F476052

General Info

Members Datasets Scaffolds Average Seq Length
699 367 623 181

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0232153|Ga0495661_0232153_327_935
Length 202
Sequence MGNTCSGSCAIPASADRRAAAMQITPTALPDVLLIEPRVFGDDRGFFFESFNERAFDQAVGRQVRFVQDNHSRSSKNVLRGLHYQVEQAQGKLVRVVHGEVFDVAVDIRRSSPTFGQWVGEVLSAENKRQLWIPEGFAHGFVTLSDSAEFLYKTTDFWAPAFERCIRWDDSDLSIDWHLNGQPLVSAKDAVGLALRDAETFA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
5 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
6 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
7 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
8 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
9 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
10 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
11 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
12 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
13 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
14 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
15 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
16 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
17 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
18 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
19 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
20 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
21 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
22 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
23 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
24 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
25 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
26 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
27 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
28 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
29 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
30 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
31 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
32 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
33 2643221638 Duganella sp. Root336D2 Isolate Unclassified
34 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
35 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
36 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
37 2738541293 Rhizobium sp. GV031 Isolate Unclassified
38 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
39 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
40 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
41 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
42 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
43 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
44 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
45 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
46 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
47 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
48 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
49 2821131069 Duganella sp. 1224 Isolate Unclassified
50 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
51 2842711865 Duganella sp. R-73148 Isolate Unclassified
52 2842733646 Variovorax sp. R-72446 Isolate Unclassified
53 2847085930 Erwinia persicina B64 Isolate Bulb
54 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
55 2857553236 Duganella sp. R-74557 Isolate Unclassified
56 2857558681 Duganella sp. R-74565 Isolate Unclassified
57 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
58 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
59 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
60 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
61 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
62 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
63 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
64 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
65 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
66 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
67 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
68 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
69 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
70 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
71 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
72 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
75 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
80 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
81 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
82 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
83 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
84 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
90 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
91 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
92 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
95 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
96 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
97 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
98 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
99 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
109 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
117 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
118 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
135 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
147 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
161 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
164 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
169 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
170 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
214 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
215 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
217 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
222 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
226 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
237 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
252 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
253 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
342 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
343 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
344 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
359 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
360 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
363 8018221730 Enterobacter sp. CM29 Isolate Unclassified
364 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
365 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
366 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
367 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.13
Metatranscriptomes 0
Isolates 10.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.14
Endosphere 22.6
Nodule 1.29
Rhizoplane 5.44
Rhizosphere 55.36
Stem 0
Stem Tuber 0
Unclassified 15.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C3528 2010549000 Bacteria 1213
2 SwRhRL2b_contig_1879625 2162886007 Bacteria 3964
3 SwRhRL2b_contig_2217296 2162886007 Bacteria 1137
4 SwRhRL2b_contig_3824893 2162886007 Bacteria 1592
5 JGI25162J39368_1000398 3300002737 Bacteria 36350
6 JGI25152J39213_1000008 3300002773 Bacteria 154537
7 JGI25150J39212_1000076 3300002774 Bacteria 59132
8 JGI25150J39212_1000172 3300002774 Bacteria 36457
9 JGI25150J39212_1000274 3300002774 Bacteria 27353
10 JGI25150J39212_1005658 3300002774 Bacteria 2649
11 JGI25159J45721_1000129 3300002987 Bacteria 36238
12 JGI25159J45721_1000145 3300002987 Bacteria 32623
13 JGI25159J45721_1002216 3300002987 Bacteria 7528
14 JGI25151J46595_10000276 3300003187 Bacteria 59132
15 JGI25151J46595_10000338 3300003187 Bacteria 50270
16 JGI25153J46596_10003185 3300003215 Bacteria 9238
17 JGI25153J46596_10011038 3300003215 Bacteria 4027
18 JGI25153J46596_10014309 3300003215 Bacteria 3305
19 JGI25153J46596_10049132 3300003215 Bacteria 1226
20 rootH2_10028477 3300003320 Bacteria 18356
21 rootL2_10060118 3300003322 Bacteria 2538
22 JGI25160J50197_1000286 3300003354 Bacteria 36574
23 JGI25160J50197_1000327 3300003354 Bacteria 32616
24 JGI25161J50226_1000217 3300003374 Bacteria 36238
25 JGI25161J50226_1000245 3300003374 Bacteria 32623
26 JGI25161J50226_1010753 3300003374 Bacteria 1198
27 Ga0055542_1000069 3300003762 Bacteria 148278
28 Ga0055529_1000127 3300003763 Bacteria 109148
29 Ga0055526_1000111 3300003771 Bacteria 71834
30 Ga0055526_1000179 3300003771 Bacteria 56199
31 Ga0055526_1000496 3300003771 Bacteria 31280
32 Ga0055526_1001794 3300003771 Bacteria 14879
33 Ga0055526_1002293 3300003771 Bacteria 13057
34 Ga0055526_1012287 3300003771 Bacteria 3752
35 Ga0055537_1000056 3300003773 Bacteria 81623
36 Ga0055537_1000791 3300003773 Bacteria 15837
37 Ga0055537_1003205 3300003773 Bacteria 5110
38 Ga0055537_1003941 3300003773 Bacteria 4403
39 Ga0055524_1000591 3300003775 Bacteria 26287
40 Ga0055524_1000980 3300003775 Bacteria 17808
41 Ga0055524_1001112 3300003775 Bacteria 16237
42 Ga0055524_1001231 3300003775 Bacteria 15109
43 Ga0055524_1002638 3300003775 Bacteria 9122
44 Ga0055524_1026523 3300003775 Bacteria 1787
45 Ga0055536_1000103 3300003781 Bacteria 73706
46 Ga0055534_1000104 3300003784 Bacteria 64767
47 Ga0055534_1000158 3300003784 Bacteria 50846
48 Ga0055534_1000329 3300003784 Bacteria 31280
49 Ga0055534_1000822 3300003784 Bacteria 14343
50 Ga0055534_1000952 3300003784 Bacteria 12859
51 Ga0055534_1021360 3300003784 Bacteria 1083
52 Ga0055528_1000601 3300003790 Bacteria 27069
53 Ga0055530_10000151 3300003791 Bacteria 62528
54 Ga0055530_10000178 3300003791 Bacteria 58060
55 Ga0055540_1000101 3300003792 Bacteria 96054
56 Ga0055531_10000174 3300003794 Bacteria 72464
57 Ga0055531_10013762 3300003794 Bacteria 3706
58 Ga0058692_1000490 3300003856 Bacteria 17685
59 Ga0058692_1001598 3300003856 Bacteria 8162
60 Ga0055543_1000267 3300004625 Bacteria 38844
61 Ga0055543_1000325 3300004625 Bacteria 32876
62 Ga0055543_1008837 3300004625 Bacteria 2204
63 Ga0065165_1000447 3300005262 Bacteria 64800
