 3300046520 | Bacteria | 3271 |
| 414 | Ga0495637_0024441 | 3300046520 | Bacteria | 2734 |
| 415 | Ga0495643_0000224 | 3300046522 | Bacteria | 86728 |
| 416 | Ga0495643_0033850 | 3300046522 | Bacteria | 2822 |
| 417 | Ga0495643_0196343 | 3300046522 | Bacteria | 971 |
| 418 | Ga0495643_0221470 | 3300046522 | Bacteria | 897 |
| 419 | Ga0495644_0000644 | 3300046523 | Bacteria | 14598 |
| 420 | Ga0495644_0022013 | 3300046523 | Bacteria | 2430 |
| 421 | Ga0495648_0039789 | 3300046524 | Bacteria | 2987 |
| 422 | Ga0495648_0041962 | 3300046524 | Bacteria | 2883 |
| 423 | Ga0495648_0062976 | 3300046524 | Bacteria | 2193 |
| 424 | Ga0495648_0074348 | 3300046524 | Bacteria | 1958 |
| 425 | Ga0495642_0000867 | 3300046528 | Bacteria | 14308 |
| 426 | Ga0495642_0020231 | 3300046528 | Bacteria | 2613 |
| 427 | Ga0495654_0003263 | 3300046530 | Bacteria | 10009 |
| 428 | Ga0495654_0082561 | 3300046530 | Bacteria | 1503 |
| 429 | Ga0495654_0178286 | 3300046530 | Bacteria | 922 |
| 430 | Ga0495654_0217704 | 3300046530 | Bacteria | 809 |
| 431 | Ga0495665_0265412 | 3300046531 | Bacteria | 882 |
| 432 | Ga0495587_0000722 | 3300046536 | Bacteria | 22074 |
| 433 | Ga0495609_0000839 | 3300046538 | Bacteria | 22790 |
| 434 | Ga0495609_0015559 | 3300046538 | Bacteria | 3559 |
| 435 | Ga0495609_0188378 | 3300046538 | Bacteria | 866 |
| 436 | Ga0495597_0001012 | 3300046542 | Bacteria | 21546 |
| 437 | Ga0495597_0001132 | 3300046542 | Bacteria | 20140 |
| 438 | Ga0495597_0021121 | 3300046542 | Bacteria | 3027 |
| 439 | Ga0495633_0001115 | 3300046558 | Bacteria | 21587 |
| 440 | Ga0495633_0002441 | 3300046558 | Bacteria | 13143 |
| 441 | Ga0495633_0006317 | 3300046558 | Bacteria | 7056 |
| 442 | Ga0495633_0012440 | 3300046558 | Bacteria | 4527 |
| 443 | Ga0495656_0006569 | 3300046615 | Bacteria | 4086 |
| 444 | Ga0495668_0000049 | 3300046616 | Bacteria | 217657 |
| 445 | Ga0495668_0000195 | 3300046616 | Bacteria | 89153 |
| 446 | Ga0495668_0002168 | 3300046616 | Bacteria | 16840 |
| 447 | Ga0495668_0108303 | 3300046616 | Bacteria | 1520 |
| 448 | Ga0495634_0001237 | 3300046642 | Bacteria | 23496 |
| 449 | Ga0495611_0003498 | 3300046648 | Bacteria | 6913 |
| 450 | Ga0495625_0013500 | 3300046660 | Bacteria | 6561 |
| 451 | Ga0495625_0072900 | 3300046660 | Bacteria | 2408 |
| 452 | Ga0495625_0113205 | 3300046660 | Bacteria | 1853 |
| 453 | Ga0495625_0348631 | 3300046660 | Bacteria | 936 |
| 454 | Ga0495625_0539372 | 3300046660 | Bacteria | 708 |
| 455 | Ga0495635_0000601 | 3300046663 | Bacteria | 23181 |
| 456 | Ga0495661_0000247 | 3300046665 | Bacteria | 62371 |
| 457 | Ga0495661_0008159 | 3300046665 | Bacteria | 7261 |
| 458 | Ga0495661_0017506 | 3300046665 | Bacteria | 4731 |
| 459 | Ga0495661_0018648 | 3300046665 | Bacteria | 4557 |
| 460 | Ga0495661_0055762 | 3300046665 | Bacteria | 2367 |
| 461 | Ga0495661_0232153 | 3300046665 | Bacteria | 951 |
| 462 | Ga0495646_0000419 | 3300046680 | Bacteria | 22476 |
| 463 | Ga0495670_0000159 | 3300046691 | Bacteria | 29368 |
| 464 | Ga0495670_0001755 | 3300046691 | Bacteria | 10647 |
| 465 | Ga0495670_0010456 | 3300046691 | Bacteria | 4559 |
| 466 | Ga0495671_0000044 | 3300046692 | Bacteria | 160337 |
| 467 | Ga0495671_0031910 | 3300046692 | Bacteria | 2691 |
| 468 | Ga0495671_0184178 | 3300046692 | Bacteria | 1014 |
| 469 | Ga0495649_0000543 | 3300046694 | Bacteria | 31982 |
| 470 | Ga0495649_0001315 | 3300046694 | Bacteria | 18963 |
| 471 | Ga0495649_0092158 | 3300046694 | Bacteria | 1614 |
| 472 | Ga0495589_0011893 | 3300046794 | Bacteria | 4513 |
| 473 | Ga0495589_0044644 | 3300046794 | Bacteria | 2203 |
| 474 | Ga0495660_0000292 | 3300046810 | Bacteria | 46230 |
| 475 | Ga0495636_0341998 | 3300047318 | Bacteria | 705 |
| 476 | Ga0495674_0728656 | 3300047319 | Bacteria | 776 |
| 477 | Ga0495672_0007968 | 3300047320 | Bacteria | 7897 |
| 478 | Ga0495672_0011711 | 3300047320 | Bacteria | 6168 |
| 479 | Ga0495672_0012969 | 3300047320 | Bacteria | 5774 |
| 480 | Ga0495683_0059666 | 3300047323 | Bacteria | 1892 |
| 481 | Ga0495683_0147651 | 3300047323 | Bacteria | 1097 |
| 482 | Ga0495683_0213387 | 3300047323 | Bacteria | 864 |
| 483 | Ga0495677_0071044 | 3300047445 | Bacteria | 1297 |
| 484 | Ga0495677_0081401 | 3300047445 | Bacteria | 1214 |
| 485 | Ga0495679_057548 | 3300047446 | Bacteria | 1149 |
| 486 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 487 | Ga0495673_0000037 | 3300047469 | Bacteria | 307717 |
| 488 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 489 | Ga0495673_0064743 | 3300047469 | Bacteria | 1553 |
| 490 | Ga0495681_0002215 | 3300047470 | Bacteria | 13999 |
| 491 | Ga0495681_0029353 | 3300047470 | Bacteria | 2815 |
| 492 | Ga0495681_0161542 | 3300047470 | Bacteria | 932 |
| 493 | Ga0495593_0000538 | 3300047673 | Bacteria | 21496 |
| 494 | Ga0495602_0208813 | 3300048088 | Bacteria | 1484 |
| 495 | Ga0495626_0000219 | 3300048091 | Bacteria | 67675 |
| 496 | Ga0495626_0000323 | 3300048091 | Bacteria | 50382 |
| 497 | Ga0495626_0001681 | 3300048091 | Bacteria | 17049 |
| 498 | Ga0496100_0159668 | 3300048903 | Bacteria | 1615 |
| 499 | Ga0496100_0643504 | 3300048903 | Bacteria | 825 |
| 500 | Ga0496101_0021648 | 3300048904 | Bacteria | 4418 |
| 501 | Ga0496101_0245295 | 3300048904 | Bacteria | 1394 |
| 502 | Ga0496102_0000957 | 3300048905 | Bacteria | 27212 |
| 503 | Ga0496102_0923945 | 3300048905 | Bacteria | 794 |
| 504 | Ga0496103_0001518 | 3300048906 | Bacteria | 15506 |
| 505 | Ga0496107_0460361 | 3300048910 | Bacteria | 944 |
| 506 | Ga0496110_0913414 | 3300048913 | Bacteria | 784 |
| 507 | Ga0496111_0201599 | 3300048914 | Bacteria | 1479 |
| 508 | Ga0496115_0080054 | 3300048918 | Bacteria | 2660 |
| 509 | Ga0496116_0000140 | 3300048919 | Bacteria | 151165 |
| 510 | Ga0496116_0004269 | 3300048919 | Bacteria | 13703 |
| 511 | Ga0496116_0007765 | 3300048919 | Bacteria | 9432 |
| 512 | Ga0496116_0009769 | 3300048919 | Bacteria | 8139 |
| 513 | Ga0496116_0019322 | 3300048919 | Bacteria | 5219 |
| 514 | Ga0496116_0104302 | 3300048919 | Bacteria | 1685 |
| 515 | Ga0496116_0121166 | 3300048919 | Bacteria | 1513 |
| 516 | Ga0496117_0000380 | 3300048920 | Bacteria | 76671 |
| 517 | Ga0496117_0000835 | 3300048920 | Bacteria | 47629 |
| 518 | Ga0496117_0003351 | 3300048920 | Bacteria | 18701 |
| 519 | Ga0496117_0004348 | 3300048920 | Bacteria | 15721 |
| 520 | Ga0496117_0004433 | 3300048920 | Bacteria | 15490 |
| 521 | Ga0496117_0005867 | 3300048920 | Bacteria | 12696 |
| 522 | Ga0496117_0005935 | 3300048920 | Bacteria | 12596 |
| 523 | Ga0496117_0006377 | 3300048920 | Bacteria | 11984 |
| 524 | Ga0496117_0043933 | 3300048920 | Bacteria | 3241 |
| 525 | Ga0496118_0001914 | 3300048921 | Bacteria | 29615 |
| 526 | Ga0496118_0004249 | 3300048921 | Bacteria | 17156 |
| 527 | Ga0496118_0005490 | 3300048921 | Bacteria | 14390 |
| 528 | Ga0496118_0006703 | 3300048921 | Bacteria | 12547 |
| 529 | Ga0496118_0008693 | 3300048921 | Bacteria | 10438 |
| 530 | Ga0496118_0025440 | 3300048921 | Bacteria | 5076 |
| 531 | Ga0496118_0067890 | 3300048921 | Bacteria | 2592 |
| 532 | Ga0496119_0000049 | 3300048922 | Bacteria | 185482 |
| 533 | Ga0496119_0002907 | 3300048922 | Bacteria | 18273 |
| 534 | Ga0496119_0036248 | 3300048922 | Bacteria | 3222 |
| 535 | Ga0496119_0043332 | 3300048922 | Bacteria | 2844 |
| 536 | Ga0496120_0000048 | 3300048923 | Bacteria | 187988 |
| 537 | Ga0496120_0001489 | 3300048923 | Bacteria | 27770 |
| 538 | Ga0496120_0015723 | 3300048923 | Bacteria | 4976 |
| 539 | Ga0496121_0001226 | 3300048924 | Bacteria | 44634 |
| 540 | Ga0496121_0002208 | 3300048924 | Bacteria | 30406 |
| 541 | Ga0496121_0004821 | 3300048924 | Bacteria | 17759 |
| 542 | Ga0496121_0006644 | 3300048924 | Bacteria | 14238 |
| 543 | Ga0496121_0008356 | 3300048924 | Bacteria | 12216 |
| 544 | Ga0496121_0011405 | 3300048924 | Bacteria | 9874 |
| 545 | Ga0496121_0046061 | 3300048924 | Bacteria | 3737 |
| 546 | Ga0496121_0103724 | 3300048924 | Bacteria | 2187 |
| 547 | Ga0496121_0104952 | 3300048924 | Bacteria | 2169 |