64 Ga0065165_1000898 3300005262 Bacteria 38426
65 Ga0065165_1001062 3300005262 Bacteria 32876
66 Ga0065165_1016545 3300005262 Bacteria 2756
67 Ga0065714_10002526 3300005288 Bacteria 26791
68 Ga0065704_10001570 3300005289 Bacteria 10573
69 Ga0065704_10070567 3300005289 Bacteria 20333
70 Ga0070658_10422706 3300005327 Bacteria 1146
71 Ga0070670_100032783 3300005331 Bacteria 4475
72 Ga0070670_100576979 3300005331 Bacteria 1005
73 Ga0070666_10004342 3300005335 Bacteria 8632
74 Ga0070682_100000795 3300005337 Bacteria 18531
75 Ga0068868_100215876 3300005338 Bacteria 1605
76 Ga0070660_100222944 3300005339 Bacteria 1533
77 Ga0070687_100009410 3300005343 Bacteria 4186
78 Ga0070675_100278573 3300005354 Bacteria 1469
79 Ga0070671_100000012 3300005355 Bacteria 196420
80 Ga0070671_100948049 3300005355 Bacteria 753
81 Ga0070701_10385638 3300005438 Bacteria 884
82 Ga0068867_100269682 3300005459 Bacteria 1391
83 Ga0070698_100263494 3300005471 Bacteria 1656
84 Ga0068853_100142053 3300005539 Bacteria 2156
85 Ga0070672_100538345 3300005543 Bacteria 1013
86 Ga0070686_100049493 3300005544 Bacteria 2667
87 Ga0070693_100001806 3300005547 Bacteria 9757
88 Ga0070665_100005528 3300005548 Bacteria 12998
89 Ga0070665_100323843 3300005548 Bacteria 1545
90 Ga0070704_100248249 3300005549 Bacteria 1460
91 Ga0068855_100000144 3300005563 Bacteria 91639
92 Ga0068855_100035221 3300005563 Bacteria 5963
93 Ga0068855_101338699 3300005563 Bacteria 740
94 Ga0070664_100394565 3300005564 Bacteria 1265
95 Ga0068854_100449288 3300005578 Bacteria 1076
96 Ga0068852_100006976 3300005616 Bacteria 8219
97 Ga0068859_100004124 3300005617 Bacteria 14825
98 Ga0068864_100205820 3300005618 Bacteria 1810
99 Ga0068862_100011562 3300005844 Bacteria 7282
100 Ga0068862_100772574 3300005844 Bacteria 936
101 Ga0075363_100264774 3300006048 Bacteria 992
102 Ga0075364_10060956 3300006051 Bacteria 2474
103 Ga0075364_10298526 3300006051 Bacteria 1096
104 Ga0075364_10663066 3300006051 Bacteria 712
105 Ga0075432_10092112 3300006058 Bacteria 1111
106 Ga0075362_10158592 3300006177 Bacteria 1088
107 Ga0075367_10526924 3300006178 Bacteria 750
108 Ga0075369_10015675 3300006186 Bacteria 3046
109 Ga0075369_10455122 3300006186 Bacteria 606
110 Ga0075366_10018405 3300006195 Bacteria 4032
111 Ga0075366_10066774 3300006195 Bacteria 2140
112 Ga0075370_10040275 3300006353 Bacteria 2635
113 Ga0075433_10266402 3300006852 Bacteria 1519
114 Ga0097620_100004126 3300006931 Bacteria 14825
115 Ga0099824_1026038 3300006942 Bacteria 3088
116 Ga0099822_1046929 3300006943 Bacteria 1993
117 Ga0079104_1000282 3300006946 Bacteria 65218
118 Ga0079104_1037413 3300006946 Bacteria 1156
119 Ga0075435_100017559 3300007076 Bacteria 5419
120 Ga0075435_100305428 3300007076 Bacteria 1361
121 Ga0105251_10042977 3300009011 Bacteria 2190
122 Ga0105244_10000347 3300009036 Bacteria 43582
123 Ga0105244_10006364 3300009036 Bacteria 7665
124 Ga0105244_10010873 3300009036 Bacteria 5493
125 Ga0105244_10287233 3300009036 Bacteria 763
126 Ga0105244_10299592 3300009036 Bacteria 744
127 Ga0105250_10001034 3300009092 Bacteria 15954
128 Ga0105250_10002475 3300009092 Bacteria 9269
129 Ga0105241_10002877 3300009174 Bacteria 12858
130 Ga0105242_10774441 3300009176 Bacteria 947
131 Ga0105248_10003226 3300009177 Bacteria 18084
132 Ga0105248_10537975 3300009177 Bacteria 1318
133 Ga0105248_10704064 3300009177 Unclassified 1140
134 Ga0105237_10025046 3300009545 Bacteria 6103
135 Ga0105238_10002448 3300009551 Bacteria 18618
136 Ga0105238_10027216 3300009551 Bacteria 5826
137 Ga0157339_1021528 3300012505 Bacteria 689
138 Ga0157327_1028226 3300012512 Bacteria 683
139 Ga0157373_10004231 3300013100 Bacteria 10835
140 Ga0157373_10018184 3300013100 Bacteria 5119
141 Ga0157371_10000001 3300013102 Bacteria 1162285
142 Ga0157370_10008528 3300013104 Bacteria 11047
143 Ga0157370_10403969 3300013104 Bacteria 1257
144 Ga0157369_10000100 3300013105 Bacteria 118782
145 Ga0157369_10060128 3300013105 Bacteria 4098
146 Ga0157378_10240880 3300013297 Unclassified 1728
147 Ga0157378_10747615 3300013297 Bacteria 1000
148 Ga0163162_10465200 3300013306 Bacteria 1396
149 Ga0157372_10284242 3300013307 Bacteria 1924
150 Ga0157375_10002678 3300013308 Bacteria 15429
151 Ga0157380_10402195 3300014326 Bacteria 1300
152 Ga0182008_10049743 3300014497 Bacteria 2080
153 Ga0157376_10877342 3300014969 Bacteria 914
154 Ga0182006_1024123 3300015261 Bacteria 2511
155 Ga0182006_1059355 3300015261 Bacteria 1448
156 Ga0182006_1158742 3300015261 Bacteria 763
157 Ga0182007_10003645 3300015262 Bacteria 7217
158 Ga0182005_1000490 3300015265 Bacteria 20417
159 Ga0163161_10088440 3300017792 Bacteria 2290
160 Ga0213872_10015084 3300021361 Bacteria 3595
161 Ga0213872_10118779 3300021361 Bacteria 1170
162 Ga0213872_10133125 3300021361 Bacteria 1094
163 Ga0209436_100116 3300025208 Bacteria 39369
164 Ga0209436_100135 3300025208 Bacteria 36415
165 Ga0207427_100372 3300025231 Bacteria 27308
166 Ga0209437_100113 3300025233 Bacteria 211240
167 Ga0209437_102331 3300025233 Bacteria 3715
168 Ga0209258_101792 3300025242 Bacteria 6574
169 Ga0207425_1000021 3300025245 Bacteria 367537
170 Ga0207425_1000050 3300025245 Bacteria 177008
171 Ga0207425_1000063 3300025245 Bacteria 134014
172 Ga0207425_1000150 3300025245 Bacteria 59533
173 Ga0207425_1007633 3300025245 Bacteria 2834
174 Ga0209646_1000047 3300025246 Bacteria 323416
175 Ga0209026_1006080 3300025250 Bacteria 3061
176 Ga0209026_1032525 3300025250 Bacteria 771
177 Ga0209148_1000005 3300025254 Bacteria 1806504
178 Ga0209129_1000020 3300025258 Bacteria 457053
179 Ga0209129_1000240 3300025258 Bacteria 59750
180 Ga0209129_1000808 3300025258 Bacteria 19776
181 Ga0209565_1000006 3300025263 Bacteria 897294
182 Ga0209565_1000296 3300025263 Bacteria 47631
183 Ga0209565_1000303 3300025263 Bacteria 46261
184 Ga0209565_1000367 3300025263 Bacteria 38709
185 Ga0209565_1000421 3300025263 Bacteria 34378
186 Ga0209565_1000439 3300025263 Bacteria 33341
187 Ga0209565_1007902 3300025263 Bacteria 2822
188 Ga0209565_1009277 3300025263 Bacteria 2513
189 Ga0209565_1012079 3300025263 Bacteria 2074
190 Ga0209565_1014026 3300025263 Bacteria 1856
191 Ga0209565_1022865 3300025263 Bacteria 1290
192 Ga0209455_1000051 3300025272 Bacteria 369818
193 Ga0209673_1000004 3300025273 Bacteria 896155
194 Ga0209673_1001496 3300025273 Bacteria 21716
195 Ga0209673_1001877 3300025273 Bacteria 16952
196 Ga0209673_1004263 3300025273 Bacteria 7774
197 Ga0209130_1000518 3300025284 Bacteria 38858
198 Ga0209130_1000574 3300025284 Bacteria 35904
199 Ga0209130_1000951 3300025284 Bacteria 22947
200 Ga0209130_1004663 3300025284 Bacteria 5088
201 Ga0209675_1000006 3300025291 Bacteria 732267
202 Ga0209675_1000078 3300025291 Bacteria 156111
203 Ga0209675_1000268 3300025291 Bacteria 49787
204 Ga0209675_1000418 3300025291 Bacteria 34762
205 Ga0209675_1006590 3300025291 Bacteria 4624
206 Ga0209675_1063491 3300025291 Bacteria 723
207 Ga0209676_1000121 3300025292 Bacteria 198920
208 Ga0209676_1001995 3300025292 Bacteria 16152
209 Ga0209025_1000051 3300025294 Bacteria 330080
210 Ga0209025_1000660 3300025294 Bacteria 59750
211 Ga0209025_1000978 3300025294 Bacteria 42664
212 Ga0209025_1018169 3300025294 Bacteria 4010
213 Ga0209564_1000006 3300025295 Bacteria 1100927
214 Ga0209564_1000064 3300025295 Bacteria 316431
215 Ga0209564_1000133 3300025295 Bacteria 189140
216 Ga0209564_1000595 3300025295 Bacteria 56670
217 Ga0209564_1000908 3300025295 Bacteria 38758
218 Ga0209564_1001027 3300025295 Bacteria 34378
219 Ga0209564_1001062 3300025295 Bacteria 33341
220 Ga0209564_1003283 3300025295 Bacteria 11274
221 Ga0209758_1000288 3300025297 Bacteria 99096
222 Ga0209758_1000550 3300025297 Bacteria 59495
223 Ga0209758_1000596 3300025297 Bacteria 56305
224 Ga0209758_1011529 3300025297 Bacteria 5102
225 Ga0209050_1000028 3300025298 Bacteria 477133
226 Ga0209050_1000050 3300025298 Bacteria 362578
227 Ga0209050_1000261 3300025298 Bacteria 112823
228 Ga0209050_1000341 3300025298 Bacteria 92696
229 Ga0209256_1000013 3300025299 Bacteria 689442
230 Ga0209256_1000079 3300025299 Bacteria 225382
231 Ga0209256_1000179 3300025299 Bacteria 123865
232 Ga0209256_1000638 3300025299 Bacteria 47804
233 Ga0209256_1000757 3300025299 Bacteria 42054
234 Ga0209256_1021080 3300025299 Bacteria 2014
235 Ga0207426_1000506 3300025302 Bacteria 57538
236 Ga0207426_1000657 3300025302 Bacteria 42328
237 Ga0209051_1000087 3300025303 Bacteria 181248
238 Ga0209051_1040326 3300025303 Bacteria 1675
239 Ga0209257_1000075 3300025304 Bacteria 324855
240 Ga0209257_1000622 3300025304 Bacteria 57122
241 Ga0209257_1009247 3300025304 Bacteria 5335
242 Ga0207696_1000622 3300025711 Bacteria 26024
243 Ga0207696_1001317 3300025711 Bacteria 13720
244 Ga0207696_1003531 3300025711 Bacteria 7069
245 Ga0207655_1000447 3300025728 Bacteria 54492
246 Ga0207655_1004471 3300025728 Bacteria 9905
247 Ga0207655_1014426 3300025728 Bacteria 4465
248 Ga0207713_1008284 3300025735 Bacteria 6008
249 Ga0207680_10006161 3300025903 Bacteria 5786
250 Ga0207705_10137204 3300025909 Bacteria 1824
251 Ga0207705_10223464 3300025909 Bacteria 1431
252 Ga0207654_10046515 3300025911 Bacteria 2475
253 Ga0207695_10004200 3300025913 Bacteria 19788
254 Ga0207671_10001118 3300025914 Bacteria 32324
255 Ga0207662_10027622 3300025918 Bacteria 3276
256 Ga0207657_10018187 3300025919 Bacteria 6723
257 Ga0207694_10000006 3300025924 Bacteria 631109
258 Ga0207694_10000707 3300025924 Bacteria 29983
259 Ga0207650_10083927 3300025925 Bacteria 2420
260 Ga0207644_10000036 3300025931 Bacteria 128383
261 Ga0207709_10275550 3300025935 Bacteria 1240
262 Ga0207711_10002081 3300025941 Bacteria 18081
263 Ga0207711_11000920 3300025941 Bacteria 775
264 Ga0207679_10412825 3300025945 Bacteria 1190
265 Ga0207667_10001831 3300025949 Bacteria 26716
266 Ga0207667_10027997 3300025949 Bacteria 6125
267 Ga0207712_10318975 3300025961 Bacteria 1281
268 Ga0207640_10398918 3300025981 Bacteria 1120
269 Ga0207658_10104911 3300025986 Bacteria 2222
270 Ga0207677_10192871 3300026023 Bacteria 1613
271 Ga0207703_10990084 3300026035 Bacteria 806