| 548 | Ga0496121_0210246 | 3300048924 | Unclassified | 1379 |
| 549 | Ga0496121_0391699 | 3300048924 | Bacteria | 913 |
| 550 | Ga0496122_0000003 | 3300048925 | Bacteria | 645810 |
| 551 | Ga0496122_0000962 | 3300048925 | Bacteria | 51794 |
| 552 | Ga0496122_0003434 | 3300048925 | Bacteria | 20839 |
| 553 | Ga0496122_0004542 | 3300048925 | Bacteria | 17111 |
| 554 | Ga0496122_0005242 | 3300048925 | Bacteria | 15541 |
| 555 | Ga0496122_0025381 | 3300048925 | Bacteria | 5147 |
| 556 | Ga0496122_0076395 | 3300048925 | Bacteria | 2357 |
| 557 | Ga0496122_0091382 | 3300048925 | Bacteria | 2072 |
| 558 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 559 | Ga0496123_0000750 | 3300048926 | Bacteria | 52534 |
| 560 | Ga0496123_0004279 | 3300048926 | Bacteria | 15190 |
| 561 | Ga0496123_0005350 | 3300048926 | Bacteria | 12971 |
| 562 | Ga0496123_0032775 | 3300048926 | Bacteria | 3752 |
| 563 | Ga0496123_0082149 | 3300048926 | Bacteria | 1954 |
| 564 | Ga0496124_0000285 | 3300048927 | Bacteria | 95893 |
| 565 | Ga0496124_0001456 | 3300048927 | Bacteria | 34913 |
| 566 | Ga0496124_0003860 | 3300048927 | Bacteria | 17927 |
| 567 | Ga0496124_0008956 | 3300048927 | Bacteria | 10366 |
| 568 | Ga0496124_0017901 | 3300048927 | Bacteria | 6659 |
| 569 | Ga0496124_0134991 | 3300048927 | Bacteria | 1954 |
| 570 | Ga0496124_0136704 | 3300048927 | Bacteria | 1939 |
| 571 | Ga0496124_0176862 | 3300048927 | Bacteria | 1646 |
| 572 | Ga0496124_0451558 | 3300048927 | Bacteria | 876 |
| 573 | Ga0496125_0009915 | 3300048928 | Bacteria | 9686 |
| 574 | Ga0496125_0039443 | 3300048928 | Bacteria | 4066 |
| 575 | Ga0496125_0058546 | 3300048928 | Bacteria | 3112 |
| 576 | Ga0496126_0005419 | 3300048929 | Bacteria | 14555 |
| 577 | Ga0496126_0009234 | 3300048929 | Bacteria | 10513 |
| 578 | Ga0496126_0013264 | 3300048929 | Bacteria | 8397 |
| 579 | Ga0496126_0014419 | 3300048929 | Bacteria | 7990 |
| 580 | Ga0496126_0038851 | 3300048929 | Bacteria | 4424 |
| 581 | Ga0496126_0041628 | 3300048929 | Bacteria | 4249 |
| 582 | Ga0496126_0148827 | 3300048929 | Bacteria | 2008 |
| 583 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 584 | Ga0495678_006341 | 3300049459 | Bacteria | 6306 |
| 585 | Ga0495678_029233 | 3300049459 | Bacteria | 2316 |
| 586 | Ga0495678_065338 | 3300049459 | Bacteria | 1351 |
| 587 | Ga0495682_0000095 | 3300049460 | Bacteria | 77918 |
| 588 | Ga0495682_0000466 | 3300049460 | Bacteria | 27939 |
| 589 | Ga0495682_0040591 | 3300049460 | Bacteria | 1706 |
| 590 | Ga0501031_0054787 | 3300049568 | Bacteria | 2598 |
| 591 | Ga0501032_0034032 | 3300049569 | Bacteria | 3489 |
| 592 | Ga0501034_0007417 | 3300049571 | Bacteria | 11673 |
| 593 | Ga0501038_0110693 | 3300049574 | Bacteria | 2275 |
| 594 | Ga0501039_0008456 | 3300049575 | Bacteria | 7843 |
| 595 | Ga0501039_0193783 | 3300049575 | Bacteria | 1598 |
| 596 | Ga0501039_0345758 | 3300049575 | Bacteria | 1169 |
| 597 | Ga0501046_0515599 | 3300049580 | Bacteria | 855 |
| 598 | Ga0501072_0546629 | 3300049588 | Bacteria | 915 |
| 599 | Ga0501222_004695 | 3300049662 | Bacteria | 1857 |
| 600 | Ga0501227_003043 | 3300049665 | Bacteria | 3652 |
| 601 | Ga0501240_010647 | 3300049673 | Bacteria | 1225 |
| 602 | Ga0501269_002758 | 3300049766 | Bacteria | 2142 |
| 603 | Ga0501035_0022923 | 3300049822 | Bacteria | 5732 |
| 604 | Ga0501035_0088603 | 3300049822 | Bacteria | 2727 |
| 605 | Ga0501044_0017297 | 3300049823 | Bacteria | 7734 |
| 606 | Ga0501044_0979779 | 3300049823 | Bacteria | 718 |
| 607 | nmdc:mga03683_155124_c1 | 3300050489 | Bacteria | 1035 |
| 608 | nmdc:mga03n38_130203_c1 | 3300050490 | Bacteria | 1246 |
| 609 | nmdc:mga0k408_11886_c1 | 3300050493 | Bacteria | 4749 |
| 610 | nmdc:mga0k408_18577_c1 | 3300050493 | Bacteria | 3882 |
| 611 | nmdc:mga0k408_7548_c1 | 3300050493 | Bacteria | 5809 |
| 612 | nmdc:mga07m45_401221_c1 | 3300050496 | Bacteria | 796 |
| 613 | nmdc:mga09592_507121_c1 | 3300050508 | Bacteria | 1038 |
| 614 | nmdc:mga0rr50_13151_c1 | 3300050513 | Bacteria | 5377 |
| 615 | nmdc:mga0a205_13912_c1 | 3300050515 | Bacteria | 7502 |
| 616 | nmdc:mga0sz30_241236_c1 | 3300050516 | Bacteria | 804 |
| 617 | Ga0500618_000576 | 3300053125 | Bacteria | 22679 |
| 618 | Ga0500586_000070 | 3300053145 | Bacteria | 17457 |
| 619 | Ga0500622_0323627 | 3300053156 | Bacteria | 649 |
| 620 | Ga0500624_000361 | 3300053157 | Bacteria | 14695 |
| 621 | Ga0500625_058052 | 3300053729 | Bacteria | 1766 |
| 622 | Ga0590075_013549 | 3300059424 | Bacteria | 1990 |
| 623 | Ga0501082_0862584 | 3300060353 | Bacteria | 792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10465200 | Ga0163162_104652002 | 164 |
| 2 | 3300048919 | Ga0496116_0121166 | Ga0496116_0121166_1008_1502 | 164 |
| 3 | 3300048925 | Ga0496122_0004542 | Ga0496122_0004542_16360_16854 | 164 |
| 4 | 3300003320 | rootH2_10028477 | rootH2_100284778 | 169 |
| 5 | 3300036647 | Ga0316582_0067624 | Ga0316582_0067624_1780_2295 | 169 |
| 6 | 3300049588 | Ga0501072_0546629 | Ga0501072_0546629_230_769 | 170 |
| 7 | 3300060353 | Ga0501082_0862584 | Ga0501082_0862584_110_649 | 170 |
| 8 | 3300046538 | Ga0495609_0188378 | Ga0495609_0188378_11_529 | 171 |
| 9 | 3300013105 | Ga0157369_10060128 | Ga0157369_100601282 | 173 |
| 10 | 3300025919 | Ga0207657_10018187 | Ga0207657_100181876 | 173 |
| 11 | 3300031727 | Ga0316576_10059338 | Ga0316576_100593382 | 174 |
| 12 | iso_pu_bacteria | 2602042066 | 2603699165 | 174 |
| 13 | iso_pu_bacteria | 2765235842 | 2765589826 | 174 |
| 14 | iso_pu_bacteria | 2848297114 | 2848299294 | 174 |
| 15 | iso_pu_bacteria | 2908669403 | 2908672277 | 174 |
| 16 | iso_pu_bacteria | 2919497567 | 2919501242 | 174 |
| 17 | iso_pu_bacteria | 2935625433 | 2935625956 | 174 |
| 18 | iso_pu_bacteria | 8018221730 | 8018225279 | 174 |
| 19 | iso_pu_bacteria | 8018405270 | 8018409442 | 174 |
| 20 | 3300009036 | Ga0105244_10287233 | Ga0105244_102872331 | 176 |
| 21 | 3300048922 | Ga0496119_0002907 | Ga0496119_0002907_12541_13077 | 176 |
| 22 | 3300048923 | Ga0496120_0000048 | Ga0496120_0000048_67704_68240 | 176 |
| 23 | iso_pu_bacteria | 2842733646 | 2842737396 | 176 |
| 24 | 3300048924 | Ga0496121_0008356 | Ga0496121_0008356_11606_12142 | 177 |
| 25 | 3300048928 | Ga0496125_0058546 | Ga0496125_0058546_1570_2106 | 177 |
| 26 | iso_pu_bacteria | 2511231021 | 2511359388 | 177 |
| 27 | iso_pu_bacteria | 2511231156 | 2511822286 | 177 |
| 28 | iso_pu_bacteria | 2526164512 | 2526211329 | 177 |
| 29 | iso_pu_bacteria | 2582581304 | 2585255670 | 177 |
| 30 | iso_pu_bacteria | 2599185212 | 2599613127 | 177 |
| 31 | iso_pu_bacteria | 2599185248 | 2599769236 | 177 |
| 32 | iso_pu_bacteria | 2599185289 | 2599888480 | 177 |
| 33 | iso_pu_bacteria | 2599185291 | 2599900272 | 177 |
| 34 | iso_pu_bacteria | 2599185302 | 2599943783 | 177 |
| 35 | iso_pu_bacteria | 2599185304 | 2599956186 | 177 |
| 36 | iso_pu_bacteria | 2599185305 | 2599961714 | 177 |
| 37 | iso_pu_bacteria | 2599185306 | 2599965871 | 177 |
| 38 | iso_pu_bacteria | 2599185308 | 2599977511 | 177 |
| 39 | iso_pu_bacteria | 2599185309 | 2599984968 | 177 |
| 40 | iso_pu_bacteria | 2599185310 | 2599990968 | 177 |
| 41 | iso_pu_bacteria | 2599185311 | 2599996141 | 177 |
| 42 | iso_pu_bacteria | 2599185312 | 2600002106 | 177 |
| 43 | iso_pu_bacteria | 2599185313 | 2600004689 | 177 |
| 44 | iso_pu_bacteria | 2599185314 | 2600011636 | 177 |
| 45 | iso_pu_bacteria | 2599185315 | 2600018814 | 177 |
| 46 | iso_pu_bacteria | 2599185316 | 2600024552 | 177 |
| 47 | iso_pu_bacteria | 2599185318 | 2600034846 | 177 |
| 48 | iso_pu_bacteria | 2599185319 | 2600043075 | 177 |
| 49 | iso_pu_bacteria | 2599185320 | 2600047905 | 177 |
| 50 | iso_pu_bacteria | 2599185321 | 2600055692 | 177 |
| 51 | iso_pu_bacteria | 2599185322 | 2600060215 | 177 |
| 52 | iso_pu_bacteria | 2599185323 | 2600065874 | 177 |
| 53 | iso_pu_bacteria | 2599185325 | 2600079161 | 177 |
| 54 | iso_pu_bacteria | 2643221638 | 2644216670 | 177 |
| 55 | iso_pu_bacteria | 2643221650 | 2644282736 | 177 |
| 56 | iso_pu_bacteria | 2667528170 | 2671092606 | 177 |