272 Ga0207708_11222837 3300026075 Bacteria 657
273 Ga0207648_10171549 3300026089 Bacteria 1918
274 Ga0207683_10102528 3300026121 Bacteria 2555
275 Ga0207698_10004561 3300026142 Bacteria 8453
276 Ga0209281_1000257 3300027111 Bacteria 103090
277 Ga0209389_1000089 3300027296 Bacteria 83505
278 Ga0209371_1000015 3300027312 Bacteria 659640
279 Ga0209371_1000078 3300027312 Bacteria 190779
280 Ga0209371_1000466 3300027312 Bacteria 39817
281 Ga0209589_1000148 3300027357 Bacteria 77222
282 Ga0209489_100512 3300027361 Bacteria 72878
283 Ga0207428_10289982 3300027907 Bacteria 1213
284 Ga0268266_10001076 3300028379 Bacteria 34200
285 Ga0268265_10002115 3300028380 Bacteria 15403
286 Ga0265334_10000027 3300028573 Bacteria 116133
287 Ga0265323_10086967 3300028653 Bacteria 1049
288 Ga0307515_10112647 3300028794 Bacteria 3163
289 Ga0265324_10011133 3300029957 Bacteria 3439
290 Ga0268256_1000018 3300030500 Bacteria 594572
291 Ga0268256_1000298 3300030500 Bacteria 49771
292 Ga0268256_1000423 3300030500 Bacteria 38191
293 Ga0265328_10011567 3300031239 Bacteria 3521
294 Ga0265328_10069420 3300031239 Bacteria 1295
295 Ga0265340_10272824 3300031247 Unclassified 752
296 Ga0265331_10000390 3300031250 Bacteria 45388
297 Ga0265331_10028041 3300031250 Bacteria 2818
298 Ga0265327_10000271 3300031251 Bacteria 102433
299 Ga0265327_10000859 3300031251 Bacteria 45360
300 Ga0265327_10001921 3300031251 Bacteria 23986
301 Ga0265316_10017747 3300031344 Bacteria 6138
302 Ga0307513_10155047 3300031456 Bacteria 2192
303 Ga0307408_100000382 3300031548 Bacteria 40475
304 Ga0307408_100001644 3300031548 Bacteria 16490
305 Ga0307408_100012140 3300031548 Bacteria 5702
306 Ga0307408_100102955 3300031548 Bacteria 2178
307 Ga0265314_10011583 3300031711 Bacteria 7264
308 Ga0265342_10011685 3300031712 Bacteria 5990
309 Ga0316576_10000167 3300031727 Bacteria 26731
310 Ga0316576_10059338 3300031727 Bacteria 2800
311 Ga0316576_10108598 3300031727 Bacteria 2079
312 Ga0316577_10061940 3300031733 Unclassified 2089
313 Ga0316577_10261561 3300031733 Bacteria 979
314 Ga0316577_10305616 3300031733 Bacteria 901
315 Ga0307518_10017110 3300031838 Bacteria 5201
316 Ga0307406_10288850 3300031901 Bacteria 1254
317 Ga0307412_10007201 3300031911 Bacteria 6314
318 Ga0307412_10023225 3300031911 Bacteria 3812
319 Ga0307412_10673466 3300031911 Bacteria 885
320 Ga0307416_100001464 3300032002 Bacteria 12860
321 Ga0307414_10318310 3300032004 Bacteria 1323
322 Ga0316574_0620269 3300035398 Unclassified 667
323 Ga0373937_0036524 3300036401 Bacteria 4478
324 Ga0316582_0067624 3300036647 Bacteria 2306
325 Ga0316582_0133104 3300036647 Bacteria 1672
326 Ga0316584_0047120 3300036712 Bacteria 3219
327 Ga0316584_0253886 3300036712 Bacteria 1284
328 Ga0316584_0598884 3300036712 Bacteria 765
329 Ga0395905_0036982 3300037471 Bacteria 4586
330 Ga0400483_101867 3300039062 Bacteria 1312
331 Ga0400483_176576 3300039062 Bacteria 1232
332 Ga0400483_284223 3300039062 Bacteria 1360
333 Ga0436361_0116812 3300039447 Bacteria 2976
334 Ga0436361_0131464 3300039447 Bacteria 793
335 Ga0436361_0148311 3300039447 Bacteria 30874
336 Ga0436361_0391517 3300039447 Bacteria 4189
337 Ga0436361_0465833 3300039447 Bacteria 7683
338 Ga0436361_0933837 3300039447 Bacteria 1779
339 Ga0436361_1029999 3300039447 Bacteria 1178
340 Ga0439438_000880 3300041405 Bacteria 13363
341 Ga0439438_012055 3300041405 Bacteria 2665
342 Ga0439432_000808 3300042006 Bacteria 11686
343 Ga0439432_024351 3300042006 Bacteria 1990
344 Ga0439452_000010 3300042010 Bacteria 459139
345 Ga0439452_000020 3300042010 Bacteria 309345
346 Ga0439452_001209 3300042010 Bacteria 11045
347 Ga0450904_000137 3300042139 Bacteria 16248
348 Ga0450901_000885 3300042533 Bacteria 3506
349 Ga0451577_0000298 3300042876 Bacteria 96541
350 Ga0451577_0000767 3300042876 Bacteria 48562
351 Ga0451577_0333427 3300042876 Bacteria 1376
352 Ga0451577_0473622 3300042876 Bacteria 1137
353 Ga0451577_0637905 3300042876 Bacteria 966
354 Ga0466961_0008258 3300044693 Bacteria 6632
355 Ga0453684_0000076 3300044712 Bacteria 437513
356 Ga0453684_0000194 3300044712 Bacteria 265783
357 Ga0453684_0000273 3300044712 Bacteria 222658
358 Ga0453684_0086174 3300044712 Unclassified 3899
359 Ga0453684_0099325 3300044712 Bacteria 3565
360 Ga0453684_0130664 3300044712 Bacteria 3013
361 Ga0453684_0426102 3300044712 Bacteria 1481
362 Ga0466960_0003091 3300044901 Bacteria 6370
363 Ga0451576_0037228 3300045051 Bacteria 5154
364 Ga0451576_0996313 3300045051 Bacteria 878
365 Ga0495617_017943 3300046452 Bacteria 2392
366 Ga0495617_095509 3300046452 Bacteria 968
367 Ga0495590_0011333 3300046457 Bacteria 3335
368 Ga0495638_0000602 3300046460 Bacteria 40434
369 Ga0495638_0110711 3300046460 Bacteria 1631
370 Ga0495653_0000297 3300046463 Bacteria 40421
371 Ga0495653_0001050 3300046463 Bacteria 21257
372 Ga0495653_0006111 3300046463 Bacteria 9871
373 Ga0495650_0000047 3300046471 Bacteria 335136
374 Ga0495650_0000454 3300046471 Bacteria 64731
375 Ga0495650_0001240 3300046471 Bacteria 26517
376 Ga0495580_0477808 3300046472 Bacteria 834
377 Ga0495605_0000015 3300046474 Bacteria 300227
378 Ga0495605_0020206 3300046474 Bacteria 3542
379 Ga0495605_0080460 3300046474 Bacteria 1525
380 Ga0495584_0000106 3300046491 Bacteria 57044
381 Ga0495584_0010772 3300046491 Bacteria 4694
382 Ga0495584_0017917 3300046491 Bacteria 3602
383 Ga0495584_0068312 3300046491 Bacteria 1785
384 Ga0495585_0005034 3300046492 Bacteria 8428
385 Ga0495585_0026369 3300046492 Bacteria 3318
386 Ga0495585_0029149 3300046492 Bacteria 3143
387 Ga0495585_0260209 3300046492 Bacteria 863
388 Ga0495596_0000075 3300046500 Bacteria 69681
389 Ga0495607_0001974 3300046501 Bacteria 17288
390 Ga0495607_0019971 3300046501 Bacteria 4243
391 Ga0495607_0027201 3300046501 Bacteria 3540
392 Ga0495607_0260646 3300046501 Bacteria 830
393 Ga0495583_0000727 3300046506 Bacteria 41970
394 Ga0495606_0000133 3300046507 Bacteria 126345
395 Ga0495606_0000690 3300046507 Bacteria 52411
396 Ga0495606_0003233 3300046507 Bacteria 17517
397 Ga0495606_0074951 3300046507 Bacteria 2118
398 Ga0495606_0108121 3300046507 Bacteria 1681
399 Ga0495610_0004101 3300046512 Bacteria 10907
400 Ga0495610_0015140 3300046512 Bacteria 4496
401 Ga0495610_0069200 3300046512 Bacteria 1652
402 Ga0495616_0001327 3300046513 Bacteria 17284
403 Ga0495616_0001422 3300046513 Bacteria 16666
404 Ga0495616_0002054 3300046513 Bacteria 13532
405 Ga0495616_0066472 3300046513 Bacteria 1754
406 Ga0495620_0042498 3300046515 Bacteria 1985
407 Ga0495630_0003242 3300046517 Bacteria 11337
408 Ga0495631_0091706 3300046518 Bacteria 1308
409 Ga0495632_0000110 3300046519 Bacteria 84473
410 Ga0495632_0206447 3300046519 Bacteria 892
411 Ga0495632_0245006 3300046519 Bacteria 805
412 Ga0495637_0001219 3300046520 Bacteria 15608
413 Ga0495637_0018102 3300046520 Bacteria 3271
414 Ga0495637_0024441 3300046520 Bacteria 2734
415 Ga0495643_0000224 3300046522 Bacteria 86728
416 Ga0495643_0033850 3300046522 Bacteria 2822
417 Ga0495643_0196343 3300046522 Bacteria 971
418 Ga0495643_0221470 3300046522 Bacteria 897
419 Ga0495644_0000644 3300046523 Bacteria 14598
420 Ga0495644_0022013 3300046523 Bacteria 2430
421 Ga0495648_0039789 3300046524 Bacteria 2987
422 Ga0495648_0041962 3300046524 Bacteria 2883
423 Ga0495648_0062976 3300046524 Bacteria 2193
424 Ga0495648_0074348 3300046524 Bacteria 1958
425 Ga0495642_0000867 3300046528 Bacteria 14308
426 Ga0495642_0020231 3300046528 Bacteria 2613
427 Ga0495654_0003263 3300046530 Bacteria 10009
428 Ga0495654_0082561 3300046530 Bacteria 1503
429 Ga0495654_0178286 3300046530 Bacteria 922
430 Ga0495654_0217704 3300046530 Bacteria 809
431 Ga0495665_0265412 3300046531 Bacteria 882
432 Ga0495587_0000722 3300046536 Bacteria 22074
433 Ga0495609_0000839 3300046538 Bacteria 22790
434 Ga0495609_0015559 3300046538 Bacteria 3559
435 Ga0495609_0188378 3300046538 Bacteria 866
436 Ga0495597_0001012 3300046542 Bacteria 21546
437 Ga0495597_0001132 3300046542 Bacteria 20140
438 Ga0495597_0021121 3300046542 Bacteria 3027
439 Ga0495633_0001115 3300046558 Bacteria 21587
440 Ga0495633_0002441 3300046558 Bacteria 13143
441 Ga0495633_0006317 3300046558 Bacteria 7056
442 Ga0495633_0012440 3300046558 Bacteria 4527
443 Ga0495656_0006569 3300046615 Bacteria 4086
444 Ga0495668_0000049 3300046616 Bacteria 217657
445 Ga0495668_0000195 3300046616 Bacteria 89153
446 Ga0495668_0002168 3300046616 Bacteria 16840
447 Ga0495668_0108303 3300046616 Bacteria 1520
448 Ga0495634_0001237 3300046642 Bacteria 23496
449 Ga0495611_0003498 3300046648 Bacteria 6913
450 Ga0495625_0013500 3300046660 Bacteria 6561
451 Ga0495625_0072900 3300046660 Bacteria 2408
452 Ga0495625_0113205 3300046660 Bacteria 1853
453 Ga0495625_0348631 3300046660 Bacteria 936
454 Ga0495625_0539372 3300046660 Bacteria 708
455 Ga0495635_0000601 3300046663 Bacteria 23181
456 Ga0495661_0000247 3300046665 Bacteria 62371
457 Ga0495661_0008159 3300046665 Bacteria 7261
458 Ga0495661_0017506 3300046665 Bacteria 4731
459 Ga0495661_0018648 3300046665 Bacteria 4557
460 Ga0495661_0055762 3300046665 Bacteria 2367
461 Ga0495661_0232153 3300046665 Bacteria 951
462 Ga0495646_0000419 3300046680 Bacteria 22476
463 Ga0495670_0000159 3300046691 Bacteria 29368
464 Ga0495670_0001755 3300046691 Bacteria 10647
465 Ga0495670_0010456 3300046691 Bacteria 4559
466 Ga0495671_0000044 3300046692 Bacteria 160337
467 Ga0495671_0031910 3300046692 Bacteria 2691
468 Ga0495671_0184178 3300046692 Bacteria 1014
469 Ga0495649_0000543 3300046694 Bacteria 31982
470 Ga0495649_0001315 3300046694 Bacteria 18963
471 Ga0495649_0092158 3300046694 Bacteria 1614
472 Ga0495589_0011893 3300046794 Bacteria 4513
473 Ga0495589_0044644 3300046794 Bacteria 2203
474 Ga0495660_0000292 3300046810 Bacteria 46230
475 Ga0495636_0341998 3300047318 Bacteria 705
476 Ga0495674_0728656 3300047319 Bacteria 776
477 Ga0495672_0007968 3300047320 Bacteria 7897
478 Ga0495672_0011711 3300047320 Bacteria 6168
479 Ga0495672_0012969 3300047320 Bacteria 5774
480 Ga0495683_0059666 3300047323 Bacteria 1892