| 57 | iso_pu_bacteria | 2675903515 | 2678260808 | 177 |
| 58 | iso_pu_bacteria | 2738541293 | 2738801580 | 177 |
| 59 | iso_pu_bacteria | 2739367655 | 2739611399 | 177 |
| 60 | iso_pu_bacteria | 2744054620 | 2745006124 | 177 |
| 61 | iso_pu_bacteria | 2808606361 | 2808857863 | 177 |
| 62 | iso_pu_bacteria | 2808606376 | 2808923848 | 177 |
| 63 | iso_pu_bacteria | 2808606378 | 2808938059 | 177 |
| 64 | iso_pu_bacteria | 2808606380 | 2808945767 | 177 |
| 65 | iso_pu_bacteria | 2808606383 | 2808966312 | 177 |
| 66 | iso_pu_bacteria | 2808606389 | 2809001239 | 177 |
| 67 | iso_pu_bacteria | 2821131069 | 2821134106 | 177 |
| 68 | iso_pu_bacteria | 2825651385 | 2825654434 | 177 |
| 69 | iso_pu_bacteria | 2842711865 | 2842711924 | 177 |
| 70 | iso_pu_bacteria | 2857553236 | 2857555735 | 177 |
| 71 | iso_pu_bacteria | 2857558681 | 2857561199 | 177 |
| 72 | iso_pu_bacteria | 2913036834 | 2913037120 | 177 |
| 73 | iso_pu_bacteria | 2919456309 | 2919461965 | 177 |
| 74 | iso_pu_bacteria | 2929144301 | 2929144635 | 177 |
| 75 | iso_pu_bacteria | 2931369376 | 2931372011 | 177 |
| 76 | iso_pu_bacteria | 2939607340 | 2939609592 | 177 |
| 77 | iso_pu_bacteria | 2945945610 | 2945949938 | 177 |
| 78 | iso_pu_bacteria | 2974310843 | 2974311298 | 177 |
| 79 | iso_pu_bacteria | 2988728565 | 2988732046 | 177 |
| 80 | iso_pu_bacteria | 2990710928 | 2990714238 | 177 |
| 81 | iso_pu_bacteria | 3007866637 | 3007870755 | 177 |
| 82 | iso_pu_bacteria | 8011350971 | 8011351704 | 177 |
| 83 | 3300002737 | JGI25162J39368_1000398 | JGI25162J39368_10003988 | 178 |
| 84 | 3300003762 | Ga0055542_1000069 | Ga0055542_100006929 | 178 |
| 85 | 3300005331 | Ga0070670_100032783 | Ga0070670_1000327833 | 178 |
| 86 | 3300005337 | Ga0070682_100000795 | Ga0070682_1000007958 | 178 |
| 87 | 3300005338 | Ga0068868_100215876 | Ga0068868_1002158762 | 178 |
| 88 | 3300005339 | Ga0070660_100222944 | Ga0070660_1002229442 | 178 |
| 89 | 3300005355 | Ga0070671_100948049 | Ga0070671_1009480492 | 178 |
| 90 | 3300005459 | Ga0068867_100269682 | Ga0068867_1002696822 | 178 |
| 91 | 3300005539 | Ga0068853_100142053 | Ga0068853_1001420532 | 178 |
| 92 | 3300005563 | Ga0068855_101338699 | Ga0068855_1013386992 | 178 |
| 93 | 3300005564 | Ga0070664_100394565 | Ga0070664_1003945652 | 178 |
| 94 | 3300005578 | Ga0068854_100449288 | Ga0068854_1004492882 | 178 |
| 95 | 3300005618 | Ga0068864_100205820 | Ga0068864_1002058202 | 178 |
| 96 | 3300006051 | Ga0075364_10663066 | Ga0075364_106630662 | 178 |
| 97 | 3300009092 | Ga0105250_10002475 | Ga0105250_100024755 | 178 |
| 98 | 3300009174 | Ga0105241_10002877 | Ga0105241_100028775 | 178 |
| 99 | 3300009177 | Ga0105248_10537975 | Ga0105248_105379752 | 178 |
| 100 | 3300009545 | Ga0105237_10025046 | Ga0105237_100250463 | 178 |
| 101 | 3300009551 | Ga0105238_10027216 | Ga0105238_100272162 | 178 |
| 102 | 3300012512 | Ga0157327_1028226 | Ga0157327_10282262 | 178 |
| 103 | 3300013105 | Ga0157369_10000100 | Ga0157369_1000010083 | 178 |
| 104 | 3300013307 | Ga0157372_10284242 | Ga0157372_102842422 | 178 |
| 105 | 3300025231 | Ga0207427_100372 | Ga0207427_1003727 | 178 |
| 106 | 3300025233 | Ga0209437_100113 | Ga0209437_10011331 | 178 |
| 107 | 3300025242 | Ga0209258_101792 | Ga0209258_1017923 | 178 |
| 108 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051442 | 178 |
| 109 | 3300025711 | Ga0207696_1001317 | Ga0207696_10013179 | 178 |
| 110 | 3300025909 | Ga0207705_10137204 | Ga0207705_101372042 | 178 |
| 111 | 3300025909 | Ga0207705_10223464 | Ga0207705_102234642 | 178 |
| 112 | 3300025911 | Ga0207654_10046515 | Ga0207654_100465153 | 178 |
| 113 | 3300025913 | Ga0207695_10004200 | Ga0207695_100042005 | 178 |
| 114 | 3300025914 | Ga0207671_10001118 | Ga0207671_1000111820 | 178 |
| 115 | 3300025924 | Ga0207694_10000707 | Ga0207694_1000070723 | 178 |
| 116 | 3300025925 | Ga0207650_10083927 | Ga0207650_100839273 | 178 |
| 117 | 3300025941 | Ga0207711_11000920 | Ga0207711_110009202 | 178 |
| 118 | 3300025945 | Ga0207679_10412825 | Ga0207679_104128252 | 178 |
| 119 | 3300025961 | Ga0207712_10318975 | Ga0207712_103189752 | 178 |
| 120 | 3300025981 | Ga0207640_10398918 | Ga0207640_103989182 | 178 |
| 121 | 3300025986 | Ga0207658_10104911 | Ga0207658_101049113 | 178 |
| 122 | 3300026023 | Ga0207677_10192871 | Ga0207677_101928712 | 178 |
| 123 | 3300026089 | Ga0207648_10171549 | Ga0207648_101715492 | 178 |
| 124 | 3300026121 | Ga0207683_10102528 | Ga0207683_101025282 | 178 |
| 125 | 3300048920 | Ga0496117_0000380 | Ga0496117_0000380_56657_57193 | 178 |
| 126 | 3300048920 | Ga0496117_0000835 | Ga0496117_0000835_46767_47303 | 178 |
| 127 | 3300048921 | Ga0496118_0001914 | Ga0496118_0001914_10403_10939 | 178 |
| 128 | 3300048924 | Ga0496121_0002208 | Ga0496121_0002208_18054_18590 | 178 |
| 129 | 3300048924 | Ga0496121_0004821 | Ga0496121_0004821_3395_3931 | 178 |
| 130 | 3300048924 | Ga0496121_0011405 | Ga0496121_0011405_6609_7145 | 178 |
| 131 | 3300048929 | Ga0496126_0013264 | Ga0496126_0013264_6692_7228 | 178 |
| 132 | 3300048929 | Ga0496126_0014419 | Ga0496126_0014419_7012_7548 | 178 |
| 133 | 3300053157 | Ga0500624_000361 | Ga0500624_000361_9059_9625 | 178 |
| 134 | iso_pu_bacteria | 2602042046 | 2603637065 | 178 |
| 135 | iso_pu_bacteria | 2811995292 | 2813728075 | 178 |
| 136 | iso_pu_bacteria | 2814123068 | 2814695630 | 178 |
| 137 | iso_pu_bacteria | 2847085930 | 2847086776 | 178 |
| 138 | iso_pu_bacteria | 2857576091 | 2857577826 | 178 |
| 139 | iso_pu_bacteria | 2919155634 | 2919158984 | 178 |
| 140 | iso_pu_bacteria | 2939617950 | 2939618294 | 178 |
| 141 | iso_pu_bacteria | 8019504834 | 8019505369 | 178 |
| 142 | iso_pu_bacteria | 8055087960 | 8055091549 | 178 |
| 143 | iso_pu_bacteria | 8055092621 | 8055096326 | 178 |
| 144 | 3300003856 | Ga0058692_1001598 | Ga0058692_100159810 | 179 |
| 145 | 3300005331 | Ga0070670_100576979 | Ga0070670_1005769792 | 179 |
| 146 | 3300005543 | Ga0070672_100538345 | Ga0070672_1005383452 | 179 |
| 147 | 3300005547 | Ga0070693_100001806 | Ga0070693_1000018065 | 179 |
| 148 | 3300009092 | Ga0105250_10001034 | Ga0105250_100010345 | 179 |
| 149 | 3300013297 | Ga0157378_10240880 | Ga0157378_102408803 | 179 |
| 150 | 3300025711 | Ga0207696_1000622 | Ga0207696_10006227 | 179 |
| 151 | 3300027312 | Ga0209371_1000466 | Ga0209371_100046621 | 179 |
| 152 | 3300028653 | Ga0265323_10086967 | Ga0265323_100869672 | 179 |
| 153 | 3300030500 | Ga0268256_1000423 | Ga0268256_100042316 | 179 |
| 154 | 3300031247 | Ga0265340_10272824 | Ga0265340_102728242 | 179 |
| 155 | 3300031344 | Ga0265316_10017747 | Ga0265316_100177475 | 179 |
| 156 | 3300031712 | Ga0265342_10011685 | Ga0265342_100116853 | 179 |
| 157 | 3300031733 | Ga0316577_10061940 | Ga0316577_100619402 | 179 |
| 158 | 3300036647 | Ga0316582_0133104 | Ga0316582_0133104_616_1179 | 179 |
| 159 | 3300036712 | Ga0316584_0253886 | Ga0316584_0253886_414_977 | 179 |
| 160 | 3300042876 | Ga0451577_0000298 | Ga0451577_0000298_42626_43174 | 179 |
| 161 | 3300042876 | Ga0451577_0000767 | Ga0451577_0000767_8669_9217 | 179 |
| 162 | 3300044712 | Ga0453684_0000076 | Ga0453684_0000076_236440_236988 | 179 |
| 163 | 3300044712 | Ga0453684_0000194 | Ga0453684_0000194_17368_17916 | 179 |
| 164 | 3300044712 | Ga0453684_0086174 | Ga0453684_0086174_1850_2395 | 179 |
| 165 | 3300044712 | Ga0453684_0426102 | Ga0453684_0426102_64_636 | 179 |
| 166 | 3300047320 | Ga0495672_0011711 | Ga0495672_0011711_3577_4182 | 179 |
| 167 | 3300048924 | Ga0496121_0006644 | Ga0496121_0006644_7506_8048 | 179 |
| 168 | 3300048927 | Ga0496124_0008956 | Ga0496124_0008956_2332_2874 | 179 |
| 169 | 3300005343 | Ga0070687_100009410 | Ga0070687_1000094102 | 180 |
| 170 | 3300005354 | Ga0070675_100278573 | Ga0070675_1002785732 | 180 |
| 171 | 3300005438 | Ga0070701_10385638 | Ga0070701_103856381 | 180 |
| 172 | 3300005471 | Ga0070698_100263494 | Ga0070698_1002634941 | 180 |
| 173 | 3300005544 | Ga0070686_100049493 | Ga0070686_1000494933 | 180 |
| 174 | 3300005549 | Ga0070704_100248249 | Ga0070704_1002482492 | 180 |