481 Ga0495683_0147651 3300047323 Bacteria 1097
482 Ga0495683_0213387 3300047323 Bacteria 864
483 Ga0495677_0071044 3300047445 Bacteria 1297
484 Ga0495677_0081401 3300047445 Bacteria 1214
485 Ga0495679_057548 3300047446 Bacteria 1149
486 Ga0495673_0000027 3300047469 Bacteria 475440
487 Ga0495673_0000037 3300047469 Bacteria 307717
488 Ga0495673_0000060 3300047469 Bacteria 231642
489 Ga0495673_0064743 3300047469 Bacteria 1553
490 Ga0495681_0002215 3300047470 Bacteria 13999
491 Ga0495681_0029353 3300047470 Bacteria 2815
492 Ga0495681_0161542 3300047470 Bacteria 932
493 Ga0495593_0000538 3300047673 Bacteria 21496
494 Ga0495602_0208813 3300048088 Bacteria 1484
495 Ga0495626_0000219 3300048091 Bacteria 67675
496 Ga0495626_0000323 3300048091 Bacteria 50382
497 Ga0495626_0001681 3300048091 Bacteria 17049
498 Ga0496100_0159668 3300048903 Bacteria 1615
499 Ga0496100_0643504 3300048903 Bacteria 825
500 Ga0496101_0021648 3300048904 Bacteria 4418
501 Ga0496101_0245295 3300048904 Bacteria 1394
502 Ga0496102_0000957 3300048905 Bacteria 27212
503 Ga0496102_0923945 3300048905 Bacteria 794
504 Ga0496103_0001518 3300048906 Bacteria 15506
505 Ga0496107_0460361 3300048910 Bacteria 944
506 Ga0496110_0913414 3300048913 Bacteria 784
507 Ga0496111_0201599 3300048914 Bacteria 1479
508 Ga0496115_0080054 3300048918 Bacteria 2660
509 Ga0496116_0000140 3300048919 Bacteria 151165
510 Ga0496116_0004269 3300048919 Bacteria 13703
511 Ga0496116_0007765 3300048919 Bacteria 9432
512 Ga0496116_0009769 3300048919 Bacteria 8139
513 Ga0496116_0019322 3300048919 Bacteria 5219
514 Ga0496116_0104302 3300048919 Bacteria 1685
515 Ga0496116_0121166 3300048919 Bacteria 1513
516 Ga0496117_0000380 3300048920 Bacteria 76671
517 Ga0496117_0000835 3300048920 Bacteria 47629
518 Ga0496117_0003351 3300048920 Bacteria 18701
519 Ga0496117_0004348 3300048920 Bacteria 15721
520 Ga0496117_0004433 3300048920 Bacteria 15490
521 Ga0496117_0005867 3300048920 Bacteria 12696
522 Ga0496117_0005935 3300048920 Bacteria 12596
523 Ga0496117_0006377 3300048920 Bacteria 11984
524 Ga0496117_0043933 3300048920 Bacteria 3241
525 Ga0496118_0001914 3300048921 Bacteria 29615
526 Ga0496118_0004249 3300048921 Bacteria 17156
527 Ga0496118_0005490 3300048921 Bacteria 14390
528 Ga0496118_0006703 3300048921 Bacteria 12547
529 Ga0496118_0008693 3300048921 Bacteria 10438
530 Ga0496118_0025440 3300048921 Bacteria 5076
531 Ga0496118_0067890 3300048921 Bacteria 2592
532 Ga0496119_0000049 3300048922 Bacteria 185482
533 Ga0496119_0002907 3300048922 Bacteria 18273
534 Ga0496119_0036248 3300048922 Bacteria 3222
535 Ga0496119_0043332 3300048922 Bacteria 2844
536 Ga0496120_0000048 3300048923 Bacteria 187988
537 Ga0496120_0001489 3300048923 Bacteria 27770
538 Ga0496120_0015723 3300048923 Bacteria 4976
539 Ga0496121_0001226 3300048924 Bacteria 44634
540 Ga0496121_0002208 3300048924 Bacteria 30406
541 Ga0496121_0004821 3300048924 Bacteria 17759
542 Ga0496121_0006644 3300048924 Bacteria 14238
543 Ga0496121_0008356 3300048924 Bacteria 12216
544 Ga0496121_0011405 3300048924 Bacteria 9874
545 Ga0496121_0046061 3300048924 Bacteria 3737
546 Ga0496121_0103724 3300048924 Bacteria 2187
547 Ga0496121_0104952 3300048924 Bacteria 2169
548 Ga0496121_0210246 3300048924 Unclassified 1379
549 Ga0496121_0391699 3300048924 Bacteria 913
550 Ga0496122_0000003 3300048925 Bacteria 645810
551 Ga0496122_0000962 3300048925 Bacteria 51794
552 Ga0496122_0003434 3300048925 Bacteria 20839
553 Ga0496122_0004542 3300048925 Bacteria 17111
554 Ga0496122_0005242 3300048925 Bacteria 15541
555 Ga0496122_0025381 3300048925 Bacteria 5147
556 Ga0496122_0076395 3300048925 Bacteria 2357
557 Ga0496122_0091382 3300048925 Bacteria 2072
558 Ga0496123_0000012 3300048926 Bacteria 458760
559 Ga0496123_0000750 3300048926 Bacteria 52534
560 Ga0496123_0004279 3300048926 Bacteria 15190
561 Ga0496123_0005350 3300048926 Bacteria 12971
562 Ga0496123_0032775 3300048926 Bacteria 3752
563 Ga0496123_0082149 3300048926 Bacteria 1954
564 Ga0496124_0000285 3300048927 Bacteria 95893
565 Ga0496124_0001456 3300048927 Bacteria 34913
566 Ga0496124_0003860 3300048927 Bacteria 17927
567 Ga0496124_0008956 3300048927 Bacteria 10366
568 Ga0496124_0017901 3300048927 Bacteria 6659
569 Ga0496124_0134991 3300048927 Bacteria 1954
570 Ga0496124_0136704 3300048927 Bacteria 1939
571 Ga0496124_0176862 3300048927 Bacteria 1646
572 Ga0496124_0451558 3300048927 Bacteria 876
573 Ga0496125_0009915 3300048928 Bacteria 9686
574 Ga0496125_0039443 3300048928 Bacteria 4066
575 Ga0496125_0058546 3300048928 Bacteria 3112
576 Ga0496126_0005419 3300048929 Bacteria 14555
577 Ga0496126_0009234 3300048929 Bacteria 10513
578 Ga0496126_0013264 3300048929 Bacteria 8397
579 Ga0496126_0014419 3300048929 Bacteria 7990
580 Ga0496126_0038851 3300048929 Bacteria 4424
581 Ga0496126_0041628 3300048929 Bacteria 4249
582 Ga0496126_0148827 3300048929 Bacteria 2008
583 Ga0495678_000001 3300049459 Bacteria 1060340
584 Ga0495678_006341 3300049459 Bacteria 6306
585 Ga0495678_029233 3300049459 Bacteria 2316
586 Ga0495678_065338 3300049459 Bacteria 1351
587 Ga0495682_0000095 3300049460 Bacteria 77918
588 Ga0495682_0000466 3300049460 Bacteria 27939
589 Ga0495682_0040591 3300049460 Bacteria 1706
590 Ga0501031_0054787 3300049568 Bacteria 2598
591 Ga0501032_0034032 3300049569 Bacteria 3489
592 Ga0501034_0007417 3300049571 Bacteria 11673
593 Ga0501038_0110693 3300049574 Bacteria 2275
594 Ga0501039_0008456 3300049575 Bacteria 7843
595 Ga0501039_0193783 3300049575 Bacteria 1598
596 Ga0501039_0345758 3300049575 Bacteria 1169
597 Ga0501046_0515599 3300049580 Bacteria 855
598 Ga0501072_0546629 3300049588 Bacteria 915
599 Ga0501222_004695 3300049662 Bacteria 1857
600 Ga0501227_003043 3300049665 Bacteria 3652
601 Ga0501240_010647 3300049673 Bacteria 1225
602 Ga0501269_002758 3300049766 Bacteria 2142
603 Ga0501035_0022923 3300049822 Bacteria 5732
604 Ga0501035_0088603 3300049822 Bacteria 2727
605 Ga0501044_0017297 3300049823 Bacteria 7734
606 Ga0501044_0979779 3300049823 Bacteria 718
607 nmdc:mga03683_155124_c1 3300050489 Bacteria 1035
608 nmdc:mga03n38_130203_c1 3300050490 Bacteria 1246
609 nmdc:mga0k408_11886_c1 3300050493 Bacteria 4749
610 nmdc:mga0k408_18577_c1 3300050493 Bacteria 3882
611 nmdc:mga0k408_7548_c1 3300050493 Bacteria 5809
612 nmdc:mga07m45_401221_c1 3300050496 Bacteria 796
613 nmdc:mga09592_507121_c1 3300050508 Bacteria 1038
614 nmdc:mga0rr50_13151_c1 3300050513 Bacteria 5377
615 nmdc:mga0a205_13912_c1 3300050515 Bacteria 7502
616 nmdc:mga0sz30_241236_c1 3300050516 Bacteria 804
617 Ga0500618_000576 3300053125 Bacteria 22679
618 Ga0500586_000070 3300053145 Bacteria 17457
619 Ga0500622_0323627 3300053156 Bacteria 649
620 Ga0500624_000361 3300053157 Bacteria 14695
621 Ga0500625_058052 3300053729 Bacteria 1766
622 Ga0590075_013549 3300059424 Bacteria 1990
623 Ga0501082_0862584 3300060353 Bacteria 792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10465200 Ga0163162_104652002 164
2 3300048919 Ga0496116_0121166 Ga0496116_0121166_1008_1502 164
3 3300048925 Ga0496122_0004542 Ga0496122_0004542_16360_16854 164
4 3300003320 rootH2_10028477 rootH2_100284778 169
5 3300036647 Ga0316582_0067624 Ga0316582_0067624_1780_2295 169
6 3300049588 Ga0501072_0546629 Ga0501072_0546629_230_769 170
7 3300060353 Ga0501082_0862584 Ga0501082_0862584_110_649 170
8 3300046538 Ga0495609_0188378 Ga0495609_0188378_11_529 171
9 3300013105 Ga0157369_10060128 Ga0157369_100601282 173
10 3300025919 Ga0207657_10018187 Ga0207657_100181876 173
11 3300031727 Ga0316576_10059338 Ga0316576_100593382 174
12 iso_pu_bacteria 2602042066 2603699165 174
13 iso_pu_bacteria 2765235842 2765589826 174
14 iso_pu_bacteria 2848297114 2848299294 174
15 iso_pu_bacteria 2908669403 2908672277 174
16 iso_pu_bacteria 2919497567 2919501242 174
17 iso_pu_bacteria 2935625433 2935625956 174
18 iso_pu_bacteria 8018221730 8018225279 174
19 iso_pu_bacteria 8018405270 8018409442 174
20 3300009036 Ga0105244_10287233 Ga0105244_102872331 176
21 3300048922 Ga0496119_0002907 Ga0496119_0002907_12541_13077 176
22 3300048923 Ga0496120_0000048 Ga0496120_0000048_67704_68240 176
23 iso_pu_bacteria 2842733646 2842737396 176
24 3300048924 Ga0496121_0008356 Ga0496121_0008356_11606_12142 177
25 3300048928 Ga0496125_0058546 Ga0496125_0058546_1570_2106 177
26 iso_pu_bacteria 2511231021 2511359388 177
27 iso_pu_bacteria 2511231156 2511822286 177
28 iso_pu_bacteria 2526164512 2526211329 177
29 iso_pu_bacteria 2582581304 2585255670 177
30 iso_pu_bacteria 2599185212 2599613127 177
31 iso_pu_bacteria 2599185248 2599769236 177
32 iso_pu_bacteria 2599185289 2599888480 177
33 iso_pu_bacteria 2599185291 2599900272 177
34 iso_pu_bacteria 2599185302 2599943783 177
35 iso_pu_bacteria 2599185304 2599956186 177
36 iso_pu_bacteria 2599185305 2599961714 177
37 iso_pu_bacteria 2599185306 2599965871 177
38 iso_pu_bacteria 2599185308 2599977511 177
39 iso_pu_bacteria 2599185309 2599984968 177
40 iso_pu_bacteria 2599185310 2599990968 177
41 iso_pu_bacteria 2599185311 2599996141 177
42 iso_pu_bacteria 2599185312 2600002106 177
43 iso_pu_bacteria 2599185313 2600004689 177
44 iso_pu_bacteria 2599185314 2600011636 177
45 iso_pu_bacteria 2599185315 2600018814 177
46 iso_pu_bacteria 2599185316 2600024552 177
47 iso_pu_bacteria 2599185318 2600034846 177
48 iso_pu_bacteria 2599185319 2600043075 177
49 iso_pu_bacteria 2599185320 2600047905 177
50 iso_pu_bacteria 2599185321 2600055692 177
51 iso_pu_bacteria 2599185322 2600060215 177
52 iso_pu_bacteria 2599185323 2600065874 177
53 iso_pu_bacteria 2599185325 2600079161 177
54 iso_pu_bacteria 2643221638 2644216670 177
55 iso_pu_bacteria 2643221650 2644282736 177
56 iso_pu_bacteria 2667528170 2671092606 177
57 iso_pu_bacteria 2675903515 2678260808 177
58 iso_pu_bacteria 2738541293 2738801580 177
59 iso_pu_bacteria 2739367655 2739611399 177
60 iso_pu_bacteria 2744054620 2745006124 177
61 iso_pu_bacteria 2808606361 2808857863 177
62 iso_pu_bacteria 2808606376 2808923848 177
63 iso_pu_bacteria 2808606378 2808938059 177
64 iso_pu_bacteria 2808606380 2808945767 177