| 175 | 3300005563 | Ga0068855_100000144 | Ga0068855_10000014488 | 180 |
| 176 | 3300005616 | Ga0068852_100006976 | Ga0068852_1000069767 | 180 |
| 177 | 3300005844 | Ga0068862_100772574 | Ga0068862_1007725742 | 180 |
| 178 | 3300006177 | Ga0075362_10158592 | Ga0075362_101585922 | 180 |
| 179 | 3300006195 | Ga0075366_10018405 | Ga0075366_100184053 | 180 |
| 180 | 3300006353 | Ga0075370_10040275 | Ga0075370_100402752 | 180 |
| 181 | 3300007076 | Ga0075435_100305428 | Ga0075435_1003054282 | 180 |
| 182 | 3300009036 | Ga0105244_10010873 | Ga0105244_100108736 | 180 |
| 183 | 3300009551 | Ga0105238_10002448 | Ga0105238_1000244810 | 180 |
| 184 | 3300013297 | Ga0157378_10747615 | Ga0157378_107476152 | 180 |
| 185 | 3300021361 | Ga0213872_10118779 | Ga0213872_101187792 | 180 |
| 186 | 3300025711 | Ga0207696_1003531 | Ga0207696_10035312 | 180 |
| 187 | 3300025728 | Ga0207655_1004471 | Ga0207655_100447110 | 180 |
| 188 | 3300025735 | Ga0207713_1008284 | Ga0207713_10082846 | 180 |
| 189 | 3300025918 | Ga0207662_10027622 | Ga0207662_100276222 | 180 |
| 190 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006644 | 180 |
| 191 | 3300025949 | Ga0207667_10001831 | Ga0207667_1000183115 | 180 |
| 192 | 3300026035 | Ga0207703_10990084 | Ga0207703_109900841 | 180 |
| 193 | 3300026075 | Ga0207708_11222837 | Ga0207708_112228371 | 180 |
| 194 | 3300026142 | Ga0207698_10004561 | Ga0207698_100045613 | 180 |
| 195 | 3300028573 | Ga0265334_10000027 | Ga0265334_1000002756 | 180 |
| 196 | 3300031456 | Ga0307513_10155047 | Ga0307513_101550473 | 180 |
| 197 | 3300031727 | Ga0316576_10000167 | Ga0316576_1000016710 | 180 |
| 198 | 3300031727 | Ga0316576_10108598 | Ga0316576_101085983 | 180 |
| 199 | 3300031733 | Ga0316577_10261561 | Ga0316577_102615612 | 180 |
| 200 | 3300031733 | Ga0316577_10305616 | Ga0316577_103056161 | 180 |
| 201 | 3300031911 | Ga0307412_10673466 | Ga0307412_106734662 | 180 |
| 202 | 3300035398 | Ga0316574_0620269 | Ga0316574_0620269_45_608 | 180 |
| 203 | 3300036401 | Ga0373937_0036524 | Ga0373937_0036524_745_1287 | 180 |
| 204 | 3300036712 | Ga0316584_0047120 | Ga0316584_0047120_2263_2811 | 180 |
| 205 | 3300036712 | Ga0316584_0598884 | Ga0316584_0598884_20_568 | 180 |
| 206 | 3300039447 | Ga0436361_0131464 | Ga0436361_0131464_220_771 | 180 |
| 207 | 3300039447 | Ga0436361_1029999 | Ga0436361_1029999_559_1107 | 180 |
| 208 | 3300042876 | Ga0451577_0333427 | Ga0451577_0333427_661_1209 | 180 |
| 209 | 3300042876 | Ga0451577_0473622 | Ga0451577_0473622_333_878 | 180 |
| 210 | 3300042876 | Ga0451577_0637905 | Ga0451577_0637905_203_778 | 180 |
| 211 | 3300044712 | Ga0453684_0130664 | Ga0453684_0130664_1818_2366 | 180 |
| 212 | 3300045051 | Ga0451576_0037228 | Ga0451576_0037228_4583_5125 | 180 |
| 213 | 3300045051 | Ga0451576_0996313 | Ga0451576_0996313_254_805 | 180 |
| 214 | 3300046472 | Ga0495580_0477808 | Ga0495580_0477808_216_758 | 180 |
| 215 | 3300046492 | Ga0495585_0029149 | Ga0495585_0029149_919_1467 | 180 |
| 216 | 3300046530 | Ga0495654_0178286 | Ga0495654_0178286_59_601 | 180 |
| 217 | 3300046531 | Ga0495665_0265412 | Ga0495665_0265412_84_626 | 180 |
| 218 | 3300046558 | Ga0495633_0006317 | Ga0495633_0006317_761_1309 | 180 |
| 219 | 3300046665 | Ga0495661_0055762 | Ga0495661_0055762_162_710 | 180 |
| 220 | 3300046691 | Ga0495670_0010456 | Ga0495670_0010456_888_1436 | 180 |
| 221 | 3300048918 | Ga0496115_0080054 | Ga0496115_0080054_1357_1908 | 180 |
| 222 | 3300048919 | Ga0496116_0000140 | Ga0496116_0000140_59414_59956 | 180 |
| 223 | 3300048920 | Ga0496117_0004433 | Ga0496117_0004433_8807_9352 | 180 |
| 224 | 3300048921 | Ga0496118_0006703 | Ga0496118_0006703_9368_9913 | 180 |
| 225 | 3300048925 | Ga0496122_0000003 | Ga0496122_0000003_278128_278673 | 180 |
| 226 | 3300048926 | Ga0496123_0000012 | Ga0496123_0000012_33311_33856 | 180 |
| 227 | 3300049823 | Ga0501044_0017297 | Ga0501044_0017297_2211_2756 | 180 |
| 228 | 3300050489 | nmdc:mga03683_155124_c1 | nmdc:mga03683_155124_c1_58_606 | 180 |
| 229 | 3300050493 | nmdc:mga0k408_18577_c1 | nmdc:mga0k408_18577_c1_1969_2517 | 180 |
| 230 | 3300050496 | nmdc:mga07m45_401221_c1 | nmdc:mga07m45_401221_c1_185_733 | 180 |
| 231 | 2162886007 | SwRhRL2b_contig_1879625 | SwRhRL2b_0536.00005270 | 181 |
| 232 | 3300002773 | JGI25152J39213_1000008 | JGI25152J39213_100000871 | 181 |
| 233 | 3300002774 | JGI25150J39212_1000076 | JGI25150J39212_100007618 | 181 |
| 234 | 3300002774 | JGI25150J39212_1000172 | JGI25150J39212_100017219 | 181 |
| 235 | 3300002774 | JGI25150J39212_1000274 | JGI25150J39212_10002744 | 181 |
| 236 | 3300002774 | JGI25150J39212_1005658 | JGI25150J39212_10056583 | 181 |
| 237 | 3300002987 | JGI25159J45721_1000129 | JGI25159J45721_100012927 | 181 |
| 238 | 3300002987 | JGI25159J45721_1000145 | JGI25159J45721_10001459 | 181 |
| 239 | 3300002987 | JGI25159J45721_1002216 | JGI25159J45721_10022167 | 181 |
| 240 | 3300003187 | JGI25151J46595_10000276 | JGI25151J46595_1000027633 | 181 |
| 241 | 3300003187 | JGI25151J46595_10000338 | JGI25151J46595_1000033853 | 181 |
| 242 | 3300003215 | JGI25153J46596_10003185 | JGI25153J46596_100031855 | 181 |
| 243 | 3300003215 | JGI25153J46596_10011038 | JGI25153J46596_100110385 | 181 |
| 244 | 3300003215 | JGI25153J46596_10014309 | JGI25153J46596_100143092 | 181 |
| 245 | 3300003215 | JGI25153J46596_10049132 | JGI25153J46596_100491322 | 181 |
| 246 | 3300003322 | rootL2_10060118 | rootL2_100601184 | 181 |
| 247 | 3300003354 | JGI25160J50197_1000286 | JGI25160J50197_100028627 | 181 |
| 248 | 3300003354 | JGI25160J50197_1000327 | JGI25160J50197_10003279 | 181 |
| 249 | 3300003374 | JGI25161J50226_1000217 | JGI25161J50226_100021727 | 181 |
| 250 | 3300003374 | JGI25161J50226_1000245 | JGI25161J50226_10002459 | 181 |
| 251 | 3300003374 | JGI25161J50226_1010753 | JGI25161J50226_10107531 | 181 |
| 252 | 3300003763 | Ga0055529_1000127 | Ga0055529_100012770 | 181 |
| 253 | 3300003771 | Ga0055526_1000111 | Ga0055526_100011153 | 181 |
| 254 | 3300003771 | Ga0055526_1000179 | Ga0055526_100017945 | 181 |
| 255 | 3300003771 | Ga0055526_1000496 | Ga0055526_100049624 | 181 |
| 256 | 3300003771 | Ga0055526_1001794 | Ga0055526_100179411 | 181 |
| 257 | 3300003771 | Ga0055526_1002293 | Ga0055526_10022939 | 181 |
| 258 | 3300003771 | Ga0055526_1012287 | Ga0055526_10122874 | 181 |
| 259 | 3300003773 | Ga0055537_1000056 | Ga0055537_100005634 | 181 |
| 260 | 3300003773 | Ga0055537_1000791 | Ga0055537_10007917 | 181 |
| 261 | 3300003773 | Ga0055537_1003205 | Ga0055537_10032054 | 181 |
| 262 | 3300003773 | Ga0055537_1003941 | Ga0055537_10039413 | 181 |
| 263 | 3300003775 | Ga0055524_1000591 | Ga0055524_10005919 | 181 |
| 264 | 3300003775 | Ga0055524_1000980 | Ga0055524_100098012 | 181 |
| 265 | 3300003775 | Ga0055524_1001112 | Ga0055524_10011129 | 181 |
| 266 | 3300003775 | Ga0055524_1001231 | Ga0055524_100123110 | 181 |
| 267 | 3300003775 | Ga0055524_1002638 | Ga0055524_10026384 | 181 |
| 268 | 3300003775 | Ga0055524_1026523 | Ga0055524_10265231 | 181 |
| 269 | 3300003781 | Ga0055536_1000103 | Ga0055536_100010324 | 181 |
| 270 | 3300003784 | Ga0055534_1000104 | Ga0055534_100010469 | 181 |
| 271 | 3300003784 | Ga0055534_1000158 | Ga0055534_100015823 | 181 |
| 272 | 3300003784 | Ga0055534_1000329 | Ga0055534_100032924 | 181 |
| 273 | 3300003784 | Ga0055534_1000822 | Ga0055534_10008228 | 181 |
| 274 | 3300003784 | Ga0055534_1000952 | Ga0055534_10009528 | 181 |
| 275 | 3300003784 | Ga0055534_1021360 | Ga0055534_10213602 | 181 |
| 276 | 3300003790 | Ga0055528_1000601 | Ga0055528_100060119 | 181 |
| 277 | 3300003791 | Ga0055530_10000151 | Ga0055530_1000015131 | 181 |
| 278 | 3300003791 | Ga0055530_10000178 | Ga0055530_1000017833 | 181 |
| 279 | 3300003792 | Ga0055540_1000101 | Ga0055540_100010133 | 181 |
| 280 | 3300003794 | Ga0055531_10000174 | Ga0055531_1000017416 | 181 |
| 281 | 3300003794 | Ga0055531_10013762 | Ga0055531_100137624 | 181 |
| 282 | 3300004625 | Ga0055543_1000267 | Ga0055543_100026729 | 181 |
| 283 | 3300004625 | Ga0055543_1000325 | Ga0055543_100032524 | 181 |