65 iso_pu_bacteria 2808606383 2808966312 177
66 iso_pu_bacteria 2808606389 2809001239 177
67 iso_pu_bacteria 2821131069 2821134106 177
68 iso_pu_bacteria 2825651385 2825654434 177
69 iso_pu_bacteria 2842711865 2842711924 177
70 iso_pu_bacteria 2857553236 2857555735 177
71 iso_pu_bacteria 2857558681 2857561199 177
72 iso_pu_bacteria 2913036834 2913037120 177
73 iso_pu_bacteria 2919456309 2919461965 177
74 iso_pu_bacteria 2929144301 2929144635 177
75 iso_pu_bacteria 2931369376 2931372011 177
76 iso_pu_bacteria 2939607340 2939609592 177
77 iso_pu_bacteria 2945945610 2945949938 177
78 iso_pu_bacteria 2974310843 2974311298 177
79 iso_pu_bacteria 2988728565 2988732046 177
80 iso_pu_bacteria 2990710928 2990714238 177
81 iso_pu_bacteria 3007866637 3007870755 177
82 iso_pu_bacteria 8011350971 8011351704 177
83 3300002737 JGI25162J39368_1000398 JGI25162J39368_10003988 178
84 3300003762 Ga0055542_1000069 Ga0055542_100006929 178
85 3300005331 Ga0070670_100032783 Ga0070670_1000327833 178
86 3300005337 Ga0070682_100000795 Ga0070682_1000007958 178
87 3300005338 Ga0068868_100215876 Ga0068868_1002158762 178
88 3300005339 Ga0070660_100222944 Ga0070660_1002229442 178
89 3300005355 Ga0070671_100948049 Ga0070671_1009480492 178
90 3300005459 Ga0068867_100269682 Ga0068867_1002696822 178
91 3300005539 Ga0068853_100142053 Ga0068853_1001420532 178
92 3300005563 Ga0068855_101338699 Ga0068855_1013386992 178
93 3300005564 Ga0070664_100394565 Ga0070664_1003945652 178
94 3300005578 Ga0068854_100449288 Ga0068854_1004492882 178
95 3300005618 Ga0068864_100205820 Ga0068864_1002058202 178
96 3300006051 Ga0075364_10663066 Ga0075364_106630662 178
97 3300009092 Ga0105250_10002475 Ga0105250_100024755 178
98 3300009174 Ga0105241_10002877 Ga0105241_100028775 178
99 3300009177 Ga0105248_10537975 Ga0105248_105379752 178
100 3300009545 Ga0105237_10025046 Ga0105237_100250463 178
101 3300009551 Ga0105238_10027216 Ga0105238_100272162 178
102 3300012512 Ga0157327_1028226 Ga0157327_10282262 178
103 3300013105 Ga0157369_10000100 Ga0157369_1000010083 178
104 3300013307 Ga0157372_10284242 Ga0157372_102842422 178
105 3300025231 Ga0207427_100372 Ga0207427_1003727 178
106 3300025233 Ga0209437_100113 Ga0209437_10011331 178
107 3300025242 Ga0209258_101792 Ga0209258_1017923 178
108 3300025254 Ga0209148_1000005 Ga0209148_10000051442 178
109 3300025711 Ga0207696_1001317 Ga0207696_10013179 178
110 3300025909 Ga0207705_10137204 Ga0207705_101372042 178
111 3300025909 Ga0207705_10223464 Ga0207705_102234642 178
112 3300025911 Ga0207654_10046515 Ga0207654_100465153 178
113 3300025913 Ga0207695_10004200 Ga0207695_100042005 178
114 3300025914 Ga0207671_10001118 Ga0207671_1000111820 178
115 3300025924 Ga0207694_10000707 Ga0207694_1000070723 178
116 3300025925 Ga0207650_10083927 Ga0207650_100839273 178
117 3300025941 Ga0207711_11000920 Ga0207711_110009202 178
118 3300025945 Ga0207679_10412825 Ga0207679_104128252 178
119 3300025961 Ga0207712_10318975 Ga0207712_103189752 178
120 3300025981 Ga0207640_10398918 Ga0207640_103989182 178
121 3300025986 Ga0207658_10104911 Ga0207658_101049113 178
122 3300026023 Ga0207677_10192871 Ga0207677_101928712 178
123 3300026089 Ga0207648_10171549 Ga0207648_101715492 178
124 3300026121 Ga0207683_10102528 Ga0207683_101025282 178
125 3300048920 Ga0496117_0000380 Ga0496117_0000380_56657_57193 178
126 3300048920 Ga0496117_0000835 Ga0496117_0000835_46767_47303 178
127 3300048921 Ga0496118_0001914 Ga0496118_0001914_10403_10939 178
128 3300048924 Ga0496121_0002208 Ga0496121_0002208_18054_18590 178
129 3300048924 Ga0496121_0004821 Ga0496121_0004821_3395_3931 178
130 3300048924 Ga0496121_0011405 Ga0496121_0011405_6609_7145 178
131 3300048929 Ga0496126_0013264 Ga0496126_0013264_6692_7228 178
132 3300048929 Ga0496126_0014419 Ga0496126_0014419_7012_7548 178
133 3300053157 Ga0500624_000361 Ga0500624_000361_9059_9625 178
134 iso_pu_bacteria 2602042046 2603637065 178
135 iso_pu_bacteria 2811995292 2813728075 178
136 iso_pu_bacteria 2814123068 2814695630 178
137 iso_pu_bacteria 2847085930 2847086776 178
138 iso_pu_bacteria 2857576091 2857577826 178
139 iso_pu_bacteria 2919155634 2919158984 178
140 iso_pu_bacteria 2939617950 2939618294 178
141 iso_pu_bacteria 8019504834 8019505369 178
142 iso_pu_bacteria 8055087960 8055091549 178
143 iso_pu_bacteria 8055092621 8055096326 178
144 3300003856 Ga0058692_1001598 Ga0058692_100159810 179
145 3300005331 Ga0070670_100576979 Ga0070670_1005769792 179
146 3300005543 Ga0070672_100538345 Ga0070672_1005383452 179
147 3300005547 Ga0070693_100001806 Ga0070693_1000018065 179
148 3300009092 Ga0105250_10001034 Ga0105250_100010345 179
149 3300013297 Ga0157378_10240880 Ga0157378_102408803 179
150 3300025711 Ga0207696_1000622 Ga0207696_10006227 179
151 3300027312 Ga0209371_1000466 Ga0209371_100046621 179
152 3300028653 Ga0265323_10086967 Ga0265323_100869672 179
153 3300030500 Ga0268256_1000423 Ga0268256_100042316 179
154 3300031247 Ga0265340_10272824 Ga0265340_102728242 179
155 3300031344 Ga0265316_10017747 Ga0265316_100177475 179
156 3300031712 Ga0265342_10011685 Ga0265342_100116853 179
157 3300031733 Ga0316577_10061940 Ga0316577_100619402 179
158 3300036647 Ga0316582_0133104 Ga0316582_0133104_616_1179 179
159 3300036712 Ga0316584_0253886 Ga0316584_0253886_414_977 179
160 3300042876 Ga0451577_0000298 Ga0451577_0000298_42626_43174 179
161 3300042876 Ga0451577_0000767 Ga0451577_0000767_8669_9217 179
162 3300044712 Ga0453684_0000076 Ga0453684_0000076_236440_236988 179
163 3300044712 Ga0453684_0000194 Ga0453684_0000194_17368_17916 179
164 3300044712 Ga0453684_0086174 Ga0453684_0086174_1850_2395 179
165 3300044712 Ga0453684_0426102 Ga0453684_0426102_64_636 179
166 3300047320 Ga0495672_0011711 Ga0495672_0011711_3577_4182 179
167 3300048924 Ga0496121_0006644 Ga0496121_0006644_7506_8048 179
168 3300048927 Ga0496124_0008956 Ga0496124_0008956_2332_2874 179
169 3300005343 Ga0070687_100009410 Ga0070687_1000094102 180
170 3300005354 Ga0070675_100278573 Ga0070675_1002785732 180
171 3300005438 Ga0070701_10385638 Ga0070701_103856381 180
172 3300005471 Ga0070698_100263494 Ga0070698_1002634941 180
173 3300005544 Ga0070686_100049493 Ga0070686_1000494933 180
174 3300005549 Ga0070704_100248249 Ga0070704_1002482492 180
175 3300005563 Ga0068855_100000144 Ga0068855_10000014488 180
176 3300005616 Ga0068852_100006976 Ga0068852_1000069767 180
177 3300005844 Ga0068862_100772574 Ga0068862_1007725742 180
178 3300006177 Ga0075362_10158592 Ga0075362_101585922 180
179 3300006195 Ga0075366_10018405 Ga0075366_100184053 180
180 3300006353 Ga0075370_10040275 Ga0075370_100402752 180
181 3300007076 Ga0075435_100305428 Ga0075435_1003054282 180
182 3300009036 Ga0105244_10010873 Ga0105244_100108736 180
183 3300009551 Ga0105238_10002448 Ga0105238_1000244810 180
184 3300013297 Ga0157378_10747615 Ga0157378_107476152 180
185 3300021361 Ga0213872_10118779 Ga0213872_101187792 180
186 3300025711 Ga0207696_1003531 Ga0207696_10035312 180
187 3300025728 Ga0207655_1004471 Ga0207655_100447110 180
188 3300025735 Ga0207713_1008284 Ga0207713_10082846 180
189 3300025918 Ga0207662_10027622 Ga0207662_100276222 180
190 3300025924 Ga0207694_10000006 Ga0207694_10000006644 180
191 3300025949 Ga0207667_10001831 Ga0207667_1000183115 180
192 3300026035 Ga0207703_10990084 Ga0207703_109900841 180
193 3300026075 Ga0207708_11222837 Ga0207708_112228371 180
194 3300026142 Ga0207698_10004561 Ga0207698_100045613 180
195 3300028573 Ga0265334_10000027 Ga0265334_1000002756 180
196 3300031456 Ga0307513_10155047 Ga0307513_101550473 180
197 3300031727 Ga0316576_10000167 Ga0316576_1000016710 180
198 3300031727 Ga0316576_10108598 Ga0316576_101085983 180
199 3300031733 Ga0316577_10261561 Ga0316577_102615612 180
200 3300031733 Ga0316577_10305616 Ga0316577_103056161 180
201 3300031911 Ga0307412_10673466 Ga0307412_106734662 180
202 3300035398 Ga0316574_0620269 Ga0316574_0620269_45_608 180
203 3300036401 Ga0373937_0036524 Ga0373937_0036524_745_1287 180
204 3300036712 Ga0316584_0047120 Ga0316584_0047120_2263_2811 180
205 3300036712 Ga0316584_0598884 Ga0316584_0598884_20_568 180
206 3300039447 Ga0436361_0131464 Ga0436361_0131464_220_771 180
207 3300039447 Ga0436361_1029999 Ga0436361_1029999_559_1107 180
208 3300042876 Ga0451577_0333427 Ga0451577_0333427_661_1209 180
209 3300042876 Ga0451577_0473622 Ga0451577_0473622_333_878 180
210 3300042876 Ga0451577_0637905 Ga0451577_0637905_203_778 180
211 3300044712 Ga0453684_0130664 Ga0453684_0130664_1818_2366 180
212 3300045051 Ga0451576_0037228 Ga0451576_0037228_4583_5125 180
213 3300045051 Ga0451576_0996313 Ga0451576_0996313_254_805 180
214 3300046472 Ga0495580_0477808 Ga0495580_0477808_216_758 180
215 3300046492 Ga0495585_0029149 Ga0495585_0029149_919_1467 180
216 3300046530 Ga0495654_0178286 Ga0495654_0178286_59_601 180
217 3300046531 Ga0495665_0265412 Ga0495665_0265412_84_626 180
218 3300046558 Ga0495633_0006317 Ga0495633_0006317_761_1309 180
219 3300046665 Ga0495661_0055762 Ga0495661_0055762_162_710 180
220 3300046691 Ga0495670_0010456 Ga0495670_0010456_888_1436 180
221 3300048918 Ga0496115_0080054 Ga0496115_0080054_1357_1908 180
222 3300048919 Ga0496116_0000140 Ga0496116_0000140_59414_59956 180
223 3300048920 Ga0496117_0004433 Ga0496117_0004433_8807_9352 180
224 3300048921 Ga0496118_0006703 Ga0496118_0006703_9368_9913 180
225 3300048925 Ga0496122_0000003 Ga0496122_0000003_278128_278673 180
226 3300048926 Ga0496123_0000012 Ga0496123_0000012_33311_33856 180
227 3300049823 Ga0501044_0017297 Ga0501044_0017297_2211_2756 180
228 3300050489 nmdc:mga03683_155124_c1 nmdc:mga03683_155124_c1_58_606 180
229 3300050493 nmdc:mga0k408_18577_c1 nmdc:mga0k408_18577_c1_1969_2517 180
230 3300050496 nmdc:mga07m45_401221_c1 nmdc:mga07m45_401221_c1_185_733 180
231 2162886007 SwRhRL2b_contig_1879625 SwRhRL2b_0536.00005270 181
232 3300002773 JGI25152J39213_1000008 JGI25152J39213_100000871 181
233 3300002774 JGI25150J39212_1000076 JGI25150J39212_100007618 181
234 3300002774 JGI25150J39212_1000172 JGI25150J39212_100017219 181
235 3300002774 JGI25150J39212_1000274 JGI25150J39212_10002744 181