| 284 | 3300004625 | Ga0055543_1008837 | Ga0055543_10088372 | 181 |
| 285 | 3300005262 | Ga0065165_1000447 | Ga0065165_100044717 | 181 |
| 286 | 3300005262 | Ga0065165_1000898 | Ga0065165_100089829 | 181 |
| 287 | 3300005262 | Ga0065165_1001062 | Ga0065165_10010629 | 181 |
| 288 | 3300005262 | Ga0065165_1016545 | Ga0065165_10165453 | 181 |
| 289 | 3300005288 | Ga0065714_10002526 | Ga0065714_1000252617 | 181 |
| 290 | 3300005289 | Ga0065704_10070567 | Ga0065704_1007056713 | 181 |
| 291 | 3300005327 | Ga0070658_10422706 | Ga0070658_104227062 | 181 |
| 292 | 3300005335 | Ga0070666_10004342 | Ga0070666_100043424 | 181 |
| 293 | 3300005355 | Ga0070671_100000012 | Ga0070671_1000000126 | 181 |
| 294 | 3300005548 | Ga0070665_100005528 | Ga0070665_1000055288 | 181 |
| 295 | 3300005548 | Ga0070665_100323843 | Ga0070665_1003238432 | 181 |
| 296 | 3300005563 | Ga0068855_100035221 | Ga0068855_1000352214 | 181 |
| 297 | 3300005617 | Ga0068859_100004124 | Ga0068859_1000041244 | 181 |
| 298 | 3300005844 | Ga0068862_100011562 | Ga0068862_1000115624 | 181 |
| 299 | 3300006048 | Ga0075363_100264774 | Ga0075363_1002647742 | 181 |
| 300 | 3300006051 | Ga0075364_10060956 | Ga0075364_100609563 | 181 |
| 301 | 3300006051 | Ga0075364_10298526 | Ga0075364_102985262 | 181 |
| 302 | 3300006058 | Ga0075432_10092112 | Ga0075432_100921122 | 181 |
| 303 | 3300006178 | Ga0075367_10526924 | Ga0075367_105269242 | 181 |
| 304 | 3300006186 | Ga0075369_10015675 | Ga0075369_100156753 | 181 |
| 305 | 3300006186 | Ga0075369_10455122 | Ga0075369_104551221 | 181 |
| 306 | 3300006195 | Ga0075366_10066774 | Ga0075366_100667742 | 181 |
| 307 | 3300006852 | Ga0075433_10266402 | Ga0075433_102664022 | 181 |
| 308 | 3300006931 | Ga0097620_100004126 | Ga0097620_10000412611 | 181 |
| 309 | 3300006942 | Ga0099824_1026038 | Ga0099824_10260383 | 181 |
| 310 | 3300006943 | Ga0099822_1046929 | Ga0099822_10469293 | 181 |
| 311 | 3300007076 | Ga0075435_100017559 | Ga0075435_1000175591 | 181 |
| 312 | 3300009036 | Ga0105244_10006364 | Ga0105244_100063644 | 181 |
| 313 | 3300009036 | Ga0105244_10299592 | Ga0105244_102995922 | 181 |
| 314 | 3300009176 | Ga0105242_10774441 | Ga0105242_107744412 | 181 |
| 315 | 3300009177 | Ga0105248_10003226 | Ga0105248_1000322610 | 181 |
| 316 | 3300009177 | Ga0105248_10704064 | Ga0105248_107040642 | 181 |
| 317 | 3300012505 | Ga0157339_1021528 | Ga0157339_10215281 | 181 |
| 318 | 3300013100 | Ga0157373_10004231 | Ga0157373_100042314 | 181 |
| 319 | 3300013100 | Ga0157373_10018184 | Ga0157373_100181844 | 181 |
| 320 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001544 | 181 |
| 321 | 3300013104 | Ga0157370_10008528 | Ga0157370_100085288 | 181 |
| 322 | 3300013104 | Ga0157370_10403969 | Ga0157370_104039692 | 181 |
| 323 | 3300013308 | Ga0157375_10002678 | Ga0157375_100026783 | 181 |
| 324 | 3300014326 | Ga0157380_10402195 | Ga0157380_104021952 | 181 |
| 325 | 3300014497 | Ga0182008_10049743 | Ga0182008_100497433 | 181 |
| 326 | 3300014969 | Ga0157376_10877342 | Ga0157376_108773422 | 181 |
| 327 | 3300015261 | Ga0182006_1024123 | Ga0182006_10241233 | 181 |
| 328 | 3300015261 | Ga0182006_1059355 | Ga0182006_10593552 | 181 |
| 329 | 3300015261 | Ga0182006_1158742 | Ga0182006_11587422 | 181 |
| 330 | 3300015262 | Ga0182007_10003645 | Ga0182007_100036452 | 181 |
| 331 | 3300015265 | Ga0182005_1000490 | Ga0182005_100049015 | 181 |
| 332 | 3300017792 | Ga0163161_10088440 | Ga0163161_100884402 | 181 |
| 333 | 3300021361 | Ga0213872_10015084 | Ga0213872_100150844 | 181 |
| 334 | 3300021361 | Ga0213872_10133125 | Ga0213872_101331252 | 181 |
| 335 | 3300025208 | Ga0209436_100116 | Ga0209436_1001169 | 181 |
| 336 | 3300025208 | Ga0209436_100135 | Ga0209436_10013529 | 181 |
| 337 | 3300025233 | Ga0209437_102331 | Ga0209437_1023312 | 181 |
| 338 | 3300025245 | Ga0207425_1000021 | Ga0207425_1000021266 | 181 |
| 339 | 3300025245 | Ga0207425_1000050 | Ga0207425_100005069 | 181 |
| 340 | 3300025245 | Ga0207425_1000063 | Ga0207425_100006369 | 181 |
| 341 | 3300025245 | Ga0207425_1000150 | Ga0207425_100015033 | 181 |
| 342 | 3300025245 | Ga0207425_1007633 | Ga0207425_10076333 | 181 |
| 343 | 3300025246 | Ga0209646_1000047 | Ga0209646_100004778 | 181 |
| 344 | 3300025250 | Ga0209026_1006080 | Ga0209026_10060803 | 181 |
| 345 | 3300025250 | Ga0209026_1032525 | Ga0209026_10325252 | 181 |
| 346 | 3300025258 | Ga0209129_1000020 | Ga0209129_1000020337 | 181 |
| 347 | 3300025258 | Ga0209129_1000240 | Ga0209129_100024019 | 181 |
| 348 | 3300025258 | Ga0209129_1000808 | Ga0209129_10008086 | 181 |
| 349 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006266 | 181 |
| 350 | 3300025263 | Ga0209565_1000296 | Ga0209565_100029637 | 181 |
| 351 | 3300025263 | Ga0209565_1000303 | Ga0209565_100030311 | 181 |
| 352 | 3300025263 | Ga0209565_1000367 | Ga0209565_10003679 | 181 |
| 353 | 3300025263 | Ga0209565_1000421 | Ga0209565_100042128 | 181 |
| 354 | 3300025263 | Ga0209565_1000439 | Ga0209565_100043922 | 181 |
| 355 | 3300025263 | Ga0209565_1007902 | Ga0209565_10079022 | 181 |
| 356 | 3300025263 | Ga0209565_1009277 | Ga0209565_10092772 | 181 |
| 357 | 3300025263 | Ga0209565_1012079 | Ga0209565_10120793 | 181 |
| 358 | 3300025263 | Ga0209565_1014026 | Ga0209565_10140263 | 181 |
| 359 | 3300025263 | Ga0209565_1022865 | Ga0209565_10228652 | 181 |
| 360 | 3300025272 | Ga0209455_1000051 | Ga0209455_1000051153 | 181 |
| 361 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004563 | 181 |
| 362 | 3300025273 | Ga0209673_1001496 | Ga0209673_100149610 | 181 |
| 363 | 3300025273 | Ga0209673_1001877 | Ga0209673_100187716 | 181 |
| 364 | 3300025273 | Ga0209673_1004263 | Ga0209673_10042635 | 181 |
| 365 | 3300025284 | Ga0209130_1000518 | Ga0209130_100051829 | 181 |
| 366 | 3300025284 | Ga0209130_1000574 | Ga0209130_100057429 | 181 |
| 367 | 3300025284 | Ga0209130_1000951 | Ga0209130_10009517 | 181 |
| 368 | 3300025284 | Ga0209130_1004663 | Ga0209130_10046632 | 181 |
| 369 | 3300025291 | Ga0209675_1000006 | Ga0209675_1000006265 | 181 |
| 370 | 3300025291 | Ga0209675_1000078 | Ga0209675_100007842 | 181 |
| 371 | 3300025291 | Ga0209675_1000268 | Ga0209675_100026839 | 181 |
| 372 | 3300025291 | Ga0209675_1000418 | Ga0209675_100041828 | 181 |
| 373 | 3300025291 | Ga0209675_1006590 | Ga0209675_10065903 | 181 |
| 374 | 3300025291 | Ga0209675_1063491 | Ga0209675_10634911 | 181 |
| 375 | 3300025292 | Ga0209676_1000121 | Ga0209676_1000121145 | 181 |
| 376 | 3300025292 | Ga0209676_1001995 | Ga0209676_10019954 | 181 |
| 377 | 3300025294 | Ga0209025_1000051 | Ga0209025_100005143 | 181 |
| 378 | 3300025294 | Ga0209025_1000660 | Ga0209025_100066019 | 181 |
| 379 | 3300025294 | Ga0209025_1000978 | Ga0209025_100097831 | 181 |
| 380 | 3300025294 | Ga0209025_1018169 | Ga0209025_10181691 | 181 |
| 381 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006454 | 181 |
| 382 | 3300025295 | Ga0209564_1000064 | Ga0209564_100006412 | 181 |
| 383 | 3300025295 | Ga0209564_1000133 | Ga0209564_1000133137 | 181 |
| 384 | 3300025295 | Ga0209564_1000595 | Ga0209564_100059545 | 181 |
| 385 | 3300025295 | Ga0209564_1000908 | Ga0209564_100090829 | 181 |
| 386 | 3300025295 | Ga0209564_1001027 | Ga0209564_100102728 | 181 |
| 387 | 3300025295 | Ga0209564_1001062 | Ga0209564_100106222 | 181 |
| 388 | 3300025295 | Ga0209564_1003283 | Ga0209564_10032839 | 181 |
| 389 | 3300025297 | Ga0209758_1000288 | Ga0209758_10002884 | 181 |
| 390 | 3300025297 | Ga0209758_1000550 | Ga0209758_100055019 | 181 |
| 391 | 3300025297 | Ga0209758_1000596 | Ga0209758_100059632 | 181 |
| 392 | 3300025297 | Ga0209758_1011529 | Ga0209758_10115294 | 181 |
| 393 | 3300025298 | Ga0209050_1000028 | Ga0209050_1000028108 | 181 |
| 394 | 3300025298 | Ga0209050_1000050 | Ga0209050_1000050258 | 181 |
| 395 | 3300025298 | Ga0209050_1000261 | Ga0209050_100026179 | 181 |
| 396 | 3300025298 | Ga0209050_1000341 | Ga0209050_100034134 | 181 |
| 397 | 3300025299 | Ga0209256_1000013 | Ga0209256_1000013152 | 181 |
| 398 | 3300025299 | Ga0209256_1000079 | Ga0209256_1000079125 | 181 |
| 399 | 3300025299 | Ga0209256_1000179 | Ga0209256_100017948 | 181 |
| 400 | 3300025299 | Ga0209256_1000638 | Ga0209256_100063819 | 181 |
| 401 | 3300025299 | Ga0209256_1000757 | Ga0209256_100075728 | 181 |
| 402 | 3300025299 | Ga0209256_1021080 | Ga0209256_10210802 | 181 |
| 403 | 3300025302 | Ga0207426_1000506 | Ga0207426_100050629 | 181 |
| 404 | 3300025302 | Ga0207426_1000657 | Ga0207426_100065728 | 181 |
| 405 | 3300025303 | Ga0209051_1000087 | Ga0209051_1000087108 | 181 |
| 406 | 3300025303 | Ga0209051_1040326 | Ga0209051_10403262 | 181 |
| 407 | 3300025304 | Ga0209257_1000075 | Ga0209257_1000075258 | 181 |
| 408 | 3300025304 | Ga0209257_1000622 | Ga0209257_100062219 | 181 |
| 409 | 3300025304 | Ga0209257_1009247 | Ga0209257_10092474 | 181 |
| 410 | 3300025728 | Ga0207655_1014426 | Ga0207655_10144263 | 181 |
| 411 | 3300025903 | Ga0207680_10006161 | Ga0207680_100061613 | 181 |
| 412 | 3300025931 | Ga0207644_10000036 | Ga0207644_1000003672 | 181 |
| 413 | 3300025935 | Ga0207709_10275550 | Ga0207709_102755502 | 181 |
| 414 | 3300025941 | Ga0207711_10002081 | Ga0207711_1000208110 | 181 |
| 415 | 3300025949 | Ga0207667_10027997 | Ga0207667_100279974 | 181 |
| 416 | 3300027296 | Ga0209389_1000089 | Ga0209389_100008954 | 181 |
| 417 | 3300027312 | Ga0209371_1000078 | Ga0209371_1000078163 | 181 |
| 418 | 3300027357 | Ga0209589_1000148 | Ga0209589_100014848 | 181 |
| 419 | 3300027361 | Ga0209489_100512 | Ga0209489_10051235 | 181 |
| 420 | 3300027907 | Ga0207428_10289982 | Ga0207428_102899821 | 181 |
| 421 | 3300028379 | Ga0268266_10001076 | Ga0268266_1000107623 | 181 |
| 422 | 3300028380 | Ga0268265_10002115 | Ga0268265_1000211510 | 181 |
| 423 | 3300028794 | Ga0307515_10112647 | Ga0307515_101126472 | 181 |
| 424 | 3300029957 | Ga0265324_10011133 | Ga0265324_100111333 | 181 |
| 425 | 3300030500 | Ga0268256_1000298 | Ga0268256_10002988 | 181 |
| 426 | 3300031239 | Ga0265328_10011567 | Ga0265328_100115673 | 181 |
| 427 | 3300031239 | Ga0265328_10069420 | Ga0265328_100694202 | 181 |
| 428 | 3300031250 | Ga0265331_10000390 | Ga0265331_1000039021 | 181 |
| 429 | 3300031250 | Ga0265331_10028041 | Ga0265331_100280413 | 181 |
| 430 | 3300031251 | Ga0265327_10000271 | Ga0265327_1000027182 | 181 |
| 431 | 3300031251 | Ga0265327_10000859 | Ga0265327_1000085921 | 181 |
| 432 | 3300031251 | Ga0265327_10001921 | Ga0265327_100019218 | 181 |
| 433 | 3300031548 | Ga0307408_100000382 | Ga0307408_10000038225 | 181 |
| 434 | 3300031548 | Ga0307408_100001644 | Ga0307408_1000016448 | 181 |
| 435 | 3300031548 | Ga0307408_100012140 | Ga0307408_1000121403 | 181 |
| 436 | 3300031548 | Ga0307408_100102955 | Ga0307408_1001029552 | 181 |
| 437 | 3300031711 | Ga0265314_10011583 | Ga0265314_100115835 | 181 |
| 438 | 3300031838 | Ga0307518_10017110 | Ga0307518_100171104 | 181 |
| 439 | 3300031901 | Ga0307406_10288850 | Ga0307406_102888502 | 181 |
| 440 | 3300031911 | Ga0307412_10007201 | Ga0307412_100072011 | 181 |
| 441 | 3300031911 | Ga0307412_10023225 | Ga0307412_100232253 | 181 |
| 442 | 3300032002 | Ga0307416_100001464 | Ga0307416_1000014645 | 181 |
| 443 | 3300032004 | Ga0307414_10318310 | Ga0307414_103183102 | 181 |
| 444 | 3300037471 | Ga0395905_0036982 | Ga0395905_0036982_159_716 | 181 |
| 445 | 3300039062 | Ga0400483_176576 | Ga0400483_176576_484_1035 | 181 |
| 446 | 3300039447 | Ga0436361_0116812 | Ga0436361_0116812_1917_2462 | 181 |
| 447 | 3300039447 | Ga0436361_0148311 | Ga0436361_0148311_18796_19344 | 181 |
| 448 | 3300039447 | Ga0436361_0391517 | Ga0436361_0391517_3568_4113 | 181 |
| 449 | 3300039447 | Ga0436361_0465833 | Ga0436361_0465833_4719_5267 | 181 |
| 450 | 3300039447 | Ga0436361_0933837 | Ga0436361_0933837_678_1229 | 181 |
| 451 | 3300042006 | Ga0439432_000808 | Ga0439432_000808_8614_9159 | 181 |
| 452 | 3300042010 | Ga0439452_001209 | Ga0439452_001209_10166_10714 | 181 |
| 453 | 3300042139 | Ga0450904_000137 | Ga0450904_000137_13353_13916 | 181 |
| 454 | 3300042533 | Ga0450901_000885 | Ga0450901_000885_2138_2683 | 181 |
| 455 | 3300044693 | Ga0466961_0008258 | Ga0466961_0008258_565_1116 | 181 |
| 456 | 3300044712 | Ga0453684_0000273 | Ga0453684_0000273_11473_12021 | 181 |
| 457 | 3300044712 | Ga0453684_0099325 | Ga0453684_0099325_1570_2136 | 181 |
| 458 | 3300044901 | Ga0466960_0003091 | Ga0466960_0003091_2847_3398 | 181 |
| 459 | 3300046452 | Ga0495617_017943 | Ga0495617_017943_1408_1953 | 181 |
| 460 | 3300046452 | Ga0495617_095509 | Ga0495617_095509_142_690 | 181 |
| 461 | 3300046457 | Ga0495590_0011333 | Ga0495590_0011333_302_847 | 181 |
| 462 | 3300046460 | Ga0495638_0000602 | Ga0495638_0000602_16891_17436 | 181 |
| 463 | 3300046460 | Ga0495638_0110711 | Ga0495638_0110711_728_1273 | 181 |
| 464 | 3300046463 | Ga0495653_0000297 | Ga0495653_0000297_5316_5864 | 181 |
| 465 | 3300046463 | Ga0495653_0001050 | Ga0495653_0001050_18830_19375 | 181 |
| 466 | 3300046463 | Ga0495653_0006111 | Ga0495653_0006111_5125_5673 | 181 |
| 467 | 3300046471 | Ga0495650_0000047 | Ga0495650_0000047_292881_293432 | 181 |
| 468 | 3300046471 | Ga0495650_0001240 | Ga0495650_0001240_561_1106 | 181 |
| 469 | 3300046474 | Ga0495605_0000015 | Ga0495605_0000015_120128_120676 | 181 |
| 470 | 3300046474 | Ga0495605_0020206 | Ga0495605_0020206_2408_2953 | 181 |
| 471 | 3300046474 | Ga0495605_0080460 | Ga0495605_0080460_811_1356 | 181 |
| 472 | 3300046491 | Ga0495584_0000106 | Ga0495584_0000106_3895_4440 | 181 |
| 473 | 3300046491 | Ga0495584_0010772 | Ga0495584_0010772_425_970 | 181 |
| 474 | 3300046491 | Ga0495584_0017917 | Ga0495584_0017917_1107_1658 | 181 |
| 475 | 3300046491 | Ga0495584_0068312 | Ga0495584_0068312_840_1385 | 181 |
| 476 | 3300046492 | Ga0495585_0005034 | Ga0495585_0005034_6538_7083 | 181 |
| 477 | 3300046492 | Ga0495585_0026369 | Ga0495585_0026369_1471_2016 | 181 |
| 478 | 3300046492 | Ga0495585_0260209 | Ga0495585_0260209_221_766 | 181 |
| 479 | 3300046500 | Ga0495596_0000075 | Ga0495596_0000075_13940_14485 | 181 |
| 480 | 3300046501 | Ga0495607_0001974 | Ga0495607_0001974_14723_15268 | 181 |
| 481 | 3300046501 | Ga0495607_0019971 | Ga0495607_0019971_1358_1903 | 181 |
| 482 | 3300046501 | Ga0495607_0027201 | Ga0495607_0027201_2115_2660 | 181 |
| 483 | 3300046501 | Ga0495607_0260646 | Ga0495607_0260646_93_638 | 181 |
| 484 | 3300046506 | Ga0495583_0000727 | Ga0495583_0000727_9950_10495 | 181 |
| 485 | 3300046507 | Ga0495606_0000133 | Ga0495606_0000133_4191_4739 | 181 |
| 486 | 3300046507 | Ga0495606_0000690 | Ga0495606_0000690_21045_21593 | 181 |
| 487 | 3300046507 | Ga0495606_0003233 | Ga0495606_0003233_16689_17234 | 181 |
| 488 | 3300046507 | Ga0495606_0074951 | Ga0495606_0074951_796_1341 | 181 |
| 489 | 3300046507 | Ga0495606_0108121 | Ga0495606_0108121_322_870 | 181 |
| 490 | 3300046512 | Ga0495610_0004101 | Ga0495610_0004101_10345_10893 | 181 |
| 491 | 3300046512 | Ga0495610_0015140 | Ga0495610_0015140_378_926 | 181 |
| 492 | 3300046512 | Ga0495610_0069200 | Ga0495610_0069200_1069_1614 | 181 |
| 493 | 3300046513 | Ga0495616_0001327 | Ga0495616_0001327_7364_7909 | 181 |
| 494 | 3300046513 | Ga0495616_0001422 | Ga0495616_0001422_14731_15276 | 181 |
| 495 | 3300046513 | Ga0495616_0002054 | Ga0495616_0002054_2278_2823 | 181 |
| 496 | 3300046513 | Ga0495616_0066472 | Ga0495616_0066472_1003_1554 | 181 |
| 497 | 3300046515 | Ga0495620_0042498 | Ga0495620_0042498_76_621 | 181 |
| 498 | 3300046517 | Ga0495630_0003242 | Ga0495630_0003242_1835_2380 | 181 |
| 499 | 3300046518 | Ga0495631_0091706 | Ga0495631_0091706_167_718 | 181 |
| 500 | 3300046519 | Ga0495632_0206447 | Ga0495632_0206447_229_774 | 181 |
| 501 | 3300046520 | Ga0495637_0001219 | Ga0495637_0001219_407_952 | 181 |
| 502 | 3300046520 | Ga0495637_0024441 | Ga0495637_0024441_1813_2373 | 181 |
| 503 | 3300046522 | Ga0495643_0000224 | Ga0495643_0000224_23542_24087 | 181 |
| 504 | 3300046522 | Ga0495643_0033850 | Ga0495643_0033850_1275_1820 | 181 |
| 505 | 3300046522 | Ga0495643_0196343 | Ga0495643_0196343_108_653 | 181 |
| 506 | 3300046522 | Ga0495643_0221470 | Ga0495643_0221470_70_615 | 181 |
| 507 | 3300046523 | Ga0495644_0000644 | Ga0495644_0000644_702_1247 | 181 |