236 3300002774 JGI25150J39212_1005658 JGI25150J39212_10056583 181
237 3300002987 JGI25159J45721_1000129 JGI25159J45721_100012927 181
238 3300002987 JGI25159J45721_1000145 JGI25159J45721_10001459 181
239 3300002987 JGI25159J45721_1002216 JGI25159J45721_10022167 181
240 3300003187 JGI25151J46595_10000276 JGI25151J46595_1000027633 181
241 3300003187 JGI25151J46595_10000338 JGI25151J46595_1000033853 181
242 3300003215 JGI25153J46596_10003185 JGI25153J46596_100031855 181
243 3300003215 JGI25153J46596_10011038 JGI25153J46596_100110385 181
244 3300003215 JGI25153J46596_10014309 JGI25153J46596_100143092 181
245 3300003215 JGI25153J46596_10049132 JGI25153J46596_100491322 181
246 3300003322 rootL2_10060118 rootL2_100601184 181
247 3300003354 JGI25160J50197_1000286 JGI25160J50197_100028627 181
248 3300003354 JGI25160J50197_1000327 JGI25160J50197_10003279 181
249 3300003374 JGI25161J50226_1000217 JGI25161J50226_100021727 181
250 3300003374 JGI25161J50226_1000245 JGI25161J50226_10002459 181
251 3300003374 JGI25161J50226_1010753 JGI25161J50226_10107531 181
252 3300003763 Ga0055529_1000127 Ga0055529_100012770 181
253 3300003771 Ga0055526_1000111 Ga0055526_100011153 181
254 3300003771 Ga0055526_1000179 Ga0055526_100017945 181
255 3300003771 Ga0055526_1000496 Ga0055526_100049624 181
256 3300003771 Ga0055526_1001794 Ga0055526_100179411 181
257 3300003771 Ga0055526_1002293 Ga0055526_10022939 181
258 3300003771 Ga0055526_1012287 Ga0055526_10122874 181
259 3300003773 Ga0055537_1000056 Ga0055537_100005634 181
260 3300003773 Ga0055537_1000791 Ga0055537_10007917 181
261 3300003773 Ga0055537_1003205 Ga0055537_10032054 181
262 3300003773 Ga0055537_1003941 Ga0055537_10039413 181
263 3300003775 Ga0055524_1000591 Ga0055524_10005919 181
264 3300003775 Ga0055524_1000980 Ga0055524_100098012 181
265 3300003775 Ga0055524_1001112 Ga0055524_10011129 181
266 3300003775 Ga0055524_1001231 Ga0055524_100123110 181
267 3300003775 Ga0055524_1002638 Ga0055524_10026384 181
268 3300003775 Ga0055524_1026523 Ga0055524_10265231 181
269 3300003781 Ga0055536_1000103 Ga0055536_100010324 181
270 3300003784 Ga0055534_1000104 Ga0055534_100010469 181
271 3300003784 Ga0055534_1000158 Ga0055534_100015823 181
272 3300003784 Ga0055534_1000329 Ga0055534_100032924 181
273 3300003784 Ga0055534_1000822 Ga0055534_10008228 181
274 3300003784 Ga0055534_1000952 Ga0055534_10009528 181
275 3300003784 Ga0055534_1021360 Ga0055534_10213602 181
276 3300003790 Ga0055528_1000601 Ga0055528_100060119 181
277 3300003791 Ga0055530_10000151 Ga0055530_1000015131 181
278 3300003791 Ga0055530_10000178 Ga0055530_1000017833 181
279 3300003792 Ga0055540_1000101 Ga0055540_100010133 181
280 3300003794 Ga0055531_10000174 Ga0055531_1000017416 181
281 3300003794 Ga0055531_10013762 Ga0055531_100137624 181
282 3300004625 Ga0055543_1000267 Ga0055543_100026729 181
283 3300004625 Ga0055543_1000325 Ga0055543_100032524 181
284 3300004625 Ga0055543_1008837 Ga0055543_10088372 181
285 3300005262 Ga0065165_1000447 Ga0065165_100044717 181
286 3300005262 Ga0065165_1000898 Ga0065165_100089829 181
287 3300005262 Ga0065165_1001062 Ga0065165_10010629 181
288 3300005262 Ga0065165_1016545 Ga0065165_10165453 181
289 3300005288 Ga0065714_10002526 Ga0065714_1000252617 181
290 3300005289 Ga0065704_10070567 Ga0065704_1007056713 181
291 3300005327 Ga0070658_10422706 Ga0070658_104227062 181
292 3300005335 Ga0070666_10004342 Ga0070666_100043424 181
293 3300005355 Ga0070671_100000012 Ga0070671_1000000126 181
294 3300005548 Ga0070665_100005528 Ga0070665_1000055288 181
295 3300005548 Ga0070665_100323843 Ga0070665_1003238432 181
296 3300005563 Ga0068855_100035221 Ga0068855_1000352214 181
297 3300005617 Ga0068859_100004124 Ga0068859_1000041244 181
298 3300005844 Ga0068862_100011562 Ga0068862_1000115624 181
299 3300006048 Ga0075363_100264774 Ga0075363_1002647742 181
300 3300006051 Ga0075364_10060956 Ga0075364_100609563 181
301 3300006051 Ga0075364_10298526 Ga0075364_102985262 181
302 3300006058 Ga0075432_10092112 Ga0075432_100921122 181
303 3300006178 Ga0075367_10526924 Ga0075367_105269242 181
304 3300006186 Ga0075369_10015675 Ga0075369_100156753 181
305 3300006186 Ga0075369_10455122 Ga0075369_104551221 181
306 3300006195 Ga0075366_10066774 Ga0075366_100667742 181
307 3300006852 Ga0075433_10266402 Ga0075433_102664022 181
308 3300006931 Ga0097620_100004126 Ga0097620_10000412611 181
309 3300006942 Ga0099824_1026038 Ga0099824_10260383 181
310 3300006943 Ga0099822_1046929 Ga0099822_10469293 181
311 3300007076 Ga0075435_100017559 Ga0075435_1000175591 181
312 3300009036 Ga0105244_10006364 Ga0105244_100063644 181
313 3300009036 Ga0105244_10299592 Ga0105244_102995922 181
314 3300009176 Ga0105242_10774441 Ga0105242_107744412 181
315 3300009177 Ga0105248_10003226 Ga0105248_1000322610 181
316 3300009177 Ga0105248_10704064 Ga0105248_107040642 181
317 3300012505 Ga0157339_1021528 Ga0157339_10215281 181
318 3300013100 Ga0157373_10004231 Ga0157373_100042314 181
319 3300013100 Ga0157373_10018184 Ga0157373_100181844 181
320 3300013102 Ga0157371_10000001 Ga0157371_10000001544 181
321 3300013104 Ga0157370_10008528 Ga0157370_100085288 181
322 3300013104 Ga0157370_10403969 Ga0157370_104039692 181
323 3300013308 Ga0157375_10002678 Ga0157375_100026783 181
324 3300014326 Ga0157380_10402195 Ga0157380_104021952 181
325 3300014497 Ga0182008_10049743 Ga0182008_100497433 181
326 3300014969 Ga0157376_10877342 Ga0157376_108773422 181
327 3300015261 Ga0182006_1024123 Ga0182006_10241233 181
328 3300015261 Ga0182006_1059355 Ga0182006_10593552 181
329 3300015261 Ga0182006_1158742 Ga0182006_11587422 181
330 3300015262 Ga0182007_10003645 Ga0182007_100036452 181
331 3300015265 Ga0182005_1000490 Ga0182005_100049015 181
332 3300017792 Ga0163161_10088440 Ga0163161_100884402 181
333 3300021361 Ga0213872_10015084 Ga0213872_100150844 181
334 3300021361 Ga0213872_10133125 Ga0213872_101331252 181
335 3300025208 Ga0209436_100116 Ga0209436_1001169 181
336 3300025208 Ga0209436_100135 Ga0209436_10013529 181
337 3300025233 Ga0209437_102331 Ga0209437_1023312 181
338 3300025245 Ga0207425_1000021 Ga0207425_1000021266 181
339 3300025245 Ga0207425_1000050 Ga0207425_100005069 181
340 3300025245 Ga0207425_1000063 Ga0207425_100006369 181
341 3300025245 Ga0207425_1000150 Ga0207425_100015033 181
342 3300025245 Ga0207425_1007633 Ga0207425_10076333 181
343 3300025246 Ga0209646_1000047 Ga0209646_100004778 181
344 3300025250 Ga0209026_1006080 Ga0209026_10060803 181
345 3300025250 Ga0209026_1032525 Ga0209026_10325252 181
346 3300025258 Ga0209129_1000020 Ga0209129_1000020337 181
347 3300025258 Ga0209129_1000240 Ga0209129_100024019 181
348 3300025258 Ga0209129_1000808 Ga0209129_10008086 181
349 3300025263 Ga0209565_1000006 Ga0209565_1000006266 181
350 3300025263 Ga0209565_1000296 Ga0209565_100029637 181
351 3300025263 Ga0209565_1000303 Ga0209565_100030311 181
352 3300025263 Ga0209565_1000367 Ga0209565_10003679 181
353 3300025263 Ga0209565_1000421 Ga0209565_100042128 181
354 3300025263 Ga0209565_1000439 Ga0209565_100043922 181
355 3300025263 Ga0209565_1007902 Ga0209565_10079022 181
356 3300025263 Ga0209565_1009277 Ga0209565_10092772 181
357 3300025263 Ga0209565_1012079 Ga0209565_10120793 181
358 3300025263 Ga0209565_1014026 Ga0209565_10140263 181
359 3300025263 Ga0209565_1022865 Ga0209565_10228652 181
360 3300025272 Ga0209455_1000051 Ga0209455_1000051153 181
361 3300025273 Ga0209673_1000004 Ga0209673_1000004563 181
362 3300025273 Ga0209673_1001496 Ga0209673_100149610 181
363 3300025273 Ga0209673_1001877 Ga0209673_100187716 181
364 3300025273 Ga0209673_1004263 Ga0209673_10042635 181
365 3300025284 Ga0209130_1000518 Ga0209130_100051829 181
366 3300025284 Ga0209130_1000574 Ga0209130_100057429 181
367 3300025284 Ga0209130_1000951 Ga0209130_10009517 181
368 3300025284 Ga0209130_1004663 Ga0209130_10046632 181
369 3300025291 Ga0209675_1000006 Ga0209675_1000006265 181
370 3300025291 Ga0209675_1000078 Ga0209675_100007842 181
371 3300025291 Ga0209675_1000268 Ga0209675_100026839 181
372 3300025291 Ga0209675_1000418 Ga0209675_100041828 181
373 3300025291 Ga0209675_1006590 Ga0209675_10065903 181
374 3300025291 Ga0209675_1063491 Ga0209675_10634911 181
375 3300025292 Ga0209676_1000121 Ga0209676_1000121145 181
376 3300025292 Ga0209676_1001995 Ga0209676_10019954 181
377 3300025294 Ga0209025_1000051 Ga0209025_100005143 181
378 3300025294 Ga0209025_1000660 Ga0209025_100066019 181
379 3300025294 Ga0209025_1000978 Ga0209025_100097831 181
380 3300025294 Ga0209025_1018169 Ga0209025_10181691 181
381 3300025295 Ga0209564_1000006 Ga0209564_1000006454 181
382 3300025295 Ga0209564_1000064 Ga0209564_100006412 181
383 3300025295 Ga0209564_1000133 Ga0209564_1000133137 181
384 3300025295 Ga0209564_1000595 Ga0209564_100059545 181
385 3300025295 Ga0209564_1000908 Ga0209564_100090829 181
386 3300025295 Ga0209564_1001027 Ga0209564_100102728 181
387 3300025295 Ga0209564_1001062 Ga0209564_100106222 181
388 3300025295 Ga0209564_1003283 Ga0209564_10032839 181
389 3300025297 Ga0209758_1000288 Ga0209758_10002884 181
390 3300025297 Ga0209758_1000550 Ga0209758_100055019 181
391 3300025297 Ga0209758_1000596 Ga0209758_100059632 181
392 3300025297 Ga0209758_1011529 Ga0209758_10115294 181
393 3300025298 Ga0209050_1000028 Ga0209050_1000028108 181
394 3300025298 Ga0209050_1000050 Ga0209050_1000050258 181
395 3300025298 Ga0209050_1000261 Ga0209050_100026179 181
396 3300025298 Ga0209050_1000341 Ga0209050_100034134 181
397 3300025299 Ga0209256_1000013 Ga0209256_1000013152 181
398 3300025299 Ga0209256_1000079 Ga0209256_1000079125 181
399 3300025299 Ga0209256_1000179 Ga0209256_100017948 181
400 3300025299 Ga0209256_1000638 Ga0209256_100063819 181
401 3300025299 Ga0209256_1000757 Ga0209256_100075728 181
402 3300025299 Ga0209256_1021080 Ga0209256_10210802 181
403 3300025302 Ga0207426_1000506 Ga0207426_100050629 181
404 3300025302 Ga0207426_1000657 Ga0207426_100065728 181
405 3300025303 Ga0209051_1000087 Ga0209051_1000087108 181
406 3300025303 Ga0209051_1040326 Ga0209051_10403262 181