| 508 | 3300046523 | Ga0495644_0022013 | Ga0495644_0022013_1377_1940 | 181 |
| 509 | 3300046524 | Ga0495648_0039789 | Ga0495648_0039789_1070_1615 | 181 |
| 510 | 3300046524 | Ga0495648_0041962 | Ga0495648_0041962_866_1411 | 181 |
| 511 | 3300046524 | Ga0495648_0062976 | Ga0495648_0062976_453_1001 | 181 |
| 512 | 3300046524 | Ga0495648_0074348 | Ga0495648_0074348_175_723 | 181 |
| 513 | 3300046528 | Ga0495642_0000867 | Ga0495642_0000867_10537_11082 | 181 |
| 514 | 3300046528 | Ga0495642_0020231 | Ga0495642_0020231_1733_2281 | 181 |
| 515 | 3300046530 | Ga0495654_0003263 | Ga0495654_0003263_7736_8281 | 181 |
| 516 | 3300046530 | Ga0495654_0082561 | Ga0495654_0082561_359_904 | 181 |
| 517 | 3300046530 | Ga0495654_0217704 | Ga0495654_0217704_224_769 | 181 |
| 518 | 3300046536 | Ga0495587_0000722 | Ga0495587_0000722_18847_19392 | 181 |
| 519 | 3300046538 | Ga0495609_0000839 | Ga0495609_0000839_14422_14967 | 181 |
| 520 | 3300046538 | Ga0495609_0015559 | Ga0495609_0015559_488_1033 | 181 |
| 521 | 3300046542 | Ga0495597_0001012 | Ga0495597_0001012_15527_16075 | 181 |
| 522 | 3300046542 | Ga0495597_0001132 | Ga0495597_0001132_13671_14216 | 181 |
| 523 | 3300046542 | Ga0495597_0021121 | Ga0495597_0021121_2469_3014 | 181 |
| 524 | 3300046558 | Ga0495633_0001115 | Ga0495633_0001115_19725_20270 | 181 |
| 525 | 3300046558 | Ga0495633_0002441 | Ga0495633_0002441_10807_11355 | 181 |
| 526 | 3300046558 | Ga0495633_0012440 | Ga0495633_0012440_3155_3703 | 181 |
| 527 | 3300046615 | Ga0495656_0006569 | Ga0495656_0006569_591_1136 | 181 |
| 528 | 3300046616 | Ga0495668_0000049 | Ga0495668_0000049_167235_167780 | 181 |
| 529 | 3300046616 | Ga0495668_0000195 | Ga0495668_0000195_56030_56575 | 181 |
| 530 | 3300046616 | Ga0495668_0002168 | Ga0495668_0002168_9679_10224 | 181 |
| 531 | 3300046616 | Ga0495668_0108303 | Ga0495668_0108303_102_665 | 181 |
| 532 | 3300046642 | Ga0495634_0001237 | Ga0495634_0001237_20279_20824 | 181 |
| 533 | 3300046648 | Ga0495611_0003498 | Ga0495611_0003498_606_1151 | 181 |
| 534 | 3300046660 | Ga0495625_0013500 | Ga0495625_0013500_4950_5495 | 181 |
| 535 | 3300046660 | Ga0495625_0072900 | Ga0495625_0072900_290_835 | 181 |
| 536 | 3300046660 | Ga0495625_0113205 | Ga0495625_0113205_729_1274 | 181 |
| 537 | 3300046660 | Ga0495625_0348631 | Ga0495625_0348631_354_899 | 181 |
| 538 | 3300046660 | Ga0495625_0539372 | Ga0495625_0539372_140_685 | 181 |
| 539 | 3300046663 | Ga0495635_0000601 | Ga0495635_0000601_20588_21133 | 181 |
| 540 | 3300046665 | Ga0495661_0008159 | Ga0495661_0008159_5018_5563 | 181 |
| 541 | 3300046665 | Ga0495661_0017506 | Ga0495661_0017506_809_1354 | 181 |
| 542 | 3300046665 | Ga0495661_0018648 | Ga0495661_0018648_1963_2508 | 181 |
| 543 | 3300046665 | Ga0495661_0232153 | Ga0495661_0232153_327_935 | 181 |
| 544 | 3300046680 | Ga0495646_0000419 | Ga0495646_0000419_3048_3593 | 181 |
| 545 | 3300046691 | Ga0495670_0000159 | Ga0495670_0000159_1621_2166 | 181 |
| 546 | 3300046691 | Ga0495670_0001755 | Ga0495670_0001755_8482_9027 | 181 |
| 547 | 3300046692 | Ga0495671_0000044 | Ga0495671_0000044_55172_55720 | 181 |
| 548 | 3300046692 | Ga0495671_0031910 | Ga0495671_0031910_1656_2204 | 181 |
| 549 | 3300046692 | Ga0495671_0184178 | Ga0495671_0184178_436_981 | 181 |
| 550 | 3300046694 | Ga0495649_0000543 | Ga0495649_0000543_20597_21154 | 181 |
| 551 | 3300046694 | Ga0495649_0001315 | Ga0495649_0001315_1035_1580 | 181 |
| 552 | 3300046694 | Ga0495649_0092158 | Ga0495649_0092158_679_1224 | 181 |
| 553 | 3300046794 | Ga0495589_0011893 | Ga0495589_0011893_1477_2022 | 181 |
| 554 | 3300046794 | Ga0495589_0044644 | Ga0495589_0044644_269_814 | 181 |
| 555 | 3300046810 | Ga0495660_0000292 | Ga0495660_0000292_37753_38304 | 181 |
| 556 | 3300047318 | Ga0495636_0341998 | Ga0495636_0341998_98_646 | 181 |
| 557 | 3300047319 | Ga0495674_0728656 | Ga0495674_0728656_213_758 | 181 |
| 558 | 3300047320 | Ga0495672_0007968 | Ga0495672_0007968_6581_7126 | 181 |
| 559 | 3300047320 | Ga0495672_0012969 | Ga0495672_0012969_2720_3265 | 181 |
| 560 | 3300047323 | Ga0495683_0059666 | Ga0495683_0059666_33_584 | 181 |
| 561 | 3300047323 | Ga0495683_0147651 | Ga0495683_0147651_272_817 | 181 |
| 562 | 3300047323 | Ga0495683_0213387 | Ga0495683_0213387_231_776 | 181 |
| 563 | 3300047445 | Ga0495677_0071044 | Ga0495677_0071044_742_1287 | 181 |
| 564 | 3300047445 | Ga0495677_0081401 | Ga0495677_0081401_654_1202 | 181 |
| 565 | 3300047446 | Ga0495679_057548 | Ga0495679_057548_302_853 | 181 |
| 566 | 3300047469 | Ga0495673_0000027 | Ga0495673_0000027_295246_295794 | 181 |
| 567 | 3300047469 | Ga0495673_0000037 | Ga0495673_0000037_256377_256925 | 181 |
| 568 | 3300047469 | Ga0495673_0000060 | Ga0495673_0000060_11570_12118 | 181 |
| 569 | 3300047469 | Ga0495673_0064743 | Ga0495673_0064743_118_663 | 181 |
| 570 | 3300047470 | Ga0495681_0002215 | Ga0495681_0002215_359_904 | 181 |
| 571 | 3300047470 | Ga0495681_0029353 | Ga0495681_0029353_1292_1843 | 181 |
| 572 | 3300047470 | Ga0495681_0161542 | Ga0495681_0161542_88_639 | 181 |
| 573 | 3300047673 | Ga0495593_0000538 | Ga0495593_0000538_1991_2536 | 181 |
| 574 | 3300048088 | Ga0495602_0208813 | Ga0495602_0208813_583_1128 | 181 |
| 575 | 3300048091 | Ga0495626_0000219 | Ga0495626_0000219_53768_54328 | 181 |
| 576 | 3300048091 | Ga0495626_0000323 | Ga0495626_0000323_21740_22285 | 181 |
| 577 | 3300048091 | Ga0495626_0001681 | Ga0495626_0001681_14074_14619 | 181 |
| 578 | 3300048903 | Ga0496100_0159668 | Ga0496100_0159668_836_1381 | 181 |
| 579 | 3300048903 | Ga0496100_0643504 | Ga0496100_0643504_126_671 | 181 |
| 580 | 3300048904 | Ga0496101_0021648 | Ga0496101_0021648_201_746 | 181 |
| 581 | 3300048904 | Ga0496101_0245295 | Ga0496101_0245295_508_1074 | 181 |
| 582 | 3300048905 | Ga0496102_0000957 | Ga0496102_0000957_23842_24387 | 181 |
| 583 | 3300048905 | Ga0496102_0923945 | Ga0496102_0923945_221_766 | 181 |
| 584 | 3300048906 | Ga0496103_0001518 | Ga0496103_0001518_13555_14100 | 181 |
| 585 | 3300048910 | Ga0496107_0460361 | Ga0496107_0460361_186_734 | 181 |
| 586 | 3300048913 | Ga0496110_0913414 | Ga0496110_0913414_15_563 | 181 |
| 587 | 3300048914 | Ga0496111_0201599 | Ga0496111_0201599_93_641 | 181 |
| 588 | 3300048919 | Ga0496116_0004269 | Ga0496116_0004269_8947_9492 | 181 |
| 589 | 3300048919 | Ga0496116_0007765 | Ga0496116_0007765_3058_3603 | 181 |
| 590 | 3300048919 | Ga0496116_0019322 | Ga0496116_0019322_1783_2328 | 181 |
| 591 | 3300048919 | Ga0496116_0104302 | Ga0496116_0104302_214_762 | 181 |
| 592 | 3300048920 | Ga0496117_0003351 | Ga0496117_0003351_2180_2725 | 181 |
| 593 | 3300048920 | Ga0496117_0005935 | Ga0496117_0005935_8947_9492 | 181 |
| 594 | 3300048920 | Ga0496117_0006377 | Ga0496117_0006377_1090_1635 | 181 |
| 595 | 3300048920 | Ga0496117_0043933 | Ga0496117_0043933_1332_1877 | 181 |
| 596 | 3300048921 | Ga0496118_0005490 | Ga0496118_0005490_12755_13300 | 181 |
| 597 | 3300048921 | Ga0496118_0008693 | Ga0496118_0008693_4057_4602 | 181 |
| 598 | 3300048921 | Ga0496118_0025440 | Ga0496118_0025440_2558_3103 | 181 |
| 599 | 3300048921 | Ga0496118_0067890 | Ga0496118_0067890_83_628 | 181 |
| 600 | 3300048922 | Ga0496119_0036248 | Ga0496119_0036248_608_1153 | 181 |
| 601 | 3300048922 | Ga0496119_0043332 | Ga0496119_0043332_1738_2283 | 181 |
| 602 | 3300048924 | Ga0496121_0046061 | Ga0496121_0046061_1039_1584 | 181 |
| 603 | 3300048924 | Ga0496121_0103724 | Ga0496121_0103724_619_1164 | 181 |
| 604 | 3300048924 | Ga0496121_0104952 | Ga0496121_0104952_1434_1979 | 181 |
| 605 | 3300048924 | Ga0496121_0210246 | Ga0496121_0210246_555_1100 | 181 |
| 606 | 3300048924 | Ga0496121_0391699 | Ga0496121_0391699_253_801 | 181 |
| 607 | 3300048925 | Ga0496122_0000962 | Ga0496122_0000962_50120_50665 | 181 |
| 608 | 3300048925 | Ga0496122_0025381 | Ga0496122_0025381_156_701 | 181 |
| 609 | 3300048925 | Ga0496122_0076395 | Ga0496122_0076395_935_1483 | 181 |
| 610 | 3300048925 | Ga0496122_0091382 | Ga0496122_0091382_1039_1584 | 181 |
| 611 | 3300048926 | Ga0496123_0000750 | Ga0496123_0000750_1871_2416 | 181 |