407 3300025304 Ga0209257_1000075 Ga0209257_1000075258 181
408 3300025304 Ga0209257_1000622 Ga0209257_100062219 181
409 3300025304 Ga0209257_1009247 Ga0209257_10092474 181
410 3300025728 Ga0207655_1014426 Ga0207655_10144263 181
411 3300025903 Ga0207680_10006161 Ga0207680_100061613 181
412 3300025931 Ga0207644_10000036 Ga0207644_1000003672 181
413 3300025935 Ga0207709_10275550 Ga0207709_102755502 181
414 3300025941 Ga0207711_10002081 Ga0207711_1000208110 181
415 3300025949 Ga0207667_10027997 Ga0207667_100279974 181
416 3300027296 Ga0209389_1000089 Ga0209389_100008954 181
417 3300027312 Ga0209371_1000078 Ga0209371_1000078163 181
418 3300027357 Ga0209589_1000148 Ga0209589_100014848 181
419 3300027361 Ga0209489_100512 Ga0209489_10051235 181
420 3300027907 Ga0207428_10289982 Ga0207428_102899821 181
421 3300028379 Ga0268266_10001076 Ga0268266_1000107623 181
422 3300028380 Ga0268265_10002115 Ga0268265_1000211510 181
423 3300028794 Ga0307515_10112647 Ga0307515_101126472 181
424 3300029957 Ga0265324_10011133 Ga0265324_100111333 181
425 3300030500 Ga0268256_1000298 Ga0268256_10002988 181
426 3300031239 Ga0265328_10011567 Ga0265328_100115673 181
427 3300031239 Ga0265328_10069420 Ga0265328_100694202 181
428 3300031250 Ga0265331_10000390 Ga0265331_1000039021 181
429 3300031250 Ga0265331_10028041 Ga0265331_100280413 181
430 3300031251 Ga0265327_10000271 Ga0265327_1000027182 181
431 3300031251 Ga0265327_10000859 Ga0265327_1000085921 181
432 3300031251 Ga0265327_10001921 Ga0265327_100019218 181
433 3300031548 Ga0307408_100000382 Ga0307408_10000038225 181
434 3300031548 Ga0307408_100001644 Ga0307408_1000016448 181
435 3300031548 Ga0307408_100012140 Ga0307408_1000121403 181
436 3300031548 Ga0307408_100102955 Ga0307408_1001029552 181
437 3300031711 Ga0265314_10011583 Ga0265314_100115835 181
438 3300031838 Ga0307518_10017110 Ga0307518_100171104 181
439 3300031901 Ga0307406_10288850 Ga0307406_102888502 181
440 3300031911 Ga0307412_10007201 Ga0307412_100072011 181
441 3300031911 Ga0307412_10023225 Ga0307412_100232253 181
442 3300032002 Ga0307416_100001464 Ga0307416_1000014645 181
443 3300032004 Ga0307414_10318310 Ga0307414_103183102 181
444 3300037471 Ga0395905_0036982 Ga0395905_0036982_159_716 181
445 3300039062 Ga0400483_176576 Ga0400483_176576_484_1035 181
446 3300039447 Ga0436361_0116812 Ga0436361_0116812_1917_2462 181
447 3300039447 Ga0436361_0148311 Ga0436361_0148311_18796_19344 181
448 3300039447 Ga0436361_0391517 Ga0436361_0391517_3568_4113 181
449 3300039447 Ga0436361_0465833 Ga0436361_0465833_4719_5267 181
450 3300039447 Ga0436361_0933837 Ga0436361_0933837_678_1229 181
451 3300042006 Ga0439432_000808 Ga0439432_000808_8614_9159 181
452 3300042010 Ga0439452_001209 Ga0439452_001209_10166_10714 181
453 3300042139 Ga0450904_000137 Ga0450904_000137_13353_13916 181
454 3300042533 Ga0450901_000885 Ga0450901_000885_2138_2683 181
455 3300044693 Ga0466961_0008258 Ga0466961_0008258_565_1116 181
456 3300044712 Ga0453684_0000273 Ga0453684_0000273_11473_12021 181
457 3300044712 Ga0453684_0099325 Ga0453684_0099325_1570_2136 181
458 3300044901 Ga0466960_0003091 Ga0466960_0003091_2847_3398 181
459 3300046452 Ga0495617_017943 Ga0495617_017943_1408_1953 181
460 3300046452 Ga0495617_095509 Ga0495617_095509_142_690 181
461 3300046457 Ga0495590_0011333 Ga0495590_0011333_302_847 181
462 3300046460 Ga0495638_0000602 Ga0495638_0000602_16891_17436 181
463 3300046460 Ga0495638_0110711 Ga0495638_0110711_728_1273 181
464 3300046463 Ga0495653_0000297 Ga0495653_0000297_5316_5864 181
465 3300046463 Ga0495653_0001050 Ga0495653_0001050_18830_19375 181
466 3300046463 Ga0495653_0006111 Ga0495653_0006111_5125_5673 181
467 3300046471 Ga0495650_0000047 Ga0495650_0000047_292881_293432 181
468 3300046471 Ga0495650_0001240 Ga0495650_0001240_561_1106 181
469 3300046474 Ga0495605_0000015 Ga0495605_0000015_120128_120676 181
470 3300046474 Ga0495605_0020206 Ga0495605_0020206_2408_2953 181
471 3300046474 Ga0495605_0080460 Ga0495605_0080460_811_1356 181
472 3300046491 Ga0495584_0000106 Ga0495584_0000106_3895_4440 181
473 3300046491 Ga0495584_0010772 Ga0495584_0010772_425_970 181
474 3300046491 Ga0495584_0017917 Ga0495584_0017917_1107_1658 181
475 3300046491 Ga0495584_0068312 Ga0495584_0068312_840_1385 181
476 3300046492 Ga0495585_0005034 Ga0495585_0005034_6538_7083 181
477 3300046492 Ga0495585_0026369 Ga0495585_0026369_1471_2016 181
478 3300046492 Ga0495585_0260209 Ga0495585_0260209_221_766 181
479 3300046500 Ga0495596_0000075 Ga0495596_0000075_13940_14485 181
480 3300046501 Ga0495607_0001974 Ga0495607_0001974_14723_15268 181
481 3300046501 Ga0495607_0019971 Ga0495607_0019971_1358_1903 181
482 3300046501 Ga0495607_0027201 Ga0495607_0027201_2115_2660 181
483 3300046501 Ga0495607_0260646 Ga0495607_0260646_93_638 181
484 3300046506 Ga0495583_0000727 Ga0495583_0000727_9950_10495 181
485 3300046507 Ga0495606_0000133 Ga0495606_0000133_4191_4739 181
486 3300046507 Ga0495606_0000690 Ga0495606_0000690_21045_21593 181
487 3300046507 Ga0495606_0003233 Ga0495606_0003233_16689_17234 181
488 3300046507 Ga0495606_0074951 Ga0495606_0074951_796_1341 181
489 3300046507 Ga0495606_0108121 Ga0495606_0108121_322_870 181
490 3300046512 Ga0495610_0004101 Ga0495610_0004101_10345_10893 181
491 3300046512 Ga0495610_0015140 Ga0495610_0015140_378_926 181
492 3300046512 Ga0495610_0069200 Ga0495610_0069200_1069_1614 181
493 3300046513 Ga0495616_0001327 Ga0495616_0001327_7364_7909 181
494 3300046513 Ga0495616_0001422 Ga0495616_0001422_14731_15276 181
495 3300046513 Ga0495616_0002054 Ga0495616_0002054_2278_2823 181
496 3300046513 Ga0495616_0066472 Ga0495616_0066472_1003_1554 181
497 3300046515 Ga0495620_0042498 Ga0495620_0042498_76_621 181
498 3300046517 Ga0495630_0003242 Ga0495630_0003242_1835_2380 181
499 3300046518 Ga0495631_0091706 Ga0495631_0091706_167_718 181
500 3300046519 Ga0495632_0206447 Ga0495632_0206447_229_774 181
501 3300046520 Ga0495637_0001219 Ga0495637_0001219_407_952 181
502 3300046520 Ga0495637_0024441 Ga0495637_0024441_1813_2373 181
503 3300046522 Ga0495643_0000224 Ga0495643_0000224_23542_24087 181
504 3300046522 Ga0495643_0033850 Ga0495643_0033850_1275_1820 181
505 3300046522 Ga0495643_0196343 Ga0495643_0196343_108_653 181
506 3300046522 Ga0495643_0221470 Ga0495643_0221470_70_615 181
507 3300046523 Ga0495644_0000644 Ga0495644_0000644_702_1247 181
508 3300046523 Ga0495644_0022013 Ga0495644_0022013_1377_1940 181
509 3300046524 Ga0495648_0039789 Ga0495648_0039789_1070_1615 181
510 3300046524 Ga0495648_0041962 Ga0495648_0041962_866_1411 181
511 3300046524 Ga0495648_0062976 Ga0495648_0062976_453_1001 181
512 3300046524 Ga0495648_0074348 Ga0495648_0074348_175_723 181
513 3300046528 Ga0495642_0000867 Ga0495642_0000867_10537_11082 181
514 3300046528 Ga0495642_0020231 Ga0495642_0020231_1733_2281 181
515 3300046530 Ga0495654_0003263 Ga0495654_0003263_7736_8281 181
516 3300046530 Ga0495654_0082561 Ga0495654_0082561_359_904 181
517 3300046530 Ga0495654_0217704 Ga0495654_0217704_224_769 181
518 3300046536 Ga0495587_0000722 Ga0495587_0000722_18847_19392 181
519 3300046538 Ga0495609_0000839 Ga0495609_0000839_14422_14967 181
520 3300046538 Ga0495609_0015559 Ga0495609_0015559_488_1033 181
521 3300046542 Ga0495597_0001012 Ga0495597_0001012_15527_16075 181
522 3300046542 Ga0495597_0001132 Ga0495597_0001132_13671_14216 181
523 3300046542 Ga0495597_0021121 Ga0495597_0021121_2469_3014 181
524 3300046558 Ga0495633_0001115 Ga0495633_0001115_19725_20270 181
525 3300046558 Ga0495633_0002441 Ga0495633_0002441_10807_11355 181
526 3300046558 Ga0495633_0012440 Ga0495633_0012440_3155_3703 181
527 3300046615 Ga0495656_0006569 Ga0495656_0006569_591_1136 181
528 3300046616 Ga0495668_0000049 Ga0495668_0000049_167235_167780 181
529 3300046616 Ga0495668_0000195 Ga0495668_0000195_56030_56575 181
530 3300046616 Ga0495668_0002168 Ga0495668_0002168_9679_10224 181
531 3300046616 Ga0495668_0108303 Ga0495668_0108303_102_665 181
532 3300046642 Ga0495634_0001237 Ga0495634_0001237_20279_20824 181
533 3300046648 Ga0495611_0003498 Ga0495611_0003498_606_1151 181
534 3300046660 Ga0495625_0013500 Ga0495625_0013500_4950_5495 181
535 3300046660 Ga0495625_0072900 Ga0495625_0072900_290_835 181
536 3300046660 Ga0495625_0113205 Ga0495625_0113205_729_1274 181
537 3300046660 Ga0495625_0348631 Ga0495625_0348631_354_899 181
538 3300046660 Ga0495625_0539372 Ga0495625_0539372_140_685 181
539 3300046663 Ga0495635_0000601 Ga0495635_0000601_20588_21133 181
540 3300046665 Ga0495661_0008159 Ga0495661_0008159_5018_5563 181
541 3300046665 Ga0495661_0017506 Ga0495661_0017506_809_1354 181
542 3300046665 Ga0495661_0018648 Ga0495661_0018648_1963_2508 181
543 3300046665 Ga0495661_0232153 Ga0495661_0232153_327_935 181
544 3300046680 Ga0495646_0000419 Ga0495646_0000419_3048_3593 181
545 3300046691 Ga0495670_0000159 Ga0495670_0000159_1621_2166 181
546 3300046691 Ga0495670_0001755 Ga0495670_0001755_8482_9027 181
547 3300046692 Ga0495671_0000044 Ga0495671_0000044_55172_55720 181
548 3300046692 Ga0495671_0031910 Ga0495671_0031910_1656_2204 181
549 3300046692 Ga0495671_0184178 Ga0495671_0184178_436_981 181
550 3300046694 Ga0495649_0000543 Ga0495649_0000543_20597_21154 181
551 3300046694 Ga0495649_0001315 Ga0495649_0001315_1035_1580 181
552 3300046694 Ga0495649_0092158 Ga0495649_0092158_679_1224 181
553 3300046794 Ga0495589_0011893 Ga0495589_0011893_1477_2022 181
554 3300046794 Ga0495589_0044644 Ga0495589_0044644_269_814 181
555 3300046810 Ga0495660_0000292 Ga0495660_0000292_37753_38304 181
556 3300047318 Ga0495636_0341998 Ga0495636_0341998_98_646 181
557 3300047319 Ga0495674_0728656 Ga0495674_0728656_213_758 181
558 3300047320 Ga0495672_0007968 Ga0495672_0007968_6581_7126 181
559 3300047320 Ga0495672_0012969 Ga0495672_0012969_2720_3265 181
560 3300047323 Ga0495683_0059666 Ga0495683_0059666_33_584 181
561 3300047323 Ga0495683_0147651 Ga0495683_0147651_272_817 181
562 3300047323 Ga0495683_0213387 Ga0495683_0213387_231_776 181
563 3300047445 Ga0495677_0071044 Ga0495677_0071044_742_1287 181
564 3300047445 Ga0495677_0081401 Ga0495677_0081401_654_1202 181
565 3300047446 Ga0495679_057548 Ga0495679_057548_302_853 181
566 3300047469 Ga0495673_0000027 Ga0495673_0000027_295246_295794 181
567 3300047469 Ga0495673_0000037 Ga0495673_0000037_256377_256925 181
568 3300047469 Ga0495673_0000060 Ga0495673_0000060_11570_12118 181
569 3300047469 Ga0495673_0064743 Ga0495673_0064743_118_663 181
570 3300047470 Ga0495681_0002215 Ga0495681_0002215_359_904 181
571 3300047470 Ga0495681_0029353 Ga0495681_0029353_1292_1843 181
572 3300047470 Ga0495681_0161542 Ga0495681_0161542_88_639 181
573 3300047673 Ga0495593_0000538 Ga0495593_0000538_1991_2536 181
574 3300048088 Ga0495602_0208813 Ga0495602_0208813_583_1128 181
575 3300048091 Ga0495626_0000219 Ga0495626_0000219_53768_54328 181
576 3300048091 Ga0495626_0000323 Ga0495626_0000323_21740_22285 181
577 3300048091 Ga0495626_0001681 Ga0495626_0001681_14074_14619 181
578 3300048903 Ga0496100_0159668 Ga0496100_0159668_836_1381 181
579 3300048903 Ga0496100_0643504 Ga0496100_0643504_126_671 181
580 3300048904 Ga0496101_0021648 Ga0496101_0021648_201_746 181
581 3300048904 Ga0496101_0245295 Ga0496101_0245295_508_1074 181
582 3300048905 Ga0496102_0000957 Ga0496102_0000957_23842_24387 181
583 3300048905 Ga0496102_0923945 Ga0496102_0923945_221_766 181
584 3300048906 Ga0496103_0001518 Ga0496103_0001518_13555_14100 181
585 3300048910 Ga0496107_0460361 Ga0496107_0460361_186_734 181
586 3300048913 Ga0496110_0913414 Ga0496110_0913414_15_563 181
587 3300048914 Ga0496111_0201599 Ga0496111_0201599_93_641 181
588 3300048919 Ga0496116_0004269 Ga0496116_0004269_8947_9492 181
589 3300048919 Ga0496116_0007765 Ga0496116_0007765_3058_3603 181
590 3300048919 Ga0496116_0019322 Ga0496116_0019322_1783_2328 181
591 3300048919 Ga0496116_0104302 Ga0496116_0104302_214_762 181
592 3300048920 Ga0496117_0003351 Ga0496117_0003351_2180_2725 181
593 3300048920 Ga0496117_0005935 Ga0496117_0005935_8947_9492 181
594 3300048920 Ga0496117_0006377 Ga0496117_0006377_1090_1635 181
595 3300048920 Ga0496117_0043933 Ga0496117_0043933_1332_1877 181
596 3300048921 Ga0496118_0005490 Ga0496118_0005490_12755_13300 181
597 3300048921 Ga0496118_0008693 Ga0496118_0008693_4057_4602 181
598 3300048921 Ga0496118_0025440 Ga0496118_0025440_2558_3103 181
599 3300048921 Ga0496118_0067890 Ga0496118_0067890_83_628 181
600 3300048922 Ga0496119_0036248 Ga0496119_0036248_608_1153 181
601 3300048922 Ga0496119_0043332 Ga0496119_0043332_1738_2283 181
602 3300048924 Ga0496121_0046061 Ga0496121_0046061_1039_1584 181
603 3300048924 Ga0496121_0103724 Ga0496121_0103724_619_1164 181
604 3300048924 Ga0496121_0104952 Ga0496121_0104952_1434_1979 181
605 3300048924 Ga0496121_0210246 Ga0496121_0210246_555_1100 181
606 3300048924 Ga0496121_0391699 Ga0496121_0391699_253_801 181
607 3300048925 Ga0496122_0000962 Ga0496122_0000962_50120_50665 181
608 3300048925 Ga0496122_0025381 Ga0496122_0025381_156_701 181
609 3300048925 Ga0496122_0076395 Ga0496122_0076395_935_1483 181
610 3300048925 Ga0496122_0091382 Ga0496122_0091382_1039_1584 181
611 3300048926 Ga0496123_0000750 Ga0496123_0000750_1871_2416 181
612 3300048926 Ga0496123_0032775 Ga0496123_0032775_119_667 181
613 3300048926 Ga0496123_0082149 Ga0496123_0082149_1332_1877 181
614 3300048927 Ga0496124_0000285 Ga0496124_0000285_91028_91573 181
615 3300048927 Ga0496124_0001456 Ga0496124_0001456_7030_7575 181
616 3300048927 Ga0496124_0003860 Ga0496124_0003860_4962_5519 181
617 3300048927 Ga0496124_0017901 Ga0496124_0017901_1787_2332 181
618 3300048927 Ga0496124_0134991 Ga0496124_0134991_1332_1877 181
619 3300048927 Ga0496124_0176862 Ga0496124_0176862_97_642 181
620 3300048927 Ga0496124_0451558 Ga0496124_0451558_238_786 181
621 3300048928 Ga0496125_0039443 Ga0496125_0039443_1185_1730 181
622 3300048929 Ga0496126_0005419 Ga0496126_0005419_12920_13465 181
623 3300048929 Ga0496126_0038851 Ga0496126_0038851_248_793 181
624 3300048929 Ga0496126_0041628 Ga0496126_0041628_910_1458 181
625 3300048929 Ga0496126_0148827 Ga0496126_0148827_131_676 181
626 3300049459 Ga0495678_000001 Ga0495678_000001_689590_690135 181
627 3300049459 Ga0495678_006341 Ga0495678_006341_2477_3028 181
628 3300049459 Ga0495678_029233 Ga0495678_029233_192_737 181
629 3300049459 Ga0495678_065338 Ga0495678_065338_330_875 181
630 3300049460 Ga0495682_0000095 Ga0495682_0000095_56943_57488 181
631 3300049460 Ga0495682_0000466 Ga0495682_0000466_4589_5134 181
632 3300049460 Ga0495682_0040591 Ga0495682_0040591_994_1539 181
633 3300049568 Ga0501031_0054787 Ga0501031_0054787_294_839 181
634 3300049569 Ga0501032_0034032 Ga0501032_0034032_1382_1927 181
635 3300049571 Ga0501034_0007417 Ga0501034_0007417_8522_9067 181
636 3300049574 Ga0501038_0110693 Ga0501038_0110693_192_737 181
637 3300049575 Ga0501039_0008456 Ga0501039_0008456_4187_4732 181
638 3300049575 Ga0501039_0193783 Ga0501039_0193783_146_691 181
639 3300049575 Ga0501039_0345758 Ga0501039_0345758_195_740 181
640 3300049580 Ga0501046_0515599 Ga0501046_0515599_183_728 181
641 3300049662 Ga0501222_004695 Ga0501222_004695_325_870 181
642 3300049665 Ga0501227_003043 Ga0501227_003043_356_901 181
643 3300049673 Ga0501240_010647 Ga0501240_010647_608_1153 181
644 3300049766 Ga0501269_002758 Ga0501269_002758_1260_1805 181
645 3300049822 Ga0501035_0022923 Ga0501035_0022923_3856_4401 181
646 3300049822 Ga0501035_0088603 Ga0501035_0088603_2117_2662 181
647 3300049823 Ga0501044_0979779 Ga0501044_0979779_91_636 181
648 3300050490 nmdc:mga03n38_130203_c1 nmdc:mga03n38_130203_c1_675_1223 181
649 3300050493 nmdc:mga0k408_11886_c1 nmdc:mga0k408_11886_c1_2964_3512 181
650 3300050493 nmdc:mga0k408_7548_c1 nmdc:mga0k408_7548_c1_4040_4588 181
651 3300050508 nmdc:mga09592_507121_c1 nmdc:mga09592_507121_c1_188_745 181
652 3300050513 nmdc:mga0rr50_13151_c1 nmdc:mga0rr50_13151_c1_4762_5307 181
653 3300050515 nmdc:mga0a205_13912_c1 nmdc:mga0a205_13912_c1_6637_7182 181
654 3300050516 nmdc:mga0sz30_241236_c1 nmdc:mga0sz30_241236_c1_235_780 181
655 3300053125 Ga0500618_000576 Ga0500618_000576_21196_21744 181
656 3300053145 Ga0500586_000070 Ga0500586_000070_1376_1924 181
657 3300053156 Ga0500622_0323627 Ga0500622_0323627_88_633 181
658 3300053729 Ga0500625_058052 Ga0500625_058052_722_1267 181
659 3300059424 Ga0590075_013549 Ga0590075_013549_374_919 181
660 2010549000 RicEn_C3528 RicEn_63810 182
661 2162886007 SwRhRL2b_contig_2217296 SwRhRL2b_0622.00003040 182
662 2162886007 SwRhRL2b_contig_3824893 SwRhRL2b_0301.00007190 182
663 3300003856 Ga0058692_1000490 Ga0058692_10004905 182
664 3300005289 Ga0065704_10001570 Ga0065704_100015708 182
665 3300006946 Ga0079104_1000282 Ga0079104_100028236 182
666 3300006946 Ga0079104_1037413 Ga0079104_10374132 182
667 3300009011 Ga0105251_10042977 Ga0105251_100429772 182
668 3300009036 Ga0105244_10000347 Ga0105244_100003476 182
669 3300025728 Ga0207655_1000447 Ga0207655_100044746 182
670 3300027111 Ga0209281_1000257 Ga0209281_100025738 182
671 3300027312 Ga0209371_1000015 Ga0209371_1000015106 182
672 3300030500 Ga0268256_1000018 Ga0268256_1000018519 182
673 3300039062 Ga0400483_101867 Ga0400483_101867_305_853 182
674 3300039062 Ga0400483_284223 Ga0400483_284223_322_870 182
675 3300041405 Ga0439438_000880 Ga0439438_000880_8295_8843 182
676 3300041405 Ga0439438_012055 Ga0439438_012055_1139_1696 182
677 3300042006 Ga0439432_024351 Ga0439432_024351_465_1022 182
678 3300042010 Ga0439452_000010 Ga0439452_000010_375728_376285 182
679 3300042010 Ga0439452_000020 Ga0439452_000020_255353_255901 182
680 3300046471 Ga0495650_0000454 Ga0495650_0000454_40246_40794 182
681 3300046519 Ga0495632_0000110 Ga0495632_0000110_40482_41030 182
682 3300046519 Ga0495632_0245006 Ga0495632_0245006_143_691 182
683 3300046520 Ga0495637_0018102 Ga0495637_0018102_179_727 182
684 3300046665 Ga0495661_0000247 Ga0495661_0000247_47258_47806 182
685 3300048919 Ga0496116_0009769 Ga0496116_0009769_3991_4539 182
686 3300048920 Ga0496117_0004348 Ga0496117_0004348_2196_2744 182
687 3300048920 Ga0496117_0005867 Ga0496117_0005867_8403_8987 182
688 3300048921 Ga0496118_0004249 Ga0496118_0004249_3644_4192 182
689 3300048922 Ga0496119_0000049 Ga0496119_0000049_24836_25384 182
690 3300048923 Ga0496120_0001489 Ga0496120_0001489_16178_16726 182
691 3300048923 Ga0496120_0015723 Ga0496120_0015723_797_1345 182
692 3300048924 Ga0496121_0001226 Ga0496121_0001226_27275_27823 182
693 3300048925 Ga0496122_0003434 Ga0496122_0003434_2074_2622 182
694 3300048925 Ga0496122_0005242 Ga0496122_0005242_10216_10764 182
695 3300048926 Ga0496123_0004279 Ga0496123_0004279_9742_10290 182
696 3300048926 Ga0496123_0005350 Ga0496123_0005350_3760_4308 182
697 3300048927 Ga0496124_0136704 Ga0496124_0136704_732_1280 182
698 3300048928 Ga0496125_0009915 Ga0496125_0009915_1960_2508 182
699 3300048929 Ga0496126_0009234 Ga0496126_0009234_7463_8047 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

26

197

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9879 2 178
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.986 2 182
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9858 1 182
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9818 1 182
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9752 1 182
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9814 2 182 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9725 1 176 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9693 1 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9583 2 174 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9572 2 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A630SW49-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.002 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A192C831-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1.001 1 151 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A526YBR9-F1-model_v4 deleted 0.9984 1 180
AF-A0A3C0JH15-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9982 1 155 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A448KY50-F1-model_v4 deleted 0.9976 1 182

Feature Viewer

pLDDT pTM Quality
97.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map