| 612 | 3300048926 | Ga0496123_0032775 | Ga0496123_0032775_119_667 | 181 |
| 613 | 3300048926 | Ga0496123_0082149 | Ga0496123_0082149_1332_1877 | 181 |
| 614 | 3300048927 | Ga0496124_0000285 | Ga0496124_0000285_91028_91573 | 181 |
| 615 | 3300048927 | Ga0496124_0001456 | Ga0496124_0001456_7030_7575 | 181 |
| 616 | 3300048927 | Ga0496124_0003860 | Ga0496124_0003860_4962_5519 | 181 |
| 617 | 3300048927 | Ga0496124_0017901 | Ga0496124_0017901_1787_2332 | 181 |
| 618 | 3300048927 | Ga0496124_0134991 | Ga0496124_0134991_1332_1877 | 181 |
| 619 | 3300048927 | Ga0496124_0176862 | Ga0496124_0176862_97_642 | 181 |
| 620 | 3300048927 | Ga0496124_0451558 | Ga0496124_0451558_238_786 | 181 |
| 621 | 3300048928 | Ga0496125_0039443 | Ga0496125_0039443_1185_1730 | 181 |
| 622 | 3300048929 | Ga0496126_0005419 | Ga0496126_0005419_12920_13465 | 181 |
| 623 | 3300048929 | Ga0496126_0038851 | Ga0496126_0038851_248_793 | 181 |
| 624 | 3300048929 | Ga0496126_0041628 | Ga0496126_0041628_910_1458 | 181 |
| 625 | 3300048929 | Ga0496126_0148827 | Ga0496126_0148827_131_676 | 181 |
| 626 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_689590_690135 | 181 |
| 627 | 3300049459 | Ga0495678_006341 | Ga0495678_006341_2477_3028 | 181 |
| 628 | 3300049459 | Ga0495678_029233 | Ga0495678_029233_192_737 | 181 |
| 629 | 3300049459 | Ga0495678_065338 | Ga0495678_065338_330_875 | 181 |
| 630 | 3300049460 | Ga0495682_0000095 | Ga0495682_0000095_56943_57488 | 181 |
| 631 | 3300049460 | Ga0495682_0000466 | Ga0495682_0000466_4589_5134 | 181 |
| 632 | 3300049460 | Ga0495682_0040591 | Ga0495682_0040591_994_1539 | 181 |
| 633 | 3300049568 | Ga0501031_0054787 | Ga0501031_0054787_294_839 | 181 |
| 634 | 3300049569 | Ga0501032_0034032 | Ga0501032_0034032_1382_1927 | 181 |
| 635 | 3300049571 | Ga0501034_0007417 | Ga0501034_0007417_8522_9067 | 181 |
| 636 | 3300049574 | Ga0501038_0110693 | Ga0501038_0110693_192_737 | 181 |
| 637 | 3300049575 | Ga0501039_0008456 | Ga0501039_0008456_4187_4732 | 181 |
| 638 | 3300049575 | Ga0501039_0193783 | Ga0501039_0193783_146_691 | 181 |
| 639 | 3300049575 | Ga0501039_0345758 | Ga0501039_0345758_195_740 | 181 |
| 640 | 3300049580 | Ga0501046_0515599 | Ga0501046_0515599_183_728 | 181 |
| 641 | 3300049662 | Ga0501222_004695 | Ga0501222_004695_325_870 | 181 |
| 642 | 3300049665 | Ga0501227_003043 | Ga0501227_003043_356_901 | 181 |
| 643 | 3300049673 | Ga0501240_010647 | Ga0501240_010647_608_1153 | 181 |
| 644 | 3300049766 | Ga0501269_002758 | Ga0501269_002758_1260_1805 | 181 |
| 645 | 3300049822 | Ga0501035_0022923 | Ga0501035_0022923_3856_4401 | 181 |
| 646 | 3300049822 | Ga0501035_0088603 | Ga0501035_0088603_2117_2662 | 181 |
| 647 | 3300049823 | Ga0501044_0979779 | Ga0501044_0979779_91_636 | 181 |
| 648 | 3300050490 | nmdc:mga03n38_130203_c1 | nmdc:mga03n38_130203_c1_675_1223 | 181 |
| 649 | 3300050493 | nmdc:mga0k408_11886_c1 | nmdc:mga0k408_11886_c1_2964_3512 | 181 |
| 650 | 3300050493 | nmdc:mga0k408_7548_c1 | nmdc:mga0k408_7548_c1_4040_4588 | 181 |
| 651 | 3300050508 | nmdc:mga09592_507121_c1 | nmdc:mga09592_507121_c1_188_745 | 181 |
| 652 | 3300050513 | nmdc:mga0rr50_13151_c1 | nmdc:mga0rr50_13151_c1_4762_5307 | 181 |
| 653 | 3300050515 | nmdc:mga0a205_13912_c1 | nmdc:mga0a205_13912_c1_6637_7182 | 181 |
| 654 | 3300050516 | nmdc:mga0sz30_241236_c1 | nmdc:mga0sz30_241236_c1_235_780 | 181 |
| 655 | 3300053125 | Ga0500618_000576 | Ga0500618_000576_21196_21744 | 181 |
| 656 | 3300053145 | Ga0500586_000070 | Ga0500586_000070_1376_1924 | 181 |
| 657 | 3300053156 | Ga0500622_0323627 | Ga0500622_0323627_88_633 | 181 |
| 658 | 3300053729 | Ga0500625_058052 | Ga0500625_058052_722_1267 | 181 |
| 659 | 3300059424 | Ga0590075_013549 | Ga0590075_013549_374_919 | 181 |
| 660 | 2010549000 | RicEn_C3528 | RicEn_63810 | 182 |
| 661 | 2162886007 | SwRhRL2b_contig_2217296 | SwRhRL2b_0622.00003040 | 182 |
| 662 | 2162886007 | SwRhRL2b_contig_3824893 | SwRhRL2b_0301.00007190 | 182 |
| 663 | 3300003856 | Ga0058692_1000490 | Ga0058692_10004905 | 182 |
| 664 | 3300005289 | Ga0065704_10001570 | Ga0065704_100015708 | 182 |
| 665 | 3300006946 | Ga0079104_1000282 | Ga0079104_100028236 | 182 |
| 666 | 3300006946 | Ga0079104_1037413 | Ga0079104_10374132 | 182 |
| 667 | 3300009011 | Ga0105251_10042977 | Ga0105251_100429772 | 182 |
| 668 | 3300009036 | Ga0105244_10000347 | Ga0105244_100003476 | 182 |
| 669 | 3300025728 | Ga0207655_1000447 | Ga0207655_100044746 | 182 |
| 670 | 3300027111 | Ga0209281_1000257 | Ga0209281_100025738 | 182 |
| 671 | 3300027312 | Ga0209371_1000015 | Ga0209371_1000015106 | 182 |
| 672 | 3300030500 | Ga0268256_1000018 | Ga0268256_1000018519 | 182 |
| 673 | 3300039062 | Ga0400483_101867 | Ga0400483_101867_305_853 | 182 |
| 674 | 3300039062 | Ga0400483_284223 | Ga0400483_284223_322_870 | 182 |
| 675 | 3300041405 | Ga0439438_000880 | Ga0439438_000880_8295_8843 | 182 |
| 676 | 3300041405 | Ga0439438_012055 | Ga0439438_012055_1139_1696 | 182 |
| 677 | 3300042006 | Ga0439432_024351 | Ga0439432_024351_465_1022 | 182 |
| 678 | 3300042010 | Ga0439452_000010 | Ga0439452_000010_375728_376285 | 182 |
| 679 | 3300042010 | Ga0439452_000020 | Ga0439452_000020_255353_255901 | 182 |
| 680 | 3300046471 | Ga0495650_0000454 | Ga0495650_0000454_40246_40794 | 182 |
| 681 | 3300046519 | Ga0495632_0000110 | Ga0495632_0000110_40482_41030 | 182 |
| 682 | 3300046519 | Ga0495632_0245006 | Ga0495632_0245006_143_691 | 182 |
| 683 | 3300046520 | Ga0495637_0018102 | Ga0495637_0018102_179_727 | 182 |
| 684 | 3300046665 | Ga0495661_0000247 | Ga0495661_0000247_47258_47806 | 182 |
| 685 | 3300048919 | Ga0496116_0009769 | Ga0496116_0009769_3991_4539 | 182 |
| 686 | 3300048920 | Ga0496117_0004348 | Ga0496117_0004348_2196_2744 | 182 |
| 687 | 3300048920 | Ga0496117_0005867 | Ga0496117_0005867_8403_8987 | 182 |
| 688 | 3300048921 | Ga0496118_0004249 | Ga0496118_0004249_3644_4192 | 182 |
| 689 | 3300048922 | Ga0496119_0000049 | Ga0496119_0000049_24836_25384 | 182 |
| 690 | 3300048923 | Ga0496120_0001489 | Ga0496120_0001489_16178_16726 | 182 |
| 691 | 3300048923 | Ga0496120_0015723 | Ga0496120_0015723_797_1345 | 182 |
| 692 | 3300048924 | Ga0496121_0001226 | Ga0496121_0001226_27275_27823 | 182 |
| 693 | 3300048925 | Ga0496122_0003434 | Ga0496122_0003434_2074_2622 | 182 |
| 694 | 3300048925 | Ga0496122_0005242 | Ga0496122_0005242_10216_10764 | 182 |
| 695 | 3300048926 | Ga0496123_0004279 | Ga0496123_0004279_9742_10290 | 182 |
| 696 | 3300048926 | Ga0496123_0005350 | Ga0496123_0005350_3760_4308 | 182 |
| 697 | 3300048927 | Ga0496124_0136704 | Ga0496124_0136704_732_1280 | 182 |
| 698 | 3300048928 | Ga0496125_0009915 | Ga0496125_0009915_1960_2508 | 182 |
| 699 | 3300048929 | Ga0496126_0009234 | Ga0496126_0009234_7463_8047 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9879 | 2 | 178 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.986 | 2 | 182 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9858 | 1 | 182 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.9818 | 1 | 182 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9752 | 1 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9814 | 2 | 182 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9725 | 1 | 176 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9693 | 1 | 176 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9583 | 2 | 174 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9572 | 2 | 176 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A630SW49-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 1.002 | 1 | 145 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A192C831-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 1.001 | 1 | 151 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A526YBR9-F1-model_v4 | deleted | 0.9984 | 1 | 180 |
|
| AF-A0A3C0JH15-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9982 | 1 | 155 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A448KY50-F1-model_v4 | deleted | 0.9976 | 1 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar