F476012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 367 | 694 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100113722|Ga0070678_1001137222 |
| Length | 332 |
| Sequence | MGGRGFSMAELTYRDAVAAGIAQEMERDERVVFLGEDVADAGGVFKATVGLLDKFGPKRVRDCPISEQAILGAAMGAAMTGLRPIAEIMFSDFLAVCWDIVANEIAKSRYMTNGQISLPLVIRTANGAGSRFGAQHSQAVENWAMMIPGIKVVAPAFPADVKGLLAAAVRDPDPVLFFEQKSLYPMKGEVPDGEYVDQLGKARVLRSGKDCTIVALASMVHKSMDAAAALEKEHGIACTVIDLRSLVPLDTQTILGEVGKTGRLFTVEENPRLCGWGAEIVSIVAEECFWNLDAPIVRITTPHVPLPSADLLEDNTIPSVARIVREIREKMG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 2 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 3 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 4 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 5 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 223 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 231 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 306 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 356 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 359 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 360 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.44 |
| Nodule | 0.43 |
| Rhizoplane | 7.73 |
| Rhizosphere | 84.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10008875 | 3300003203 | Bacteria | 4524 |
| 2 | JGI25153J46596_10000010 | 3300003215 | Bacteria | 337769 |
| 3 | Ga0065715_10135985 | 3300005293 | Bacteria | 1930 |
| 4 | Ga0070676_10119615 | 3300005328 | Bacteria | 1651 |
| 5 | Ga0070683_100039965 | 3300005329 | Bacteria | 4310 |
| 6 | Ga0070683_100047446 | 3300005329 | Bacteria | 3969 |
| 7 | Ga0070683_100088335 | 3300005329 | Bacteria | 2908 |
| 8 | Ga0070670_100005194 | 3300005331 | Bacteria | 10961 |
| 9 | Ga0070670_100010828 | 3300005331 | Bacteria | 7790 |
| 10 | Ga0070670_100069160 | 3300005331 | Bacteria | 3031 |
| 11 | Ga0070670_100103417 | 3300005331 | Bacteria | 2453 |
| 12 | Ga0070677_10057758 | 3300005333 | Bacteria | 1591 |
| 13 | Ga0070680_100098358 | 3300005336 | Bacteria | 2427 |
| 14 | Ga0068868_100000544 | 3300005338 | Bacteria | 25315 |
| 15 | Ga0070660_100213577 | 3300005339 | Bacteria | 1567 |
| 16 | Ga0070689_100050245 | 3300005340 | Bacteria | 3221 |
| 17 | Ga0070689_100061702 | 3300005340 | Bacteria | 2916 |
| 18 | Ga0070689_100061730 | 3300005340 | Bacteria | 2915 |
| 19 | Ga0070691_10131909 | 3300005341 | Bacteria | 1267 |
| 20 | Ga0070661_100014017 | 3300005344 | Bacteria | 5637 |
| 21 | Ga0070692_10051973 | 3300005345 | Bacteria | 2133 |
| 22 | Ga0070668_100024657 | 3300005347 | Bacteria | 4558 |
| 23 | Ga0070668_100113176 | 3300005347 | Bacteria | 2162 |
| 24 | Ga0070669_100081605 | 3300005353 | Bacteria | 2409 |
| 25 | Ga0070675_100015371 | 3300005354 | Bacteria | 6050 |
| 26 | Ga0070675_100108494 | 3300005354 | Bacteria | 2344 |
| 27 | Ga0070671_100016634 | 3300005355 | Bacteria | 5945 |
| 28 | Ga0070671_100035497 | 3300005355 | Bacteria | 4130 |
| 29 | Ga0070674_100095128 | 3300005356 | Bacteria | 2159 |
| 30 | Ga0070673_100005459 | 3300005364 | Bacteria | 8141 |
| 31 | Ga0070673_100148486 | 3300005364 | Bacteria | 1983 |
| 32 | Ga0070688_100055393 | 3300005365 | Bacteria | 2487 |
| 33 | Ga0070659_100039631 | 3300005366 | Bacteria | 3678 |
| 34 | Ga0070659_100057549 | 3300005366 | Bacteria | 3066 |
| 35 | Ga0070667_100169799 | 3300005367 | Bacteria | 1925 |
| 36 | Ga0070709_10001838 | 3300005434 | Bacteria | 11515 |
| 37 | Ga0070709_10172580 | 3300005434 | Bacteria | 1512 |
| 38 | Ga0070714_100085203 | 3300005435 | Bacteria | 2759 |
| 39 | Ga0070713_100008135 | 3300005436 | Bacteria | 7422 |
| 40 | Ga0070701_10014594 | 3300005438 | Bacteria | 3606 |
| 41 | Ga0070711_100285695 | 3300005439 | Bacteria | 1307 |
| 42 | Ga0070705_100000495 | 3300005440 | Bacteria | 22727 |
| 43 | Ga0070705_100277279 | 3300005440 | Bacteria | 1190 |
| 44 | Ga0070700_100126592 | 3300005441 | Bacteria | 1718 |
| 45 | Ga0070700_100276567 | 3300005441 | Bacteria | 1215 |
| 46 | Ga0070694_100015470 | 3300005444 | Bacteria | 4794 |
| 47 | Ga0070694_100126229 | 3300005444 | Bacteria | 1842 |
| 48 | Ga0070708_100003217 | 3300005445 | Bacteria | 12740 |
| 49 | Ga0070663_100082371 | 3300005455 | Bacteria | 2367 |
| 50 | Ga0070678_100000281 | 3300005456 | Bacteria | 23641 |
| 51 | Ga0070678_100028549 | 3300005456 | Bacteria | 3807 |
| 52 | Ga0070678_100113722 | 3300005456 | Bacteria | 2122 |
| 53 | Ga0070662_100102734 | 3300005457 | Bacteria | 2166 |
| 54 | Ga0070662_100143198 | 3300005457 | Bacteria | 1855 |
| 55 | Ga0070685_10010154 | 3300005466 | Bacteria | 4888 |
| 56 | Ga0070685_10047169 | 3300005466 | Bacteria | 2476 |
| 57 | Ga0070706_100121271 | 3300005467 | Bacteria | 2437 |
| 58 | Ga0070707_100006922 | 3300005468 | Bacteria | 10508 |
| 59 | Ga0070699_100000158 | 3300005518 | Bacteria | 64029 |
| 60 | Ga0070684_100016240 | 3300005535 | Bacteria | 6081 |
| 61 | Ga0070684_100193002 | 3300005535 | Bacteria | 1854 |
| 62 | Ga0070697_100041288 | 3300005536 | Bacteria | 3733 |
| 63 | Ga0070697_100125137 | 3300005536 | Bacteria | 2153 |
| 64 | Ga0068853_100081302 | 3300005539 | Bacteria | 2836 |
| 65 | Ga0070672_100001595 | 3300005543 | Bacteria | 14069 |
| 66 | Ga0070672_100004204 | 3300005543 | Bacteria | 9409 |
| 67 | Ga0070672_100195682 | 3300005543 | Bacteria | 1689 |
| 68 | Ga0070686_100003659 | 3300005544 | Bacteria | 8439 |
| 69 | Ga0070686_100152520 | 3300005544 | Bacteria | 1619 |
| 70 | Ga0070686_100357081 | 3300005544 | Bacteria | 1100 |
| 71 | Ga0070695_100009449 | 3300005545 | Bacteria | 5806 |
| 72 | Ga0070695_100171523 | 3300005545 | Bacteria | 1531 |
| 73 | Ga0070696_100010445 | 3300005546 | Bacteria | 6222 |
| 74 | Ga0070693_100161697 | 3300005547 | Bacteria | 1427 |
| 75 | Ga0070665_100106145 | 3300005548 | Bacteria | 2811 |
| 76 | Ga0070665_100228361 | 3300005548 | Bacteria | 1861 |
| 77 | Ga0070704_100009759 | 3300005549 | Bacteria | 5818 |
| 78 | Ga0070664_100007947 | 3300005564 | Bacteria | 8569 |
| 79 | Ga0068857_100056849 | 3300005577 | Bacteria | 3472 |
| 80 | Ga0068854_100015614 | 3300005578 | Bacteria | 5036 |
| 81 | Ga0068856_100115685 | 3300005614 | Bacteria | 2682 |
| 82 | Ga0070702_100028493 | 3300005615 | Bacteria | 3027 |
| 83 | Ga0070702_100038821 | 3300005615 | Bacteria | 2654 |
| 84 | Ga0068852_100000200 | 3300005616 | Bacteria | 40742 |
| 85 | Ga0068859_100085823 | 3300005617 | Bacteria | 3193 |
| 86 | Ga0068864_100036691 | 3300005618 | Bacteria | 4180 |
| 87 | Ga0068864_100060098 | 3300005618 | Bacteria | 3290 |
| 88 | Ga0068864_100157016 | 3300005618 | Bacteria | 2065 |
| 89 | Ga0068866_10053799 | 3300005718 | Bacteria | 2060 |
| 90 | Ga0068861_100261891 | 3300005719 | Bacteria | 1481 |
| 91 | Ga0068870_10060060 | 3300005840 | Bacteria | 2040 |
| 92 | Ga0068863_100009972 | 3300005841 | Bacteria | 9248 |
| 93 | Ga0068863_100017201 | 3300005841 | Bacteria | 6934 |
| 94 | Ga0068863_100112376 | 3300005841 | Bacteria | 2594 |
| 95 | Ga0068858_100220300 | 3300005842 | Bacteria | 1797 |
| 96 | Ga0068860_100005729 | 3300005843 | Bacteria | 12528 |
| 97 | Ga0068860_100161614 | 3300005843 | Bacteria | 2160 |
| 98 | Ga0068862_100001649 | 3300005844 | Bacteria | 20295 |
| 99 | Ga0068862_100018237 | 3300005844 | Bacteria | 5843 |
| 100 | Ga0068862_100302721 | 3300005844 | Bacteria | 1471 |
| 101 | Ga0081538_10004000 | 3300005981 | Bacteria | 13727 |
| 102 | Ga0081538_10016393 | 3300005981 | Bacteria | 5685 |
| 103 | Ga0081540_1005998 | 3300005983 | Bacteria | 8951 |
| 104 | Ga0081540_1014080 | 3300005983 | Bacteria | 5152 |
| 105 | Ga0081540_1064427 | 3300005983 | Bacteria | 1729 |
| 106 | Ga0081539_10002801 | 3300005985 | Bacteria | 23305 |
| 107 | Ga0081539_10039440 | 3300005985 | Bacteria | 2786 |
| 108 | Ga0081539_10161189 | 3300005985 | Bacteria | 1069 |
| 109 | Ga0070717_10027405 | 3300006028 | Bacteria | 4554 |
| 110 | Ga0075365_10053360 | 3300006038 | Bacteria | 2677 |
| 111 | Ga0075365_10103751 | 3300006038 | Bacteria | 1949 |
| 112 | Ga0075365_10175835 | 3300006038 | Bacteria | 1495 |
| 113 | Ga0075363_100004257 | 3300006048 | Bacteria | 6222 |
| 114 | Ga0075363_100040646 | 3300006048 | Bacteria | 2451 |
| 115 | Ga0075364_10158854 | 3300006051 | Bacteria | 1525 |
| 116 | Ga0075364_10232414 | 3300006051 | Bacteria | 1252 |
| 117 | Ga0070715_10001029 | 3300006163 | Bacteria | 7873 |
| 118 | Ga0070716_100076910 | 3300006173 | Bacteria | 1979 |
| 119 | Ga0075362_10001107 | 3300006177 | Bacteria | 8361 |
| 120 | Ga0075367_10037538 | 3300006178 | Bacteria | 2816 |
| 121 | Ga0075367_10096575 | 3300006178 | Bacteria | 1802 |
| 122 | Ga0075367_10161251 | 3300006178 | Bacteria | 1394 |
| 123 | Ga0075366_10008250 | 3300006195 | Bacteria | 5782 |
| 124 | Ga0097621_100003433 | 3300006237 | Bacteria | 10913 |
| 125 | Ga0075370_10100220 | 3300006353 | Bacteria | 1676 |
| 126 | Ga0075428_100005978 | 3300006844 | Bacteria | 13519 |
| 127 | Ga0075428_100672413 | 3300006844 | Bacteria | 1104 |
| 128 | Ga0075430_100001391 | 3300006846 | Bacteria | 19638 |
| 129 | Ga0075430_100056675 | 3300006846 | Bacteria | 3296 |
| 130 | Ga0075430_100117562 | 3300006846 | Bacteria | 2216 |
| 131 | Ga0075431_100007118 | 3300006847 | Bacteria | 11115 |
| 132 | Ga0075431_100024240 | 3300006847 | Bacteria | 6214 |
| 133 | Ga0075431_100052784 | 3300006847 | Bacteria | 4191 |
| 134 | Ga0075431_100254998 | 3300006847 | Bacteria | 1781 |
| 135 | Ga0075431_100259582 | 3300006847 | Bacteria | 1763 |
| 136 | Ga0075431_100624674 | 3300006847 | Bacteria | 1059 |
| 137 | Ga0075433_10026200 | 3300006852 | Bacteria | 4934 |
| 138 | Ga0075434_100061854 | 3300006871 | Bacteria | 3726 |
| 139 | Ga0075429_100024317 | 3300006880 | Bacteria | 5256 |
| 140 | Ga0075429_100107365 | 3300006880 | Bacteria | 2440 |
| 141 | Ga0075436_100002520 | 3300006914 | Bacteria | 12602 |
| 142 | Ga0097620_100085819 | 3300006931 | Bacteria | 3193 |
| 143 | Ga0099794_10000104 | 3300007265 | Bacteria | 31247 |
| 144 | Ga0099794_10096702 | 3300007265 | Bacteria | 1470 |
| 145 | Ga0099795_10045891 | 3300007788 | Bacteria | 1572 |
| 146 | Ga0105251_10086645 | 3300009011 | Bacteria | 1442 |
| 147 | Ga0105240_10032455 | 3300009093 | Bacteria | 6761 |
| 148 | Ga0105240_10130173 | 3300009093 | Bacteria | 3019 |
| 149 | Ga0105240_10156897 | 3300009093 | Bacteria | 2706 |
| 150 | Ga0111539_10072415 | 3300009094 | Bacteria | 4064 |
| 151 | Ga0111539_10074818 | 3300009094 | Bacteria | 3991 |
| 152 | Ga0105247_10046857 | 3300009101 | Bacteria | 2654 |
| 153 | Ga0114129_10086220 | 3300009147 | Bacteria | 4355 |
| 154 | Ga0114129_10457215 | 3300009147 | Bacteria | 1673 |
| 155 | Ga0105243_10188172 | 3300009148 | Bacteria | 1801 |
| 156 | Ga0105242_10198974 | 3300009176 | Bacteria | 1779 |
| 157 | Ga0105242_10231955 | 3300009176 | Bacteria | 1655 |
| 158 | Ga0105248_10071779 | 3300009177 | Bacteria | 3890 |
| 159 | Ga0105248_10100379 | 3300009177 | Bacteria | 3261 |
| 160 | Ga0105237_10345963 | 3300009545 | Bacteria | 1491 |
| 161 | Ga0105238_10067684 | 3300009551 | Bacteria | 3572 |
| 162 | Ga0105249_10000475 | 3300009553 | Bacteria | 37277 |
| 163 | Ga0099796_10034050 | 3300010159 | Bacteria | 1680 |
| 164 | Ga0105239_10012459 | 3300010375 | Bacteria | 9470 |
| 165 | Ga0105239_10286325 | 3300010375 | Bacteria | 1855 |
| 166 | Ga0105246_10206033 | 3300011119 | Bacteria | 1532 |
| 167 | Ga0105246_10238293 | 3300011119 | Bacteria | 1437 |
| 168 | Ga0157374_10000653 | 3300013296 | Bacteria | 30599 |
| 169 | Ga0157378_10001132 | 3300013297 | Bacteria | 24292 |
| 170 | Ga0163162_10131050 | 3300013306 | Bacteria | 2616 |
| 171 | Ga0163162_10145173 | 3300013306 | Bacteria | 2488 |
| 172 | Ga0163162_10335970 | 3300013306 | Bacteria | 1643 |
| 173 | Ga0157372_10408424 | 3300013307 | Bacteria | 1582 |
| 174 | Ga0157375_10001703 | 3300013308 | Bacteria | 18876 |
| 175 | Ga0157375_10321053 | 3300013308 | Bacteria | 1713 |
| 176 | Ga0163163_10021730 | 3300014325 | Bacteria | 6061 |
| 177 | Ga0163163_10069852 | 3300014325 | Bacteria | 3497 |
| 178 | Ga0163163_10131176 | 3300014325 | Bacteria | 2546 |
| 179 | Ga0157380_10133590 | 3300014326 | Bacteria | 2121 |
| 180 | Ga0157380_10187983 | 3300014326 | Bacteria | 1821 |
| 181 | Ga0157380_10284305 | 3300014326 | Bacteria | 1515 |
| 182 | Ga0157377_10009768 | 3300014745 | Bacteria | 4723 |
| 183 | Ga0157377_10013216 | 3300014745 | Bacteria | 4175 |
| 184 | Ga0157379_10113188 | 3300014968 | Bacteria | 2439 |
| 185 | Ga0157376_10020667 | 3300014969 | Bacteria | 5099 |
| 186 | Ga0213876_10003329 | 3300021384 | Bacteria | 9208 |
| 187 | Ga0213876_10008211 | 3300021384 | Bacteria | 5652 |
| 188 | Ga0213876_10021721 | 3300021384 | Bacteria | 3395 |
| 189 | Ga0213876_10163658 | 3300021384 | Bacteria | 1184 |
| 190 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 191 | Ga0207697_10011678 | 3300025315 | Bacteria | 3707 |
| 192 | Ga0207656_10020204 | 3300025321 | Bacteria | 2645 |
| 193 | Ga0207653_10011499 | 3300025885 | Bacteria | 2761 |
| 194 | Ga0207682_10002135 | 3300025893 | Bacteria | 8970 |
| 195 | Ga0207682_10059324 | 3300025893 | Bacteria | 1599 |
| 196 | Ga0207692_10062025 | 3300025898 | Bacteria | 1940 |
| 197 | Ga0207692_10077089 | 3300025898 | Bacteria | 1772 |
| 198 | Ga0207688_10004400 | 3300025901 | Bacteria | 7669 |
| 199 | Ga0207685_10017899 | 3300025905 | Bacteria | 2303 |
| 200 | Ga0207699_10326254 | 3300025906 | Bacteria | 1078 |
| 201 | Ga0207645_10006895 | 3300025907 | Bacteria | 8102 |
| 202 | Ga0207645_10013908 | 3300025907 | Bacteria | 5397 |
| 203 | Ga0207643_10000132 | 3300025908 | Bacteria | 50824 |
| 204 | Ga0207643_10002110 | 3300025908 | Bacteria | 10953 |
| 205 | Ga0207654_10257721 | 3300025911 | Bacteria | 1171 |
| 206 | Ga0207707_10093239 | 3300025912 | Bacteria | 2630 |
| 207 | Ga0207695_10052905 | 3300025913 | Bacteria | 4251 |
| 208 | Ga0207695_10139652 | 3300025913 | Bacteria | 2373 |
| 209 | Ga0207695_10145384 | 3300025913 | Bacteria | 2316 |
| 210 | Ga0207693_10000988 | 3300025915 | Bacteria | 25527 |
| 211 | Ga0207693_10014858 | 3300025915 | Bacteria | 6254 |
| 212 | Ga0207693_10024106 | 3300025915 | Bacteria | 4831 |
| 213 | Ga0207663_10060053 | 3300025916 | Bacteria | 2408 |
| 214 | Ga0207660_10122750 | 3300025917 | Bacteria | 1969 |
| 215 | Ga0207662_10073964 | 3300025918 | Bacteria | 2068 |
| 216 | Ga0207662_10137091 | 3300025918 | Bacteria | 1547 |
| 217 | Ga0207657_10024231 | 3300025919 | Bacteria | 5630 |
| 218 | Ga0207649_10031311 | 3300025920 | Bacteria | 3161 |
| 219 | Ga0207652_10255689 | 3300025921 | Bacteria | 1580 |
| 220 | Ga0207646_10091008 | 3300025922 | Bacteria | 2730 |
| 221 | Ga0207694_10038798 | 3300025924 | Bacteria | 3663 |
| 222 | Ga0207650_10001197 | 3300025925 | Bacteria | 19048 |
| 223 | Ga0207650_10002081 | 3300025925 | Bacteria | 13987 |
| 224 | Ga0207650_10003351 | 3300025925 | Bacteria | 11021 |
| 225 | Ga0207650_10016727 | 3300025925 | Bacteria | 5128 |
| 226 | Ga0207650_10181740 | 3300025925 | Bacteria | 1676 |
| 227 | Ga0207650_10274901 | 3300025925 | Bacteria | 1370 |
| 228 | Ga0207659_10011997 | 3300025926 | Bacteria | 5491 |
| 229 | Ga0207659_10029082 | 3300025926 | Bacteria | 3762 |
| 230 | Ga0207700_10057899 | 3300025928 | Bacteria | 2924 |
| 231 | Ga0207700_10185655 | 3300025928 | Bacteria | 1744 |
| 232 | Ga0207644_10000669 | 3300025931 | Bacteria | 21644 |
| 233 | Ga0207644_10127627 | 3300025931 | Bacteria | 1943 |
| 234 | Ga0207690_10295359 | 3300025932 | Bacteria | 1266 |
| 235 | Ga0207706_10003081 | 3300025933 | Bacteria | 16020 |
| 236 | Ga0207706_10070011 | 3300025933 | Bacteria | 3085 |
| 237 | Ga0207686_10014996 | 3300025934 | Bacteria | 4326 |
| 238 | Ga0207686_10124121 | 3300025934 | Bacteria | 1762 |
| 239 | Ga0207709_10172122 | 3300025935 | Bacteria | 1521 |
| 240 | Ga0207670_10004147 | 3300025936 | Bacteria | 7766 |
| 241 | Ga0207670_10105118 | 3300025936 | Bacteria | 2023 |
| 242 | Ga0207669_10063577 | 3300025937 | Bacteria | 2279 |
| 243 | Ga0207704_10111779 | 3300025938 | Bacteria | 1848 |
| 244 | Ga0207665_10003664 | 3300025939 | Bacteria | 10262 |
| 245 | Ga0207691_10000470 | 3300025940 | Bacteria | 39893 |
| 246 | Ga0207691_10053994 | 3300025940 | Bacteria | 3666 |
| 247 | Ga0207711_10012335 | 3300025941 | Bacteria | 7103 |
| 248 | Ga0207711_10435983 | 3300025941 | Bacteria | 1219 |
| 249 | Ga0207661_10002744 | 3300025944 | Bacteria | 12121 |
| 250 | Ga0207661_10314216 | 3300025944 | Bacteria | 1407 |
| 251 | Ga0207679_10047223 | 3300025945 | Bacteria | 3127 |
| 252 | Ga0207651_10020371 | 3300025960 | Bacteria | 4001 |
| 253 | Ga0207651_10110726 | 3300025960 | Bacteria | 2060 |
| 254 | Ga0207651_10183520 | 3300025960 | Bacteria | 1662 |
| 255 | Ga0207651_10226603 | 3300025960 | Bacteria | 1514 |
| 256 | Ga0207712_10001185 | 3300025961 | Bacteria | 18034 |
| 257 | Ga0207712_10174653 | 3300025961 | Bacteria | 1683 |
| 258 | Ga0207668_10244922 | 3300025972 | Bacteria | 1452 |
| 259 | Ga0207668_10479557 | 3300025972 | Bacteria | 1066 |
| 260 | Ga0207677_10001341 | 3300026023 | Bacteria | 13198 |
| 261 | Ga0207703_10059555 | 3300026035 | Bacteria | 3119 |
| 262 | Ga0207678_10005470 | 3300026067 | Bacteria | 11361 |
| 263 | Ga0207678_10059999 | 3300026067 | Bacteria | 3272 |
| 264 | Ga0207708_10015889 | 3300026075 | Bacteria | 5652 |
| 265 | Ga0207702_10108403 | 3300026078 | Bacteria | 2464 |
| 266 | Ga0207702_10138984 | 3300026078 | Bacteria | 2196 |
| 267 | Ga0207641_10010430 | 3300026088 | Bacteria | 7635 |
| 268 | Ga0207641_10418873 | 3300026088 | Bacteria | 1289 |
| 269 | Ga0207648_10012278 | 3300026089 | Bacteria | 8020 |
| 270 | Ga0207648_10015184 | 3300026089 | Bacteria | 7088 |
| 271 | Ga0207648_10031802 | 3300026089 | Bacteria | 4663 |
| 272 | Ga0207676_10001530 | 3300026095 | Bacteria | 17068 |
| 273 | Ga0207676_10007595 | 3300026095 | Bacteria | 7696 |
| 274 | Ga0207676_10009147 | 3300026095 | Bacteria | 7052 |
| 275 | Ga0207676_10032741 | 3300026095 | Bacteria | 3921 |
| 276 | Ga0207676_10046205 | 3300026095 | Bacteria | 3368 |
| 277 | Ga0207676_10286517 | 3300026095 | Bacteria | 1498 |
| 278 | Ga0207674_10003960 | 3300026116 | Bacteria | 18007 |
| 279 | Ga0207675_100040881 | 3300026118 | Bacteria | 4331 |
| 280 | Ga0207675_100044150 | 3300026118 | Bacteria | 4164 |
| 281 | Ga0207675_100081085 | 3300026118 | Bacteria | 3042 |
| 282 | Ga0207683_10000581 | 3300026121 | Bacteria | 33773 |
| 283 | Ga0207683_10000755 | 3300026121 | Bacteria | 29385 |
| 284 | Ga0207683_10021344 | 3300026121 | Bacteria | 5542 |
| 285 | Ga0207683_10070780 | 3300026121 | Bacteria | 3082 |
| 286 | Ga0207698_10000953 | 3300026142 | Bacteria | 16813 |
| 287 | Ga0209967_1001698 | 3300027364 | Bacteria | 2830 |
| 288 | Ga0209179_1003214 | 3300027512 | Bacteria | 2325 |
| 289 | Ga0209999_1005118 | 3300027543 | Bacteria | 2359 |
| 290 | Ga0209588_1000009 | 3300027671 | Bacteria | 174900 |
| 291 | Ga0209974_10001468 | 3300027876 | Bacteria | 8552 |
| 292 | Ga0207428_10006759 | 3300027907 | Bacteria | 10522 |
| 293 | Ga0268266_10411813 | 3300028379 | Bacteria | 1280 |
| 294 | Ga0268265_10001944 | 3300028380 | Bacteria | 16407 |
| 295 | Ga0268265_10087925 | 3300028380 | Bacteria | 2474 |
| 296 | Ga0268265_10186540 | 3300028380 | Bacteria | 1787 |
| 297 | Ga0268265_10275676 | 3300028380 | Bacteria | 1502 |
| 298 | Ga0268264_10009120 | 3300028381 | Bacteria | 8226 |
| 299 | Ga0268264_10357760 | 3300028381 | Bacteria | 1391 |
| 300 | Ga0265318_10006701 | 3300028577 | Bacteria | 5277 |
| 301 | Ga0265318_10027395 | 3300028577 | Bacteria | 2240 |
| 302 | Ga0307515_10063235 | 3300028794 | Bacteria | 5205 |
| 303 | Ga0265338_10053521 | 3300028800 | Bacteria | 3610 |
| 304 | Ga0265332_10000310 | 3300031238 | Bacteria | 37390 |
| 305 | Ga0265332_10003853 | 3300031238 | Bacteria | 7164 |
| 306 | Ga0265332_10015644 | 3300031238 | Bacteria | 3349 |
| 307 | Ga0265332_10060909 | 3300031238 | Bacteria | 1614 |
| 308 | Ga0265328_10028090 | 3300031239 | Bacteria | 2106 |
| 309 | Ga0265320_10019572 | 3300031240 | Bacteria | 3698 |
| 310 | Ga0265320_10033117 | 3300031240 | Bacteria | 2640 |
| 311 | Ga0265325_10006109 | 3300031241 | Bacteria | 7355 |
| 312 | Ga0265329_10011028 | 3300031242 | Bacteria | 3296 |
| 313 | Ga0265340_10006782 | 3300031247 | Bacteria | 6268 |
| 314 | Ga0265339_10001481 | 3300031249 | Bacteria | 17344 |
| 315 | Ga0265331_10004097 | 3300031250 | Bacteria | 9158 |
| 316 | Ga0265331_10024928 | 3300031250 | Bacteria | 3022 |
| 317 | Ga0265331_10033074 | 3300031250 | Bacteria | 2558 |
| 318 | Ga0265316_10118829 | 3300031344 | Bacteria | 1997 |
| 319 | Ga0265316_10258394 | 3300031344 | Bacteria | 1278 |
| 320 | Ga0316579_10033433 | 3300031691 | Bacteria | 2361 |
| 321 | Ga0265314_10106115 | 3300031711 | Bacteria | 1795 |
| 322 | Ga0265342_10000175 | 3300031712 | Bacteria | 71083 |
| 323 | Ga0265342_10023796 | 3300031712 | Bacteria | 3871 |
| 324 | Ga0265342_10174231 | 3300031712 | Bacteria | 1181 |
| 325 | Ga0316576_10014919 | 3300031727 | Bacteria | 5198 |
| 326 | Ga0307516_10002086 | 3300031730 | Bacteria | 27199 |
| 327 | Ga0307516_10084832 | 3300031730 | Bacteria | 3006 |
| 328 | Ga0307405_10022972 | 3300031731 | Bacteria | 3536 |
| 329 | Ga0307405_10416536 | 3300031731 | Bacteria | 1056 |
| 330 | Ga0316577_10008457 | 3300031733 | Bacteria | 5518 |
| 331 | Ga0307413_10251226 | 3300031824 | Bacteria | 1312 |
| 332 | Ga0307410_10296870 | 3300031852 | Bacteria | 1273 |
| 333 | Ga0307407_10017234 | 3300031903 | Bacteria | 3618 |
| 334 | Ga0307416_100007220 | 3300032002 | Bacteria | 7039 |
| 335 | Ga0307411_10226459 | 3300032005 | Bacteria | 1454 |
| 336 | Ga0373934_0039193 | 3300035086 | Bacteria | 1867 |
| 337 | Ga0373923_0000157 | 3300035111 | Bacteria | 13326 |
| 338 | Ga0373936_0035416 | 3300035113 | Bacteria | 1987 |
| 339 | Ga0373945_0004209 | 3300035116 | Bacteria | 4561 |
| 340 | Ga0373953_0007423 | 3300035117 | Bacteria | 3671 |
| 341 | Ga0373954_0029599 | 3300035118 | Bacteria | 2522 |
| 342 | Ga0373943_0001586 | 3300035170 | Bacteria | 10296 |
| 343 | Ga0373943_0043005 | 3300035170 | Bacteria | 2192 |
| 344 | Ga0373943_0094381 | 3300035170 | Bacteria | 1554 |
| 345 | Ga0373946_0003086 | 3300035171 | Bacteria | 5900 |
| 346 | Ga0373955_0000562 | 3300035172 | Bacteria | 15770 |
| 347 | Ga0373962_0005165 | 3300035242 | Bacteria | 3155 |
| 348 | Ga0316574_0136391 | 3300035398 | Bacteria | 1580 |
| 349 | Ga0373924_0005771 | 3300035410 | Bacteria | 4402 |
| 350 | Ga0373935_0255045 | 3300035692 | Bacteria | 1228 |
| 351 | Ga0373933_0045120 | 3300035724 | Bacteria | 2613 |
| 352 | Ga0373947_0049565 | 3300035725 | Bacteria | 2522 |
| 353 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 354 | Ga0316582_0199445 | 3300036647 | Bacteria | 1365 |
| 355 | Ga0316584_0033327 | 3300036712 | Bacteria | 3815 |
| 356 | Ga0373925_0000194 | 3300037068 | Bacteria | 66124 |
| 357 | Ga0373925_0004439 | 3300037068 | Bacteria | 10600 |
| 358 | Ga0373925_0007047 | 3300037068 | Bacteria | 8213 |
| 359 | Ga0373925_0024598 | 3300037068 | Bacteria | 4398 |
| 360 | Ga0373925_0091665 | 3300037068 | Bacteria | 2324 |
| 361 | Ga0373925_0115129 | 3300037068 | Bacteria | 2082 |
| 362 | Ga0395905_0001088 | 3300037471 | Bacteria | 34174 |
| 363 | Ga0395905_0173156 | 3300037471 | Bacteria | 2027 |
| 364 | Ga0436364_0104023 | 3300037853 | Bacteria | 1128 |
| 365 | Ga0436364_0216969 | 3300037853 | Unclassified | 1032 |
| 366 | Ga0436365_0047572 | 3300039437 | Bacteria | 8696 |
| 367 | Ga0436365_0803180 | 3300039437 | Bacteria | 1528 |
| 368 | Ga0436365_1535122 | 3300039437 | Bacteria | 8641 |
| 369 | Ga0436365_1613453 | 3300039437 | Bacteria | 24235 |
| 370 | Ga0436361_0668552 | 3300039447 | Bacteria | 2982 |
| 371 | Ga0436363_0153896 | 3300039450 | Bacteria | 3361 |
| 372 | Ga0436363_0979456 | 3300039450 | Bacteria | 1052 |
| 373 | Ga0436362_0471479 | 3300039453 | Bacteria | 6434 |
| 374 | Ga0439461_0013081 | 3300041410 | Bacteria | 1562 |
| 375 | Ga0439435_0000853 | 3300042436 | Bacteria | 5221 |
| 376 | Ga0439435_0025327 | 3300042436 | Bacteria | 1572 |
| 377 | Ga0495592_0000018 | 3300046454 | Bacteria | 140962 |
| 378 | Ga0495603_0036468 | 3300046455 | Bacteria | 2952 |
| 379 | Ga0495629_0005894 | 3300046459 | Bacteria | 9132 |
| 380 | Ga0495629_0103941 | 3300046459 | Bacteria | 1981 |
| 381 | Ga0495638_0007358 | 3300046460 | Bacteria | 7903 |
| 382 | Ga0495638_0025383 | 3300046460 | Bacteria | 3853 |
| 383 | Ga0495651_0002271 | 3300046462 | Bacteria | 14833 |
| 384 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 385 | Ga0495580_0314286 | 3300046472 | Bacteria | 1065 |
| 386 | Ga0495582_0005975 | 3300046473 | Bacteria | 6784 |
| 387 | Ga0495582_0039554 | 3300046473 | Bacteria | 2596 |
| 388 | Ga0495605_0063268 | 3300046474 | Bacteria | 1765 |
| 389 | Ga0495639_0081300 | 3300046475 | Bacteria | 1510 |
| 390 | Ga0495639_0106743 | 3300046475 | Bacteria | 1326 |
| 391 | Ga0495662_0007065 | 3300046476 | Bacteria | 5576 |
| 392 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 393 | Ga0495584_0040269 | 3300046491 | Bacteria | 2359 |
| 394 | Ga0495584_0045185 | 3300046491 | Bacteria | 2222 |
| 395 | Ga0495607_0098868 | 3300046501 | Bacteria | 1566 |
| 396 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 397 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 398 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 399 | Ga0495628_0074585 | 3300046516 | Bacteria | 2642 |
| 400 | Ga0495630_0005324 | 3300046517 | Bacteria | 9079 |
| 401 | Ga0495630_0193828 | 3300046517 | Bacteria | 1550 |
| 402 | Ga0495644_0013428 | 3300046523 | Bacteria | 3143 |
| 403 | Ga0495663_0068005 | 3300046525 | Bacteria | 1130 |
| 404 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 405 | Ga0495654_0076317 | 3300046530 | Bacteria | 1579 |
| 406 | Ga0495665_0012720 | 3300046531 | Bacteria | 4554 |
| 407 | Ga0495640_0000009 | 3300046533 | Bacteria | 217086 |
| 408 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 409 | Ga0495587_0018219 | 3300046536 | Bacteria | 4355 |
| 410 | Ga0495621_0020602 | 3300046539 | Bacteria | 2166 |
| 411 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 412 | Ga0495633_0019278 | 3300046558 | Bacteria | 3451 |
| 413 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 414 | Ga0495667_0194649 | 3300046559 | Bacteria | 1298 |
| 415 | Ga0495656_0033241 | 3300046615 | Bacteria | 2104 |
| 416 | Ga0495668_0019322 | 3300046616 | Bacteria | 3929 |
| 417 | Ga0495668_0084296 | 3300046616 | Bacteria | 1743 |
| 418 | Ga0495634_0000223 | 3300046642 | Bacteria | 53103 |
| 419 | Ga0495625_0083178 | 3300046660 | Bacteria | 2225 |
| 420 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 421 | Ga0495588_0031067 | 3300046674 | Bacteria | 2687 |
| 422 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 423 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 424 | Ga0495623_0000085 | 3300046679 | Bacteria | 55527 |
| 425 | Ga0495646_0000021 | 3300046680 | Bacteria | 115358 |
| 426 | Ga0495647_0019538 | 3300046681 | Bacteria | 2423 |
| 427 | Ga0495658_0049538 | 3300046683 | Bacteria | 2373 |
| 428 | Ga0495658_0128265 | 3300046683 | Bacteria | 1541 |
| 429 | Ga0495658_0208317 | 3300046683 | Bacteria | 1221 |
| 430 | Ga0495669_0094739 | 3300046684 | Bacteria | 1382 |
| 431 | Ga0495613_0016426 | 3300046689 | Bacteria | 5513 |
| 432 | Ga0495624_0094266 | 3300046690 | Bacteria | 1845 |
| 433 | Ga0495670_0050454 | 3300046691 | Bacteria | 2083 |
| 434 | Ga0495589_0094778 | 3300046794 | Bacteria | 1448 |
| 435 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 436 | Ga0495581_0046995 | 3300047315 | Bacteria | 2494 |
| 437 | Ga0495581_0161680 | 3300047315 | Bacteria | 1309 |
| 438 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 439 | Ga0495604_0073579 | 3300047317 | Bacteria | 2579 |
| 440 | Ga0495636_0091357 | 3300047318 | Bacteria | 1322 |
| 441 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 442 | Ga0495676_0080664 | 3300047321 | Bacteria | 2469 |
| 443 | Ga0495680_0001281 | 3300047322 | Bacteria | 27427 |
| 444 | Ga0495680_0347626 | 3300047322 | Bacteria | 1033 |
| 445 | Ga0495675_0000096 | 3300047444 | Bacteria | 62617 |
| 446 | Ga0495684_0000084 | 3300047471 | Bacteria | 65600 |
| 447 | Ga0495593_0001526 | 3300047673 | Bacteria | 13624 |
| 448 | Ga0495602_0000073 | 3300048088 | Bacteria | 98745 |
| 449 | Ga0495615_0033202 | 3300048090 | Bacteria | 1249 |
| 450 | Ga0496100_0015237 | 3300048903 | Bacteria | 4486 |
| 451 | Ga0496100_0028490 | 3300048903 | Bacteria | 3445 |
| 452 | Ga0496100_0065531 | 3300048903 | Bacteria | 2407 |
| 453 | Ga0496100_0107444 | 3300048903 | Bacteria | 1933 |
| 454 | Ga0496100_0144316 | 3300048903 | Bacteria | 1691 |
| 455 | Ga0496101_0014939 | 3300048904 | Bacteria | 5224 |
| 456 | Ga0496101_0015869 | 3300048904 | Bacteria | 5083 |
| 457 | Ga0496102_0028797 | 3300048905 | Bacteria | 4965 |
| 458 | Ga0496102_0080917 | 3300048905 | Bacteria | 2994 |
| 459 | Ga0496102_0092173 | 3300048905 | Bacteria | 2806 |
| 460 | Ga0496102_0212232 | 3300048905 | Unclassified | 1825 |
| 461 | Ga0496103_0005890 | 3300048906 | Bacteria | 7326 |
| 462 | Ga0496104_0000445 | 3300048907 | Bacteria | 35921 |
| 463 | Ga0496104_0001219 | 3300048907 | Bacteria | 22114 |
| 464 | Ga0496104_0002378 | 3300048907 | Bacteria | 16215 |
| 465 | Ga0496104_0077142 | 3300048907 | Bacteria | 3174 |
| 466 | Ga0496104_0446002 | 3300048907 | Bacteria | 1206 |
| 467 | Ga0496105_0046477 | 3300048908 | Bacteria | 3583 |
| 468 | Ga0496106_0000388 | 3300048909 | Bacteria | 31323 |
| 469 | Ga0496106_0004954 | 3300048909 | Bacteria | 9851 |
| 470 | Ga0496106_0230729 | 3300048909 | Bacteria | 1478 |
| 471 | Ga0496107_0004447 | 3300048910 | Bacteria | 9503 |
| 472 | Ga0496107_0022084 | 3300048910 | Bacteria | 4496 |
| 473 | Ga0496107_0081615 | 3300048910 | Bacteria | 2358 |
| 474 | Ga0496108_0003673 | 3300048911 | Bacteria | 12302 |
| 475 | Ga0496108_0004728 | 3300048911 | Bacteria | 10980 |
| 476 | Ga0496108_0062222 | 3300048911 | Bacteria | 3143 |
| 477 | Ga0496109_0001694 | 3300048912 | Bacteria | 18370 |
| 478 | Ga0496109_0001818 | 3300048912 | Bacteria | 17745 |
| 479 | Ga0496109_0004263 | 3300048912 | Bacteria | 11944 |
| 480 | Ga0496110_0002379 | 3300048913 | Bacteria | 14095 |
| 481 | Ga0496110_0004198 | 3300048913 | Bacteria | 11135 |
| 482 | Ga0496110_0413055 | 3300048913 | Bacteria | 1230 |
| 483 | Ga0496110_0466053 | 3300048913 | Bacteria | 1151 |
| 484 | Ga0496110_0567569 | 3300048913 | Bacteria | 1031 |
| 485 | Ga0496111_0000375 | 3300048914 | Bacteria | 22279 |
| 486 | Ga0496111_0007514 | 3300048914 | Bacteria | 7150 |
| 487 | Ga0496111_0359750 | 3300048914 | Bacteria | 1077 |
| 488 | Ga0496112_0009605 | 3300048915 | Bacteria | 8726 |
| 489 | Ga0496112_0074254 | 3300048915 | Bacteria | 3362 |
| 490 | Ga0496112_0108034 | 3300048915 | Bacteria | 2752 |
| 491 | Ga0496112_0438064 | 3300048915 | Bacteria | 1245 |
| 492 | Ga0496113_0014110 | 3300048916 | Bacteria | 5438 |
| 493 | Ga0496113_0016155 | 3300048916 | Bacteria | 5152 |
| 494 | Ga0496113_0049815 | 3300048916 | Bacteria | 3120 |
| 495 | Ga0496113_0108789 | 3300048916 | Bacteria | 2155 |
| 496 | Ga0496114_0018470 | 3300048917 | Bacteria | 5638 |
| 497 | Ga0496114_0052250 | 3300048917 | Bacteria | 3404 |
| 498 | Ga0496114_0197813 | 3300048917 | Unclassified | 1760 |
| 499 | Ga0496114_0287434 | 3300048917 | Bacteria | 1450 |
| 500 | Ga0496115_0045185 | 3300048918 | Bacteria | 3516 |
| 501 | Ga0496115_0113604 | 3300048918 | Bacteria | 2225 |
| 502 | Ga0496115_0158594 | 3300048918 | Bacteria | 1869 |
| 503 | Ga0496115_0250833 | 3300048918 | Bacteria | 1457 |
| 504 | Ga0496121_0240390 | 3300048924 | Bacteria | 1262 |
| 505 | Ga0501031_0020357 | 3300049568 | Bacteria | 4324 |
| 506 | Ga0501033_0023284 | 3300049570 | Bacteria | 4671 |
| 507 | Ga0501033_0026890 | 3300049570 | Bacteria | 4329 |
| 508 | Ga0501033_0035637 | 3300049570 | Bacteria | 3730 |
| 509 | Ga0501034_0004413 | 3300049571 | Bacteria | 15657 |
| 510 | Ga0501036_0015406 | 3300049572 | Bacteria | 6385 |
| 511 | Ga0501036_0018718 | 3300049572 | Bacteria | 5807 |
| 512 | Ga0501036_0020831 | 3300049572 | Bacteria | 5507 |
| 513 | Ga0501036_0034448 | 3300049572 | Bacteria | 4283 |
| 514 | Ga0501036_0212713 | 3300049572 | Bacteria | 1624 |
| 515 | Ga0501037_0012501 | 3300049573 | Bacteria | 6253 |
| 516 | Ga0501037_0027717 | 3300049573 | Bacteria | 4186 |
| 517 | Ga0501037_0085302 | 3300049573 | Bacteria | 2286 |
| 518 | Ga0501038_0001483 | 3300049574 | Bacteria | 21610 |
| 519 | Ga0501038_0039646 | 3300049574 | Bacteria | 4119 |
| 520 | Ga0501038_0081595 | 3300049574 | Bacteria | 2724 |
| 521 | Ga0501039_0002955 | 3300049575 | Bacteria | 12718 |
| 522 | Ga0501039_0014481 | 3300049575 | Bacteria | 6038 |
| 523 | Ga0501039_0106253 | 3300049575 | Bacteria | 2192 |
| 524 | Ga0501039_0138657 | 3300049575 | Bacteria | 1910 |
| 525 | Ga0501040_0002082 | 3300049576 | Bacteria | 12885 |
| 526 | Ga0501040_0017695 | 3300049576 | Bacteria | 4730 |
| 527 | Ga0501040_0038640 | 3300049576 | Bacteria | 3244 |
| 528 | Ga0501040_0041694 | 3300049576 | Bacteria | 3126 |
| 529 | Ga0501040_0043695 | 3300049576 | Bacteria | 3055 |
| 530 | Ga0501041_0002051 | 3300049577 | Bacteria | 11341 |
| 531 | Ga0501041_0003848 | 3300049577 | Bacteria | 8632 |
| 532 | Ga0501041_0004416 | 3300049577 | Bacteria | 8132 |
| 533 | Ga0501041_0044025 | 3300049577 | Bacteria | 2713 |
| 534 | Ga0501041_0098880 | 3300049577 | Bacteria | 1805 |
| 535 | Ga0501042_0006501 | 3300049578 | Bacteria | 7589 |
| 536 | Ga0501042_0008572 | 3300049578 | Bacteria | 6762 |
| 537 | Ga0501042_0035032 | 3300049578 | Bacteria | 3561 |
| 538 | Ga0501042_0059051 | 3300049578 | Bacteria | 2738 |
| 539 | Ga0501042_0146936 | 3300049578 | Bacteria | 1700 |
| 540 | Ga0501042_0221097 | 3300049578 | Bacteria | 1366 |
| 541 | Ga0501043_0025776 | 3300049579 | Bacteria | 4612 |
| 542 | Ga0501043_0028283 | 3300049579 | Bacteria | 4400 |
| 543 | Ga0501043_0067206 | 3300049579 | Bacteria | 2815 |
| 544 | Ga0501046_0005973 | 3300049580 | Bacteria | 10837 |
| 545 | Ga0501046_0010727 | 3300049580 | Bacteria | 7858 |
| 546 | Ga0501046_0079239 | 3300049580 | Bacteria | 2540 |
| 547 | Ga0501046_0080472 | 3300049580 | Bacteria | 2517 |
| 548 | Ga0501046_0102555 | 3300049580 | Bacteria | 2193 |
| 549 | Ga0501046_0105293 | 3300049580 | Bacteria | 2161 |
| 550 | Ga0501047_0407601 | 3300049581 | Bacteria | 1192 |
| 551 | Ga0501048_0017493 | 3300049582 | Bacteria | 5278 |
| 552 | Ga0501048_0028264 | 3300049582 | Bacteria | 4071 |
| 553 | Ga0501048_0087749 | 3300049582 | Bacteria | 2194 |
| 554 | Ga0501068_0009909 | 3300049584 | Bacteria | 5340 |
| 555 | Ga0501068_0021171 | 3300049584 | Bacteria | 3795 |
| 556 | Ga0501068_0073670 | 3300049584 | Bacteria | 2086 |
| 557 | Ga0501068_0228745 | 3300049584 | Bacteria | 1182 |
| 558 | Ga0501069_0106615 | 3300049585 | Bacteria | 1593 |
| 559 | Ga0501069_0190503 | 3300049585 | Bacteria | 1187 |
| 560 | Ga0501071_0032246 | 3300049587 | Bacteria | 3719 |
| 561 | Ga0501071_0041132 | 3300049587 | Bacteria | 3309 |
| 562 | Ga0501071_0055178 | 3300049587 | Bacteria | 2868 |
| 563 | Ga0501071_0282318 | 3300049587 | Bacteria | 1257 |
| 564 | Ga0501072_0001271 | 3300049588 | Bacteria | 18833 |
| 565 | Ga0501072_0009293 | 3300049588 | Bacteria | 7471 |
| 566 | Ga0501072_0038467 | 3300049588 | Bacteria | 3755 |
| 567 | Ga0501072_0120850 | 3300049588 | Bacteria | 2087 |
| 568 | Ga0501072_0285854 | 3300049588 | Bacteria | 1311 |
| 569 | Ga0501073_0002264 | 3300049589 | Bacteria | 14398 |
| 570 | Ga0501074_0001230 | 3300049590 | Bacteria | 16892 |
| 571 | Ga0501074_0064092 | 3300049590 | Bacteria | 2646 |
| 572 | Ga0501074_0076131 | 3300049590 | Bacteria | 2409 |
| 573 | Ga0501074_0079731 | 3300049590 | Bacteria | 2349 |
| 574 | Ga0501074_0085815 | 3300049590 | Bacteria | 2255 |
| 575 | Ga0501074_0337020 | 3300049590 | Bacteria | 1070 |
| 576 | Ga0501075_0003461 | 3300049591 | Bacteria | 10555 |
| 577 | Ga0501075_0012910 | 3300049591 | Bacteria | 5950 |
| 578 | Ga0501075_0016310 | 3300049591 | Bacteria | 5348 |
| 579 | Ga0501075_0026034 | 3300049591 | Bacteria | 4301 |
| 580 | Ga0501075_0045440 | 3300049591 | Bacteria | 3296 |
| 581 | Ga0501075_0058529 | 3300049591 | Bacteria | 2902 |
| 582 | Ga0501076_0006995 | 3300049592 | Bacteria | 8196 |
| 583 | Ga0501076_0010342 | 3300049592 | Bacteria | 6919 |
| 584 | Ga0501076_0036537 | 3300049592 | Bacteria | 3849 |
| 585 | Ga0501076_0335648 | 3300049592 | Bacteria | 1240 |
| 586 | Ga0501076_0398644 | 3300049592 | Bacteria | 1131 |
| 587 | Ga0501077_0037560 | 3300049593 | Bacteria | 3084 |
| 588 | Ga0501077_0113646 | 3300049593 | Bacteria | 1717 |
| 589 | Ga0501077_0194975 | 3300049593 | Bacteria | 1287 |
| 590 | Ga0501079_0001328 | 3300049741 | Bacteria | 17387 |
| 591 | Ga0501079_0004670 | 3300049741 | Bacteria | 10145 |
| 592 | Ga0501079_0052091 | 3300049741 | Bacteria | 3160 |
| 593 | Ga0501079_0056402 | 3300049741 | Bacteria | 3031 |
| 594 | Ga0501079_0066529 | 3300049741 | Bacteria | 2781 |
| 595 | Ga0501080_0005631 | 3300049742 | Bacteria | 11193 |
| 596 | Ga0501080_0048254 | 3300049742 | Bacteria | 3963 |
| 597 | Ga0501080_0055289 | 3300049742 | Bacteria | 3697 |
| 598 | Ga0501080_0351334 | 3300049742 | Bacteria | 1331 |
| 599 | Ga0501081_0000347 | 3300049743 | Bacteria | 24912 |
| 600 | Ga0501081_0009005 | 3300049743 | Bacteria | 6488 |
| 601 | Ga0501081_0010042 | 3300049743 | Bacteria | 6172 |
| 602 | Ga0501081_0010184 | 3300049743 | Bacteria | 6135 |
| 603 | Ga0501081_0027372 | 3300049743 | Bacteria | 3846 |
| 604 | Ga0501081_0038104 | 3300049743 | Bacteria | 3282 |
| 605 | Ga0501081_0041336 | 3300049743 | Bacteria | 3157 |
| 606 | Ga0501081_0048196 | 3300049743 | Bacteria | 2932 |
| 607 | Ga0501081_0162780 | 3300049743 | Bacteria | 1608 |
| 608 | Ga0501083_0005244 | 3300049744 | Bacteria | 9166 |
| 609 | Ga0501083_0008226 | 3300049744 | Bacteria | 7375 |
| 610 | Ga0501083_0013741 | 3300049744 | Bacteria | 5662 |
| 611 | Ga0501083_0051936 | 3300049744 | Bacteria | 2755 |
| 612 | Ga0501083_0249010 | 3300049744 | Bacteria | 1157 |
| 613 | Ga0501035_0217947 | 3300049822 | Bacteria | 1630 |
| 614 | Ga0501035_0479243 | 3300049822 | Bacteria | 1026 |
| 615 | Ga0501044_0059434 | 3300049823 | Bacteria | 3916 |
| 616 | Ga0501044_0174210 | 3300049823 | Bacteria | 2121 |
| 617 | Ga0501045_0001638 | 3300049824 | Bacteria | 15023 |
| 618 | Ga0501045_0011396 | 3300049824 | Bacteria | 6243 |
| 619 | Ga0501045_0021776 | 3300049824 | Bacteria | 4588 |
| 620 | Ga0501045_0024960 | 3300049824 | Bacteria | 4294 |
| 621 | nmdc:mga03683_12449_c1 | 3300050489 | Bacteria | 3108 |
| 622 | nmdc:mga03683_762_c1 | 3300050489 | Bacteria | 9224 |
| 623 | nmdc:mga03n38_66496_c1 | 3300050490 | Bacteria | 1656 |
| 624 | nmdc:mga03n38_8935_c1 | 3300050490 | Bacteria | 3618 |
| 625 | nmdc:mga00v17_207188_c1 | 3300050491 | Bacteria | 1268 |
| 626 | nmdc:mga0yw44_12424_c1 | 3300050492 | Bacteria | 4438 |
| 627 | nmdc:mga0yw44_3606_c1 | 3300050492 | Bacteria | 6907 |
| 628 | nmdc:mga0yw44_7591_c1 | 3300050492 | Bacteria | 5347 |
| 629 | nmdc:mga0yw44_86722_c1 | 3300050492 | Bacteria | 1972 |
| 630 | nmdc:mga0k408_7030_c1 | 3300050493 | Bacteria | 6007 |
| 631 | nmdc:mga06z11_45959_c1 | 3300050494 | Bacteria | 2210 |
| 632 | nmdc:mga07m45_65286_c1 | 3300050496 | Bacteria | 2066 |
| 633 | nmdc:mga05p37_98899_c1 | 3300050507 | Bacteria | 3594 |
| 634 | nmdc:mga09592_114863_c1 | 3300050508 | Bacteria | 2311 |
| 635 | nmdc:mga09592_173869_c1 | 3300050508 | Bacteria | 1863 |
| 636 | nmdc:mga09592_291054_c1 | 3300050508 | Bacteria | 1416 |
| 637 | nmdc:mga09592_44949_c1 | 3300050508 | Bacteria | 3719 |
| 638 | nmdc:mga0qj67_17402_c1 | 3300050509 | Bacteria | 5464 |
| 639 | nmdc:mga0qj67_212311_c1 | 3300050509 | Bacteria | 1572 |
| 640 | nmdc:mga0qj67_71664_c1 | 3300050509 | Bacteria | 2766 |
| 641 | nmdc:mga06r32_199488_c1 | 3300050510 | Bacteria | 1989 |
| 642 | nmdc:mga06r32_218532_c1 | 3300050510 | Bacteria | 1894 |
| 643 | nmdc:mga08y16_11692_c1 | 3300050511 | Bacteria | 9224 |
| 644 | nmdc:mga08y16_119084_c1 | 3300050511 | Bacteria | 2748 |
| 645 | nmdc:mga08y16_58758_c1 | 3300050511 | Bacteria | 4018 |
| 646 | nmdc:mga08y16_96694_c1 | 3300050511 | Bacteria | 3075 |
| 647 | nmdc:mga0n895_106961_c1 | 3300050512 | Bacteria | 2810 |
| 648 | nmdc:mga0n895_115366_c1 | 3300050512 | Bacteria | 2704 |
| 649 | nmdc:mga0n895_132887_c1 | 3300050512 | Bacteria | 2514 |
| 650 | nmdc:mga0n895_549856_c1 | 3300050512 | Bacteria | 1160 |
| 651 | nmdc:mga0n895_73249_c1 | 3300050512 | Bacteria | 3400 |
| 652 | nmdc:mga08x19_110857_c1 | 3300050514 | Bacteria | 1830 |
| 653 | nmdc:mga08x19_21691_c1 | 3300050514 | Bacteria | 3969 |
| 654 | nmdc:mga08x19_294442_c1 | 3300050514 | Bacteria | 1126 |
| 655 | nmdc:mga0a205_24943_c1 | 3300050515 | Bacteria | 5041 |
| 656 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 657 | Ga0495601_0004968 | 3300053077 | Bacteria | 7718 |
| 658 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 659 | Ga0495612_0000090 | 3300053078 | Bacteria | 40215 |
| 660 | Ga0500610_0112927 | 3300053079 | Bacteria | 1395 |
| 661 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 662 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 663 | Ga0495619_0018391 | 3300053085 | Bacteria | 4434 |
| 664 | Ga0495619_0087536 | 3300053085 | Bacteria | 2106 |
| 665 | Ga0495619_0112881 | 3300053085 | Bacteria | 1858 |
| 666 | Ga0500593_002797 | 3300053117 | Bacteria | 6468 |
| 667 | Ga0500595_001729 | 3300053119 | Bacteria | 11391 |
| 668 | Ga0500588_0001660 | 3300053146 | Bacteria | 4308 |
| 669 | Ga0500588_0047309 | 3300053146 | Bacteria | 1326 |
| 670 | Ga0500604_0001281 | 3300053151 | Bacteria | 7035 |
| 671 | Ga0500604_0007299 | 3300053151 | Bacteria | 2929 |
| 672 | Ga0500616_0041337 | 3300053153 | Bacteria | 2475 |
| 673 | Ga0500627_0019554 | 3300053158 | Bacteria | 2701 |
| 674 | Ga0500627_0098299 | 3300053158 | Bacteria | 1313 |
| 675 | Ga0500637_0011014 | 3300053178 | Bacteria | 4655 |
| 676 | Ga0501084_0003640 | 3300054114 | Bacteria | 12515 |
| 677 | Ga0501084_0013611 | 3300054114 | Bacteria | 6731 |
| 678 | Ga0501084_0041440 | 3300054114 | Bacteria | 3852 |
| 679 | Ga0501084_0052208 | 3300054114 | Bacteria | 3421 |
| 680 | Ga0501084_0069409 | 3300054114 | Bacteria | 2950 |
| 681 | Ga0501082_0002535 | 3300060353 | Bacteria | 15994 |
| 682 | Ga0501082_0005369 | 3300060353 | Bacteria | 11118 |
| 683 | Ga0501082_0015536 | 3300060353 | Bacteria | 6554 |
| 684 | Ga0501082_0028880 | 3300060353 | Bacteria | 4778 |
| 685 | Ga0501082_0039944 | 3300060353 | Bacteria | 4048 |
| 686 | Ga0501082_0064574 | 3300060353 | Bacteria | 3152 |
| 687 | Ga0530510_0027909 | 3300061734 | Bacteria | 4045 |
| 688 | Ga0530510_0037230 | 3300061734 | Bacteria | 3507 |
| 689 | Ga0530510_0079593 | 3300061734 | Bacteria | 2384 |
| 690 | Ga0530510_0119304 | 3300061734 | Bacteria | 1936 |
| 691 | Ga0530510_0121744 | 3300061734 | Bacteria | 1915 |
| 692 | Ga0530510_0127595 | 3300061734 | Bacteria | 1870 |
| 693 | Ga0530510_0161347 | 3300061734 | Bacteria | 1658 |
| 694 | Ga0530510_0200050 | 3300061734 | Bacteria | 1483 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0012720 | Ga0495665_0012720_10_828 | 272 |
| 2 | 3300046683 | Ga0495658_0208317 | Ga0495658_0208317_23_847 | 274 |
| 3 | 3300047322 | Ga0495680_0347626 | Ga0495680_0347626_193_1017 | 274 |
| 4 | 3300035242 | Ga0373962_0005165 | Ga0373962_0005165_22_852 | 276 |
| 5 | 3300046473 | Ga0495582_0005975 | Ga0495582_0005975_19_849 | 276 |
| 6 | 3300046516 | Ga0495628_0074585 | Ga0495628_0074585_1773_2603 | 276 |
| 7 | 3300046536 | Ga0495587_0018219 | Ga0495587_0018219_19_849 | 276 |
| 8 | 3300047315 | Ga0495581_0046995 | Ga0495581_0046995_1646_2476 | 276 |
| 9 | 3300049587 | Ga0501071_0282318 | Ga0501071_0282318_12_854 | 280 |
| 10 | 3300049574 | Ga0501038_0039646 | Ga0501038_0039646_507_1433 | 286 |
| 11 | 3300049744 | Ga0501083_0249010 | Ga0501083_0249010_276_1145 | 289 |
| 12 | 3300048915 | Ga0496112_0438064 | Ga0496112_0438064_299_1171 | 290 |
| 13 | 3300053078 | Ga0495612_0000090 | Ga0495612_0000090_9990_10976 | 298 |
| 14 | 3300049590 | Ga0501074_0337020 | Ga0501074_0337020_13_927 | 300 |
| 15 | 3300049822 | Ga0501035_0479243 | Ga0501035_0479243_66_980 | 300 |
| 16 | 3300061734 | Ga0530510_0121744 | Ga0530510_0121744_988_1902 | 300 |
| 17 | 3300049824 | Ga0501045_0021776 | Ga0501045_0021776_1868_3121 | 306 |
| 18 | 3300006844 | Ga0075428_100005978 | Ga0075428_1000059788 | 308 |
| 19 | 3300027907 | Ga0207428_10006759 | Ga0207428_100067595 | 308 |
| 20 | 3300050508 | nmdc:mga09592_173869_c1 | nmdc:mga09592_173869_c1_772_1749 | 308 |
| 21 | 3300050511 | nmdc:mga08y16_11692_c1 | nmdc:mga08y16_11692_c1_5104_6081 | 308 |
| 22 | 3300035398 | Ga0316574_0136391 | Ga0316574_0136391_160_1137 | 309 |
| 23 | 3300037471 | Ga0395905_0173156 | Ga0395905_0173156_1082_2014 | 309 |
| 24 | 3300039450 | Ga0436363_0153896 | Ga0436363_0153896_31_960 | 309 |
| 25 | 3300048913 | Ga0496110_0466053 | Ga0496110_0466053_32_961 | 309 |
| 26 | 3300049585 | Ga0501069_0106615 | Ga0501069_0106615_308_1285 | 310 |
| 27 | 3300005545 | Ga0070695_100171523 | Ga0070695_1001715232 | 315 |
| 28 | 3300009094 | Ga0111539_10072415 | Ga0111539_100724153 | 315 |
| 29 | 3300014326 | Ga0157380_10187983 | Ga0157380_101879832 | 315 |
| 30 | 3300049584 | Ga0501068_0021171 | Ga0501068_0021171_38_994 | 315 |
| 31 | 3300050511 | nmdc:mga08y16_96694_c1 | nmdc:mga08y16_96694_c1_1108_2085 | 315 |
| 32 | 3300049744 | Ga0501083_0005244 | Ga0501083_0005244_2391_3641 | 318 |
| 33 | 3300031731 | Ga0307405_10416536 | Ga0307405_104165361 | 320 |
| 34 | iso_pu_bacteria | 2889790730 | 2889792695 | 321 |
| 35 | iso_pu_bacteria | 2889914905 | 2889918909 | 321 |
| 36 | iso_pu_bacteria | 2512875024 | 2512962156 | 322 |
| 37 | iso_pu_bacteria | 2869162929 | 2869166041 | 322 |
| 38 | iso_pu_bacteria | 2987652177 | 2987653346 | 322 |
| 39 | 3300031727 | Ga0316576_10014919 | Ga0316576_100149192 | 323 |
| 40 | 3300031733 | Ga0316577_10008457 | Ga0316577_100084574 | 323 |
| 41 | 3300036712 | Ga0316584_0033327 | Ga0316584_0033327_1587_2558 | 323 |
| 42 | 3300005336 | Ga0070680_100098358 | Ga0070680_1000983582 | 324 |
| 43 | 3300005341 | Ga0070691_10131909 | Ga0070691_101319092 | 324 |
| 44 | 3300005345 | Ga0070692_10051973 | Ga0070692_100519732 | 324 |
| 45 | 3300005438 | Ga0070701_10014594 | Ga0070701_100145943 | 324 |
| 46 | 3300005440 | Ga0070705_100000495 | Ga0070705_10000049517 | 324 |
| 47 | 3300005444 | Ga0070694_100015470 | Ga0070694_1000154707 | 324 |
| 48 | 3300005455 | Ga0070663_100082371 | Ga0070663_1000823713 | 324 |
| 49 | 3300005518 | Ga0070699_100000158 | Ga0070699_1000001588 | 324 |
| 50 | 3300005535 | Ga0070684_100016240 | Ga0070684_1000162402 | 324 |
| 51 | 3300005545 | Ga0070695_100009449 | Ga0070695_1000094492 | 324 |
| 52 | 3300005546 | Ga0070696_100010445 | Ga0070696_1000104452 | 324 |
| 53 | 3300005549 | Ga0070704_100009759 | Ga0070704_1000097597 | 324 |
| 54 | 3300005577 | Ga0068857_100056849 | Ga0068857_1000568495 | 324 |
| 55 | 3300005615 | Ga0070702_100038821 | Ga0070702_1000388213 | 324 |
| 56 | 3300005841 | Ga0068863_100017201 | Ga0068863_1000172012 | 324 |
| 57 | 3300005842 | Ga0068858_100220300 | Ga0068858_1002203002 | 324 |
| 58 | 3300005843 | Ga0068860_100005729 | Ga0068860_1000057292 | 324 |
| 59 | 3300005844 | Ga0068862_100001649 | Ga0068862_10000164914 | 324 |
| 60 | 3300005985 | Ga0081539_10039440 | Ga0081539_100394402 | 324 |
| 61 | 3300006846 | Ga0075430_100001391 | Ga0075430_10000139118 | 324 |
| 62 | 3300006847 | Ga0075431_100007118 | Ga0075431_10000711811 | 324 |
| 63 | 3300009553 | Ga0105249_10000475 | Ga0105249_1000047533 | 324 |
| 64 | 3300013306 | Ga0163162_10145173 | Ga0163162_101451732 | 324 |
| 65 | 3300014325 | Ga0163163_10069852 | Ga0163163_100698524 | 324 |
| 66 | 3300014326 | Ga0157380_10284305 | Ga0157380_102843051 | 324 |
| 67 | 3300014745 | Ga0157377_10013216 | Ga0157377_100132163 | 324 |
| 68 | 3300025908 | Ga0207643_10000132 | Ga0207643_100001323 | 324 |
| 69 | 3300025917 | Ga0207660_10122750 | Ga0207660_101227501 | 324 |
| 70 | 3300025921 | Ga0207652_10255689 | Ga0207652_102556891 | 324 |
| 71 | 3300025925 | Ga0207650_10016727 | Ga0207650_100167274 | 324 |
| 72 | 3300025961 | Ga0207712_10001185 | Ga0207712_1000118511 | 324 |
| 73 | 3300026067 | Ga0207678_10059999 | Ga0207678_100599992 | 324 |
| 74 | 3300026088 | Ga0207641_10418873 | Ga0207641_104188732 | 324 |
| 75 | 3300026095 | Ga0207676_10007595 | Ga0207676_100075954 | 324 |
| 76 | 3300026095 | Ga0207676_10032741 | Ga0207676_100327413 | 324 |
| 77 | 3300026116 | Ga0207674_10003960 | Ga0207674_100039607 | 324 |
| 78 | 3300026118 | Ga0207675_100081085 | Ga0207675_1000810853 | 324 |
| 79 | 3300028380 | Ga0268265_10001944 | Ga0268265_100019447 | 324 |
| 80 | 3300028380 | Ga0268265_10087925 | Ga0268265_100879252 | 324 |
| 81 | 3300028381 | Ga0268264_10009120 | Ga0268264_100091209 | 324 |
| 82 | 3300031824 | Ga0307413_10251226 | Ga0307413_102512262 | 324 |
| 83 | 3300031852 | Ga0307410_10296870 | Ga0307410_102968702 | 324 |
| 84 | 3300031903 | Ga0307407_10017234 | Ga0307407_100172343 | 324 |
| 85 | 3300035170 | Ga0373943_0043005 | Ga0373943_0043005_937_1911 | 324 |
| 86 | 3300048905 | Ga0496102_0028797 | Ga0496102_0028797_3401_4375 | 324 |
| 87 | 3300048906 | Ga0496103_0005890 | Ga0496103_0005890_505_1479 | 324 |
| 88 | 3300048909 | Ga0496106_0000388 | Ga0496106_0000388_23527_24501 | 324 |
| 89 | 3300048910 | Ga0496107_0004447 | Ga0496107_0004447_4604_5578 | 324 |
| 90 | 3300048912 | Ga0496109_0001818 | Ga0496109_0001818_10193_11167 | 324 |
| 91 | 3300049577 | Ga0501041_0098880 | Ga0501041_0098880_443_1417 | 324 |
| 92 | 3300049578 | Ga0501042_0221097 | Ga0501042_0221097_53_1027 | 324 |
| 93 | 3300049580 | Ga0501046_0079239 | Ga0501046_0079239_152_1126 | 324 |
| 94 | 3300049580 | Ga0501046_0105293 | Ga0501046_0105293_1083_2057 | 324 |
| 95 | 3300049592 | Ga0501076_0335648 | Ga0501076_0335648_148_1122 | 324 |
| 96 | 3300049743 | Ga0501081_0027372 | Ga0501081_0027372_2849_3823 | 324 |
| 97 | 3300049743 | Ga0501081_0041336 | Ga0501081_0041336_360_1334 | 324 |
| 98 | 3300049743 | Ga0501081_0048196 | Ga0501081_0048196_1840_2814 | 324 |
| 99 | 3300050508 | nmdc:mga09592_114863_c1 | nmdc:mga09592_114863_c1_1001_1975 | 324 |
| 100 | 3300050509 | nmdc:mga0qj67_71664_c1 | nmdc:mga0qj67_71664_c1_643_1617 | 324 |
| 101 | 3300060353 | Ga0501082_0039944 | Ga0501082_0039944_50_1024 | 324 |
| 102 | 3300061734 | Ga0530510_0127595 | Ga0530510_0127595_217_1191 | 324 |
| 103 | 3300061734 | Ga0530510_0200050 | Ga0530510_0200050_471_1445 | 324 |
| 104 | 3300005328 | Ga0070676_10119615 | Ga0070676_101196152 | 325 |
| 105 | 3300005329 | Ga0070683_100039965 | Ga0070683_1000399653 | 325 |
| 106 | 3300005329 | Ga0070683_100047446 | Ga0070683_1000474462 | 325 |
| 107 | 3300005329 | Ga0070683_100088335 | Ga0070683_1000883352 | 325 |
| 108 | 3300005331 | Ga0070670_100005194 | Ga0070670_1000051947 | 325 |
| 109 | 3300005331 | Ga0070670_100069160 | Ga0070670_1000691603 | 325 |
| 110 | 3300005331 | Ga0070670_100103417 | Ga0070670_1001034173 | 325 |
| 111 | 3300005333 | Ga0070677_10057758 | Ga0070677_100577582 | 325 |
| 112 | 3300005338 | Ga0068868_100000544 | Ga0068868_1000005448 | 325 |
| 113 | 3300005340 | Ga0070689_100050245 | Ga0070689_1000502452 | 325 |
| 114 | 3300005340 | Ga0070689_100061702 | Ga0070689_1000617023 | 325 |
| 115 | 3300005344 | Ga0070661_100014017 | Ga0070661_1000140172 | 325 |
| 116 | 3300005347 | Ga0070668_100024657 | Ga0070668_1000246573 | 325 |
| 117 | 3300005353 | Ga0070669_100081605 | Ga0070669_1000816051 | 325 |
| 118 | 3300005354 | Ga0070675_100015371 | Ga0070675_1000153712 | 325 |
| 119 | 3300005354 | Ga0070675_100108494 | Ga0070675_1001084942 | 325 |
| 120 | 3300005355 | Ga0070671_100016634 | Ga0070671_1000166342 | 325 |
| 121 | 3300005355 | Ga0070671_100035497 | Ga0070671_1000354972 | 325 |
| 122 | 3300005356 | Ga0070674_100095128 | Ga0070674_1000951282 | 325 |
| 123 | 3300005364 | Ga0070673_100005459 | Ga0070673_1000054592 | 325 |
| 124 | 3300005364 | Ga0070673_100148486 | Ga0070673_1001484862 | 325 |
| 125 | 3300005365 | Ga0070688_100055393 | Ga0070688_1000553932 | 325 |
| 126 | 3300005366 | Ga0070659_100039631 | Ga0070659_1000396314 | 325 |
| 127 | 3300005366 | Ga0070659_100057549 | Ga0070659_1000575492 | 325 |
| 128 | 3300005367 | Ga0070667_100169799 | Ga0070667_1001697992 | 325 |
| 129 | 3300005440 | Ga0070705_100277279 | Ga0070705_1002772791 | 325 |
| 130 | 3300005441 | Ga0070700_100126592 | Ga0070700_1001265922 | 325 |
| 131 | 3300005441 | Ga0070700_100276567 | Ga0070700_1002765671 | 325 |
| 132 | 3300005444 | Ga0070694_100126229 | Ga0070694_1001262292 | 325 |
| 133 | 3300005445 | Ga0070708_100003217 | Ga0070708_1000032178 | 325 |
| 134 | 3300005456 | Ga0070678_100000281 | Ga0070678_10000028114 | 325 |
| 135 | 3300005456 | Ga0070678_100113722 | Ga0070678_1001137222 | 325 |
| 136 | 3300005457 | Ga0070662_100102734 | Ga0070662_1001027342 | 325 |
| 137 | 3300005457 | Ga0070662_100143198 | Ga0070662_1001431982 | 325 |
| 138 | 3300005466 | Ga0070685_10010154 | Ga0070685_100101543 | 325 |
| 139 | 3300005467 | Ga0070706_100121271 | Ga0070706_1001212712 | 325 |
| 140 | 3300005468 | Ga0070707_100006922 | Ga0070707_1000069222 | 325 |
| 141 | 3300005535 | Ga0070684_100193002 | Ga0070684_1001930022 | 325 |
| 142 | 3300005536 | Ga0070697_100041288 | Ga0070697_1000412883 | 325 |
| 143 | 3300005536 | Ga0070697_100125137 | Ga0070697_1001251372 | 325 |
| 144 | 3300005539 | Ga0068853_100081302 | Ga0068853_1000813021 | 325 |
| 145 | 3300005543 | Ga0070672_100001595 | Ga0070672_10000159511 | 325 |
| 146 | 3300005543 | Ga0070672_100004204 | Ga0070672_1000042046 | 325 |
| 147 | 3300005544 | Ga0070686_100003659 | Ga0070686_1000036598 | 325 |
| 148 | 3300005544 | Ga0070686_100152520 | Ga0070686_1001525202 | 325 |
| 149 | 3300005547 | Ga0070693_100161697 | Ga0070693_1001616972 | 325 |
| 150 | 3300005548 | Ga0070665_100228361 | Ga0070665_1002283612 | 325 |
| 151 | 3300005564 | Ga0070664_100007947 | Ga0070664_1000079475 | 325 |
| 152 | 3300005578 | Ga0068854_100015614 | Ga0068854_1000156144 | 325 |
| 153 | 3300005615 | Ga0070702_100028493 | Ga0070702_1000284932 | 325 |
| 154 | 3300005616 | Ga0068852_100000200 | Ga0068852_10000020014 | 325 |
| 155 | 3300005617 | Ga0068859_100085823 | Ga0068859_1000858232 | 325 |
| 156 | 3300005618 | Ga0068864_100036691 | Ga0068864_1000366913 | 325 |
| 157 | 3300005618 | Ga0068864_100060098 | Ga0068864_1000600982 | 325 |
| 158 | 3300005618 | Ga0068864_100157016 | Ga0068864_1001570162 | 325 |
| 159 | 3300005718 | Ga0068866_10053799 | Ga0068866_100537992 | 325 |
| 160 | 3300005840 | Ga0068870_10060060 | Ga0068870_100600602 | 325 |
| 161 | 3300005841 | Ga0068863_100009972 | Ga0068863_1000099726 | 325 |
| 162 | 3300005841 | Ga0068863_100112376 | Ga0068863_1001123762 | 325 |
| 163 | 3300005843 | Ga0068860_100161614 | Ga0068860_1001616142 | 325 |
| 164 | 3300005844 | Ga0068862_100018237 | Ga0068862_1000182372 | 325 |
| 165 | 3300005844 | Ga0068862_100302721 | Ga0068862_1003027212 | 325 |
| 166 | 3300005985 | Ga0081539_10161189 | Ga0081539_101611891 | 325 |
| 167 | 3300006038 | Ga0075365_10053360 | Ga0075365_100533602 | 325 |
| 168 | 3300006178 | Ga0075367_10096575 | Ga0075367_100965752 | 325 |
| 169 | 3300006237 | Ga0097621_100003433 | Ga0097621_1000034336 | 325 |
| 170 | 3300006847 | Ga0075431_100024240 | Ga0075431_1000242404 | 325 |
| 171 | 3300006852 | Ga0075433_10026200 | Ga0075433_100262003 | 325 |
| 172 | 3300006871 | Ga0075434_100061854 | Ga0075434_1000618543 | 325 |
| 173 | 3300006931 | Ga0097620_100085819 | Ga0097620_1000858192 | 325 |
| 174 | 3300007265 | Ga0099794_10000104 | Ga0099794_1000010421 | 325 |
| 175 | 3300007265 | Ga0099794_10096702 | Ga0099794_100967022 | 325 |
| 176 | 3300009011 | Ga0105251_10086645 | Ga0105251_100866451 | 325 |
| 177 | 3300009094 | Ga0111539_10074818 | Ga0111539_100748182 | 325 |
| 178 | 3300009147 | Ga0114129_10457215 | Ga0114129_104572152 | 325 |
| 179 | 3300009176 | Ga0105242_10231955 | Ga0105242_102319552 | 325 |
| 180 | 3300009177 | Ga0105248_10071779 | Ga0105248_100717793 | 325 |
| 181 | 3300009177 | Ga0105248_10100379 | Ga0105248_101003792 | 325 |
| 182 | 3300010375 | Ga0105239_10012459 | Ga0105239_100124591 | 325 |
| 183 | 3300011119 | Ga0105246_10206033 | Ga0105246_102060332 | 325 |
| 184 | 3300011119 | Ga0105246_10238293 | Ga0105246_102382932 | 325 |
| 185 | 3300013296 | Ga0157374_10000653 | Ga0157374_1000065320 | 325 |
| 186 | 3300013297 | Ga0157378_10001132 | Ga0157378_1000113216 | 325 |
| 187 | 3300013306 | Ga0163162_10131050 | Ga0163162_101310503 | 325 |
| 188 | 3300013306 | Ga0163162_10335970 | Ga0163162_103359702 | 325 |
| 189 | 3300013308 | Ga0157375_10001703 | Ga0157375_1000170316 | 325 |
| 190 | 3300013308 | Ga0157375_10321053 | Ga0157375_103210532 | 325 |
| 191 | 3300014325 | Ga0163163_10021730 | Ga0163163_100217302 | 325 |
| 192 | 3300014326 | Ga0157380_10133590 | Ga0157380_101335902 | 325 |
| 193 | 3300014745 | Ga0157377_10009768 | Ga0157377_100097682 | 325 |
| 194 | 3300014968 | Ga0157379_10113188 | Ga0157379_101131881 | 325 |
| 195 | 3300014969 | Ga0157376_10020667 | Ga0157376_100206672 | 325 |
| 196 | 3300025315 | Ga0207697_10011678 | Ga0207697_100116782 | 325 |
| 197 | 3300025321 | Ga0207656_10020204 | Ga0207656_100202043 | 325 |
| 198 | 3300025893 | Ga0207682_10002135 | Ga0207682_100021353 | 325 |
| 199 | 3300025893 | Ga0207682_10059324 | Ga0207682_100593242 | 325 |
| 200 | 3300025901 | Ga0207688_10004400 | Ga0207688_100044004 | 325 |
| 201 | 3300025907 | Ga0207645_10006895 | Ga0207645_100068957 | 325 |
| 202 | 3300025907 | Ga0207645_10013908 | Ga0207645_100139085 | 325 |
| 203 | 3300025908 | Ga0207643_10002110 | Ga0207643_100021102 | 325 |
| 204 | 3300025912 | Ga0207707_10093239 | Ga0207707_100932392 | 325 |
| 205 | 3300025915 | Ga0207693_10024106 | Ga0207693_100241064 | 325 |
| 206 | 3300025920 | Ga0207649_10031311 | Ga0207649_100313112 | 325 |
| 207 | 3300025922 | Ga0207646_10091008 | Ga0207646_100910082 | 325 |
| 208 | 3300025925 | Ga0207650_10001197 | Ga0207650_100011979 | 325 |
| 209 | 3300025925 | Ga0207650_10003351 | Ga0207650_100033518 | 325 |
| 210 | 3300025925 | Ga0207650_10181740 | Ga0207650_101817402 | 325 |
| 211 | 3300025925 | Ga0207650_10274901 | Ga0207650_102749011 | 325 |
| 212 | 3300025926 | Ga0207659_10011997 | Ga0207659_100119974 | 325 |
| 213 | 3300025926 | Ga0207659_10029082 | Ga0207659_100290822 | 325 |
| 214 | 3300025931 | Ga0207644_10000669 | Ga0207644_100006697 | 325 |
| 215 | 3300025931 | Ga0207644_10127627 | Ga0207644_101276272 | 325 |
| 216 | 3300025932 | Ga0207690_10295359 | Ga0207690_102953591 | 325 |
| 217 | 3300025933 | Ga0207706_10003081 | Ga0207706_100030816 | 325 |
| 218 | 3300025933 | Ga0207706_10070011 | Ga0207706_100700113 | 325 |
| 219 | 3300025934 | Ga0207686_10014996 | Ga0207686_100149964 | 325 |
| 220 | 3300025934 | Ga0207686_10124121 | Ga0207686_101241212 | 325 |
| 221 | 3300025935 | Ga0207709_10172122 | Ga0207709_101721222 | 325 |
| 222 | 3300025936 | Ga0207670_10004147 | Ga0207670_100041471 | 325 |
| 223 | 3300025937 | Ga0207669_10063577 | Ga0207669_100635772 | 325 |
| 224 | 3300025938 | Ga0207704_10111779 | Ga0207704_101117792 | 325 |
| 225 | 3300025940 | Ga0207691_10000470 | Ga0207691_1000047019 | 325 |
| 226 | 3300025941 | Ga0207711_10012335 | Ga0207711_100123356 | 325 |
| 227 | 3300025944 | Ga0207661_10002744 | Ga0207661_100027448 | 325 |
| 228 | 3300025945 | Ga0207679_10047223 | Ga0207679_100472233 | 325 |
| 229 | 3300025960 | Ga0207651_10020371 | Ga0207651_100203713 | 325 |
| 230 | 3300025960 | Ga0207651_10110726 | Ga0207651_101107261 | 325 |
| 231 | 3300025972 | Ga0207668_10244922 | Ga0207668_102449222 | 325 |
| 232 | 3300025972 | Ga0207668_10479557 | Ga0207668_104795571 | 325 |
| 233 | 3300026023 | Ga0207677_10001341 | Ga0207677_100013414 | 325 |
| 234 | 3300026035 | Ga0207703_10059555 | Ga0207703_100595551 | 325 |
| 235 | 3300026067 | Ga0207678_10005470 | Ga0207678_100054702 | 325 |
| 236 | 3300026075 | Ga0207708_10015889 | Ga0207708_100158893 | 325 |
| 237 | 3300026078 | Ga0207702_10138984 | Ga0207702_101389842 | 325 |
| 238 | 3300026088 | Ga0207641_10010430 | Ga0207641_100104307 | 325 |
| 239 | 3300026089 | Ga0207648_10012278 | Ga0207648_100122782 | 325 |
| 240 | 3300026089 | Ga0207648_10015184 | Ga0207648_100151846 | 325 |
| 241 | 3300026095 | Ga0207676_10001530 | Ga0207676_100015302 | 325 |
| 242 | 3300026095 | Ga0207676_10009147 | Ga0207676_100091472 | 325 |
| 243 | 3300026118 | Ga0207675_100040881 | Ga0207675_1000408814 | 325 |
| 244 | 3300026121 | Ga0207683_10000581 | Ga0207683_1000058117 | 325 |
| 245 | 3300026121 | Ga0207683_10021344 | Ga0207683_100213443 | 325 |
| 246 | 3300026121 | Ga0207683_10070780 | Ga0207683_100707802 | 325 |
| 247 | 3300026142 | Ga0207698_10000953 | Ga0207698_100009538 | 325 |
| 248 | 3300027364 | Ga0209967_1001698 | Ga0209967_10016982 | 325 |
| 249 | 3300027543 | Ga0209999_1005118 | Ga0209999_10051182 | 325 |
| 250 | 3300027671 | Ga0209588_1000009 | Ga0209588_100000940 | 325 |
| 251 | 3300027876 | Ga0209974_10001468 | Ga0209974_100014683 | 325 |
| 252 | 3300028379 | Ga0268266_10411813 | Ga0268266_104118132 | 325 |
| 253 | 3300028380 | Ga0268265_10186540 | Ga0268265_101865402 | 325 |
| 254 | 3300028380 | Ga0268265_10275676 | Ga0268265_102756761 | 325 |
| 255 | 3300028381 | Ga0268264_10357760 | Ga0268264_103577602 | 325 |
| 256 | 3300028577 | Ga0265318_10027395 | Ga0265318_100273952 | 325 |
| 257 | 3300028800 | Ga0265338_10053521 | Ga0265338_100535212 | 325 |
| 258 | 3300031238 | Ga0265332_10003853 | Ga0265332_100038533 | 325 |
| 259 | 3300031239 | Ga0265328_10028090 | Ga0265328_100280901 | 325 |
| 260 | 3300031240 | Ga0265320_10019572 | Ga0265320_100195722 | 325 |
| 261 | 3300031242 | Ga0265329_10011028 | Ga0265329_100110281 | 325 |
| 262 | 3300031250 | Ga0265331_10004097 | Ga0265331_100040977 | 325 |
| 263 | 3300031712 | Ga0265342_10023796 | Ga0265342_100237964 | 325 |
| 264 | 3300031731 | Ga0307405_10022972 | Ga0307405_100229722 | 325 |
| 265 | 3300032002 | Ga0307416_100007220 | Ga0307416_1000072203 | 325 |
| 266 | 3300032005 | Ga0307411_10226459 | Ga0307411_102264592 | 325 |
| 267 | 3300037068 | Ga0373925_0115129 | Ga0373925_0115129_941_1921 | 325 |
| 268 | 3300037853 | Ga0436364_0104023 | Ga0436364_0104023_20_997 | 325 |
| 269 | 3300042436 | Ga0439435_0025327 | Ga0439435_0025327_123_1100 | 325 |
| 270 | 3300046530 | Ga0495654_0076317 | Ga0495654_0076317_459_1436 | 325 |
| 271 | 3300046539 | Ga0495621_0020602 | Ga0495621_0020602_1041_2018 | 325 |
| 272 | 3300046616 | Ga0495668_0084296 | Ga0495668_0084296_427_1404 | 325 |
| 273 | 3300046683 | Ga0495658_0049538 | Ga0495658_0049538_737_1714 | 325 |
| 274 | 3300046691 | Ga0495670_0050454 | Ga0495670_0050454_203_1180 | 325 |
| 275 | 3300046794 | Ga0495589_0094778 | Ga0495589_0094778_410_1387 | 325 |
| 276 | 3300048090 | Ga0495615_0033202 | Ga0495615_0033202_133_1110 | 325 |
| 277 | 3300048903 | Ga0496100_0028490 | Ga0496100_0028490_600_1577 | 325 |
| 278 | 3300048903 | Ga0496100_0065531 | Ga0496100_0065531_636_1613 | 325 |
| 279 | 3300048904 | Ga0496101_0015869 | Ga0496101_0015869_2876_3853 | 325 |
| 280 | 3300048905 | Ga0496102_0080917 | Ga0496102_0080917_1142_2119 | 325 |
| 281 | 3300048907 | Ga0496104_0077142 | Ga0496104_0077142_1004_1981 | 325 |
| 282 | 3300048907 | Ga0496104_0446002 | Ga0496104_0446002_177_1154 | 325 |
| 283 | 3300048909 | Ga0496106_0004954 | Ga0496106_0004954_6722_7699 | 325 |
| 284 | 3300048911 | Ga0496108_0062222 | Ga0496108_0062222_350_1327 | 325 |
| 285 | 3300048913 | Ga0496110_0004198 | Ga0496110_0004198_7886_8863 | 325 |
| 286 | 3300048913 | Ga0496110_0567569 | Ga0496110_0567569_32_1009 | 325 |
| 287 | 3300048915 | Ga0496112_0108034 | Ga0496112_0108034_76_1053 | 325 |
| 288 | 3300048916 | Ga0496113_0014110 | Ga0496113_0014110_3164_4141 | 325 |
| 289 | 3300048917 | Ga0496114_0018470 | Ga0496114_0018470_1879_2856 | 325 |
| 290 | 3300048917 | Ga0496114_0052250 | Ga0496114_0052250_2153_3130 | 325 |
| 291 | 3300048918 | Ga0496115_0113604 | Ga0496115_0113604_1173_2150 | 325 |
| 292 | 3300049568 | Ga0501031_0020357 | Ga0501031_0020357_323_1303 | 325 |
| 293 | 3300049570 | Ga0501033_0023284 | Ga0501033_0023284_1009_1998 | 325 |
| 294 | 3300049570 | Ga0501033_0026890 | Ga0501033_0026890_2493_3482 | 325 |
| 295 | 3300049570 | Ga0501033_0035637 | Ga0501033_0035637_172_1152 | 325 |
| 296 | 3300049571 | Ga0501034_0004413 | Ga0501034_0004413_2191_3168 | 325 |
| 297 | 3300049572 | Ga0501036_0015406 | Ga0501036_0015406_4095_5075 | 325 |
| 298 | 3300049572 | Ga0501036_0018718 | Ga0501036_0018718_1831_2820 | 325 |
| 299 | 3300049572 | Ga0501036_0020831 | Ga0501036_0020831_227_1216 | 325 |
| 300 | 3300049572 | Ga0501036_0034448 | Ga0501036_0034448_1511_2500 | 325 |
| 301 | 3300049572 | Ga0501036_0212713 | Ga0501036_0212713_319_1296 | 325 |
| 302 | 3300049573 | Ga0501037_0012501 | Ga0501037_0012501_3168_4157 | 325 |
| 303 | 3300049573 | Ga0501037_0027717 | Ga0501037_0027717_572_1549 | 325 |
| 304 | 3300049573 | Ga0501037_0085302 | Ga0501037_0085302_470_1450 | 325 |
| 305 | 3300049574 | Ga0501038_0001483 | Ga0501038_0001483_10476_11465 | 325 |
| 306 | 3300049574 | Ga0501038_0081595 | Ga0501038_0081595_1575_2564 | 325 |
| 307 | 3300049575 | Ga0501039_0002955 | Ga0501039_0002955_6826_7803 | 325 |
| 308 | 3300049575 | Ga0501039_0014481 | Ga0501039_0014481_3475_4464 | 325 |
| 309 | 3300049575 | Ga0501039_0106253 | Ga0501039_0106253_960_1949 | 325 |
| 310 | 3300049575 | Ga0501039_0138657 | Ga0501039_0138657_591_1571 | 325 |
| 311 | 3300049576 | Ga0501040_0002082 | Ga0501040_0002082_1192_2181 | 325 |
| 312 | 3300049576 | Ga0501040_0017695 | Ga0501040_0017695_930_1910 | 325 |
| 313 | 3300049576 | Ga0501040_0038640 | Ga0501040_0038640_1332_2321 | 325 |
| 314 | 3300049576 | Ga0501040_0041694 | Ga0501040_0041694_919_1896 | 325 |
| 315 | 3300049576 | Ga0501040_0043695 | Ga0501040_0043695_714_1700 | 325 |
| 316 | 3300049577 | Ga0501041_0002051 | Ga0501041_0002051_1192_2181 | 325 |
| 317 | 3300049577 | Ga0501041_0003848 | Ga0501041_0003848_4686_5663 | 325 |
| 318 | 3300049577 | Ga0501041_0004416 | Ga0501041_0004416_3926_4915 | 325 |
| 319 | 3300049577 | Ga0501041_0044025 | Ga0501041_0044025_533_1522 | 325 |
| 320 | 3300049578 | Ga0501042_0006501 | Ga0501042_0006501_991_1980 | 325 |
| 321 | 3300049578 | Ga0501042_0008572 | Ga0501042_0008572_3970_4950 | 325 |
| 322 | 3300049578 | Ga0501042_0035032 | Ga0501042_0035032_1324_2313 | 325 |
| 323 | 3300049578 | Ga0501042_0059051 | Ga0501042_0059051_776_1765 | 325 |
| 324 | 3300049578 | Ga0501042_0146936 | Ga0501042_0146936_261_1238 | 325 |
| 325 | 3300049579 | Ga0501043_0025776 | Ga0501043_0025776_121_1110 | 325 |
| 326 | 3300049579 | Ga0501043_0028283 | Ga0501043_0028283_1204_2193 | 325 |
| 327 | 3300049579 | Ga0501043_0067206 | Ga0501043_0067206_1186_2163 | 325 |
| 328 | 3300049580 | Ga0501046_0005973 | Ga0501046_0005973_5968_6957 | 325 |
| 329 | 3300049580 | Ga0501046_0010727 | Ga0501046_0010727_5295_6284 | 325 |
| 330 | 3300049580 | Ga0501046_0080472 | Ga0501046_0080472_1192_2181 | 325 |
| 331 | 3300049580 | Ga0501046_0102555 | Ga0501046_0102555_113_1093 | 325 |
| 332 | 3300049581 | Ga0501047_0407601 | Ga0501047_0407601_71_1060 | 325 |
| 333 | 3300049582 | Ga0501048_0017493 | Ga0501048_0017493_533_1522 | 325 |
| 334 | 3300049582 | Ga0501048_0028264 | Ga0501048_0028264_2328_3305 | 325 |
| 335 | 3300049582 | Ga0501048_0087749 | Ga0501048_0087749_533_1522 | 325 |
| 336 | 3300049584 | Ga0501068_0009909 | Ga0501068_0009909_64_1044 | 325 |
| 337 | 3300049584 | Ga0501068_0073670 | Ga0501068_0073670_134_1123 | 325 |
| 338 | 3300049584 | Ga0501068_0228745 | Ga0501068_0228745_75_1064 | 325 |
| 339 | 3300049585 | Ga0501069_0190503 | Ga0501069_0190503_68_1057 | 325 |
| 340 | 3300049587 | Ga0501071_0032246 | Ga0501071_0032246_1567_2556 | 325 |
| 341 | 3300049587 | Ga0501071_0041132 | Ga0501071_0041132_1122_2111 | 325 |
| 342 | 3300049587 | Ga0501071_0055178 | Ga0501071_0055178_1601_2587 | 325 |
| 343 | 3300049588 | Ga0501072_0001271 | Ga0501072_0001271_13793_14773 | 325 |
| 344 | 3300049588 | Ga0501072_0009293 | Ga0501072_0009293_505_1494 | 325 |
| 345 | 3300049588 | Ga0501072_0038467 | Ga0501072_0038467_1117_2106 | 325 |
| 346 | 3300049588 | Ga0501072_0120850 | Ga0501072_0120850_466_1452 | 325 |
| 347 | 3300049589 | Ga0501073_0002264 | Ga0501073_0002264_12737_13726 | 325 |
| 348 | 3300049590 | Ga0501074_0001230 | Ga0501074_0001230_3876_4856 | 325 |
| 349 | 3300049590 | Ga0501074_0064092 | Ga0501074_0064092_846_1835 | 325 |
| 350 | 3300049590 | Ga0501074_0079731 | Ga0501074_0079731_501_1487 | 325 |
| 351 | 3300049590 | Ga0501074_0085815 | Ga0501074_0085815_154_1143 | 325 |
| 352 | 3300049591 | Ga0501075_0003461 | Ga0501075_0003461_3975_4964 | 325 |
| 353 | 3300049591 | Ga0501075_0012910 | Ga0501075_0012910_4133_5119 | 325 |
| 354 | 3300049591 | Ga0501075_0016310 | Ga0501075_0016310_3177_4157 | 325 |
| 355 | 3300049591 | Ga0501075_0026034 | Ga0501075_0026034_1955_2932 | 325 |
| 356 | 3300049591 | Ga0501075_0045440 | Ga0501075_0045440_1116_2105 | 325 |
| 357 | 3300049591 | Ga0501075_0058529 | Ga0501075_0058529_940_1929 | 325 |
| 358 | 3300049592 | Ga0501076_0006995 | Ga0501076_0006995_1132_2121 | 325 |
| 359 | 3300049592 | Ga0501076_0010342 | Ga0501076_0010342_332_1321 | 325 |
| 360 | 3300049592 | Ga0501076_0036537 | Ga0501076_0036537_1294_2283 | 325 |
| 361 | 3300049593 | Ga0501077_0037560 | Ga0501077_0037560_960_1949 | 325 |
| 362 | 3300049593 | Ga0501077_0113646 | Ga0501077_0113646_255_1241 | 325 |
| 363 | 3300049741 | Ga0501079_0001328 | Ga0501079_0001328_14415_15395 | 325 |
| 364 | 3300049741 | Ga0501079_0004670 | Ga0501079_0004670_7059_8048 | 325 |
| 365 | 3300049741 | Ga0501079_0052091 | Ga0501079_0052091_980_1969 | 325 |
| 366 | 3300049741 | Ga0501079_0056402 | Ga0501079_0056402_505_1494 | 325 |
| 367 | 3300049742 | Ga0501080_0005631 | Ga0501080_0005631_540_1529 | 325 |
| 368 | 3300049742 | Ga0501080_0048254 | Ga0501080_0048254_2156_3136 | 325 |
| 369 | 3300049742 | Ga0501080_0055289 | Ga0501080_0055289_1574_2563 | 325 |
| 370 | 3300049742 | Ga0501080_0351334 | Ga0501080_0351334_32_1018 | 325 |
| 371 | 3300049743 | Ga0501081_0000347 | Ga0501081_0000347_12974_13951 | 325 |
| 372 | 3300049743 | Ga0501081_0009005 | Ga0501081_0009005_72_1061 | 325 |
| 373 | 3300049743 | Ga0501081_0010042 | Ga0501081_0010042_526_1515 | 325 |
| 374 | 3300049743 | Ga0501081_0010184 | Ga0501081_0010184_1000_1986 | 325 |
| 375 | 3300049743 | Ga0501081_0038104 | Ga0501081_0038104_1169_2158 | 325 |
| 376 | 3300049744 | Ga0501083_0008226 | Ga0501083_0008226_881_1870 | 325 |
| 377 | 3300049744 | Ga0501083_0013741 | Ga0501083_0013741_3775_4755 | 325 |
| 378 | 3300049744 | Ga0501083_0051936 | Ga0501083_0051936_1254_2243 | 325 |
| 379 | 3300049822 | Ga0501035_0217947 | Ga0501035_0217947_526_1515 | 325 |
| 380 | 3300049823 | Ga0501044_0059434 | Ga0501044_0059434_2337_3326 | 325 |
| 381 | 3300049823 | Ga0501044_0174210 | Ga0501044_0174210_245_1234 | 325 |
| 382 | 3300049824 | Ga0501045_0001638 | Ga0501045_0001638_171_1151 | 325 |
| 383 | 3300049824 | Ga0501045_0011396 | Ga0501045_0011396_1047_2036 | 325 |
| 384 | 3300049824 | Ga0501045_0024960 | Ga0501045_0024960_533_1522 | 325 |
| 385 | 3300050492 | nmdc:mga0yw44_3606_c1 | nmdc:mga0yw44_3606_c1_3450_4427 | 325 |
| 386 | 3300050507 | nmdc:mga05p37_98899_c1 | nmdc:mga05p37_98899_c1_2402_3379 | 325 |
| 387 | 3300050509 | nmdc:mga0qj67_212311_c1 | nmdc:mga0qj67_212311_c1_562_1539 | 325 |
| 388 | 3300050510 | nmdc:mga06r32_218532_c1 | nmdc:mga06r32_218532_c1_571_1548 | 325 |
| 389 | 3300050511 | nmdc:mga08y16_119084_c1 | nmdc:mga08y16_119084_c1_1408_2385 | 325 |
| 390 | 3300050511 | nmdc:mga08y16_58758_c1 | nmdc:mga08y16_58758_c1_1733_2710 | 325 |
| 391 | 3300050512 | nmdc:mga0n895_132887_c1 | nmdc:mga0n895_132887_c1_999_1976 | 325 |
| 392 | 3300050514 | nmdc:mga08x19_294442_c1 | nmdc:mga08x19_294442_c1_75_1052 | 325 |
| 393 | 3300050515 | nmdc:mga0a205_24943_c1 | nmdc:mga0a205_24943_c1_2223_3200 | 325 |
| 394 | 3300053085 | Ga0495619_0112881 | Ga0495619_0112881_680_1657 | 325 |
| 395 | 3300053178 | Ga0500637_0011014 | Ga0500637_0011014_2952_3929 | 325 |
| 396 | 3300054114 | Ga0501084_0003640 | Ga0501084_0003640_11271_12251 | 325 |
| 397 | 3300054114 | Ga0501084_0013611 | Ga0501084_0013611_3882_4871 | 325 |
| 398 | 3300054114 | Ga0501084_0041440 | Ga0501084_0041440_898_1875 | 325 |
| 399 | 3300054114 | Ga0501084_0052208 | Ga0501084_0052208_477_1463 | 325 |
| 400 | 3300054114 | Ga0501084_0069409 | Ga0501084_0069409_1112_2101 | 325 |
| 401 | 3300060353 | Ga0501082_0002535 | Ga0501082_0002535_6749_7726 | 325 |
| 402 | 3300060353 | Ga0501082_0005369 | Ga0501082_0005369_3988_4977 | 325 |
| 403 | 3300060353 | Ga0501082_0015536 | Ga0501082_0015536_2200_3189 | 325 |
| 404 | 3300060353 | Ga0501082_0028880 | Ga0501082_0028880_1676_2662 | 325 |
| 405 | 3300060353 | Ga0501082_0064574 | Ga0501082_0064574_1192_2181 | 325 |
| 406 | 3300061734 | Ga0530510_0027909 | Ga0530510_0027909_264_1244 | 325 |
| 407 | 3300061734 | Ga0530510_0037230 | Ga0530510_0037230_417_1406 | 325 |
| 408 | 3300061734 | Ga0530510_0079593 | Ga0530510_0079593_136_1122 | 325 |
| 409 | 3300061734 | Ga0530510_0119304 | Ga0530510_0119304_694_1671 | 325 |
| 410 | 3300003203 | JGI25406J46586_10008875 | JGI25406J46586_100088753 | 326 |
| 411 | 3300003215 | JGI25153J46596_10000010 | JGI25153J46596_10000010193 | 326 |
| 412 | 3300005293 | Ga0065715_10135985 | Ga0065715_101359852 | 326 |
| 413 | 3300005331 | Ga0070670_100010828 | Ga0070670_1000108282 | 326 |
| 414 | 3300005339 | Ga0070660_100213577 | Ga0070660_1002135771 | 326 |
| 415 | 3300005340 | Ga0070689_100061730 | Ga0070689_1000617302 | 326 |
| 416 | 3300005347 | Ga0070668_100113176 | Ga0070668_1001131762 | 326 |
| 417 | 3300005434 | Ga0070709_10001838 | Ga0070709_100018383 | 326 |
| 418 | 3300005434 | Ga0070709_10172580 | Ga0070709_101725802 | 326 |
| 419 | 3300005435 | Ga0070714_100085203 | Ga0070714_1000852032 | 326 |
| 420 | 3300005436 | Ga0070713_100008135 | Ga0070713_1000081353 | 326 |
| 421 | 3300005439 | Ga0070711_100285695 | Ga0070711_1002856952 | 326 |
| 422 | 3300005456 | Ga0070678_100028549 | Ga0070678_1000285492 | 326 |
| 423 | 3300005466 | Ga0070685_10047169 | Ga0070685_100471692 | 326 |
| 424 | 3300005543 | Ga0070672_100195682 | Ga0070672_1001956821 | 326 |
| 425 | 3300005544 | Ga0070686_100357081 | Ga0070686_1003570811 | 326 |
| 426 | 3300005548 | Ga0070665_100106145 | Ga0070665_1001061453 | 326 |
| 427 | 3300005614 | Ga0068856_100115685 | Ga0068856_1001156853 | 326 |
| 428 | 3300005719 | Ga0068861_100261891 | Ga0068861_1002618912 | 326 |
| 429 | 3300005981 | Ga0081538_10004000 | Ga0081538_100040003 | 326 |
| 430 | 3300005981 | Ga0081538_10016393 | Ga0081538_100163934 | 326 |
| 431 | 3300005983 | Ga0081540_1005998 | Ga0081540_10059988 | 326 |
| 432 | 3300005983 | Ga0081540_1014080 | Ga0081540_10140802 | 326 |
| 433 | 3300005983 | Ga0081540_1064427 | Ga0081540_10644272 | 326 |
| 434 | 3300005985 | Ga0081539_10002801 | Ga0081539_100028014 | 326 |
| 435 | 3300006028 | Ga0070717_10027405 | Ga0070717_100274052 | 326 |
| 436 | 3300006038 | Ga0075365_10103751 | Ga0075365_101037512 | 326 |
| 437 | 3300006038 | Ga0075365_10175835 | Ga0075365_101758352 | 326 |
| 438 | 3300006048 | Ga0075363_100004257 | Ga0075363_1000042576 | 326 |
| 439 | 3300006048 | Ga0075363_100040646 | Ga0075363_1000406462 | 326 |
| 440 | 3300006051 | Ga0075364_10158854 | Ga0075364_101588542 | 326 |
| 441 | 3300006051 | Ga0075364_10232414 | Ga0075364_102324142 | 326 |
| 442 | 3300006163 | Ga0070715_10001029 | Ga0070715_100010295 | 326 |
| 443 | 3300006173 | Ga0070716_100076910 | Ga0070716_1000769102 | 326 |
| 444 | 3300006177 | Ga0075362_10001107 | Ga0075362_100011079 | 326 |
| 445 | 3300006178 | Ga0075367_10037538 | Ga0075367_100375382 | 326 |
| 446 | 3300006178 | Ga0075367_10161251 | Ga0075367_101612511 | 326 |
| 447 | 3300006195 | Ga0075366_10008250 | Ga0075366_100082504 | 326 |
| 448 | 3300006353 | Ga0075370_10100220 | Ga0075370_101002202 | 326 |
| 449 | 3300006844 | Ga0075428_100672413 | Ga0075428_1006724131 | 326 |
| 450 | 3300006846 | Ga0075430_100056675 | Ga0075430_1000566753 | 326 |
| 451 | 3300006846 | Ga0075430_100117562 | Ga0075430_1001175622 | 326 |
| 452 | 3300006847 | Ga0075431_100052784 | Ga0075431_1000527843 | 326 |
| 453 | 3300006847 | Ga0075431_100254998 | Ga0075431_1002549982 | 326 |
| 454 | 3300006847 | Ga0075431_100259582 | Ga0075431_1002595822 | 326 |
| 455 | 3300006847 | Ga0075431_100624674 | Ga0075431_1006246741 | 326 |
| 456 | 3300006880 | Ga0075429_100024317 | Ga0075429_1000243172 | 326 |
| 457 | 3300006880 | Ga0075429_100107365 | Ga0075429_1001073653 | 326 |
| 458 | 3300006914 | Ga0075436_100002520 | Ga0075436_1000025208 | 326 |
| 459 | 3300007788 | Ga0099795_10045891 | Ga0099795_100458912 | 326 |
| 460 | 3300009093 | Ga0105240_10032455 | Ga0105240_100324552 | 326 |
| 461 | 3300009093 | Ga0105240_10130173 | Ga0105240_101301734 | 326 |
| 462 | 3300009093 | Ga0105240_10156897 | Ga0105240_101568974 | 326 |
| 463 | 3300009101 | Ga0105247_10046857 | Ga0105247_100468572 | 326 |
| 464 | 3300009147 | Ga0114129_10086220 | Ga0114129_100862202 | 326 |
| 465 | 3300009148 | Ga0105243_10188172 | Ga0105243_101881722 | 326 |
| 466 | 3300009176 | Ga0105242_10198974 | Ga0105242_101989742 | 326 |
| 467 | 3300009545 | Ga0105237_10345963 | Ga0105237_103459632 | 326 |
| 468 | 3300009551 | Ga0105238_10067684 | Ga0105238_100676841 | 326 |
| 469 | 3300010159 | Ga0099796_10034050 | Ga0099796_100340502 | 326 |
| 470 | 3300010375 | Ga0105239_10286325 | Ga0105239_102863252 | 326 |
| 471 | 3300013307 | Ga0157372_10408424 | Ga0157372_104084241 | 326 |
| 472 | 3300014325 | Ga0163163_10131176 | Ga0163163_101311762 | 326 |
| 473 | 3300021384 | Ga0213876_10003329 | Ga0213876_100033292 | 326 |
| 474 | 3300021384 | Ga0213876_10008211 | Ga0213876_100082115 | 326 |
| 475 | 3300021384 | Ga0213876_10021721 | Ga0213876_100217213 | 326 |
| 476 | 3300021384 | Ga0213876_10163658 | Ga0213876_101636582 | 326 |
| 477 | 3300025297 | Ga0209758_1000033 | Ga0209758_1000033334 | 326 |
| 478 | 3300025885 | Ga0207653_10011499 | Ga0207653_100114992 | 326 |
| 479 | 3300025898 | Ga0207692_10062025 | Ga0207692_100620252 | 326 |
| 480 | 3300025898 | Ga0207692_10077089 | Ga0207692_100770892 | 326 |
| 481 | 3300025905 | Ga0207685_10017899 | Ga0207685_100178992 | 326 |
| 482 | 3300025906 | Ga0207699_10326254 | Ga0207699_103262541 | 326 |
| 483 | 3300025911 | Ga0207654_10257721 | Ga0207654_102577212 | 326 |
| 484 | 3300025913 | Ga0207695_10052905 | Ga0207695_100529054 | 326 |
| 485 | 3300025913 | Ga0207695_10139652 | Ga0207695_101396522 | 326 |
| 486 | 3300025913 | Ga0207695_10145384 | Ga0207695_101453841 | 326 |
| 487 | 3300025915 | Ga0207693_10000988 | Ga0207693_100009885 | 326 |
| 488 | 3300025915 | Ga0207693_10014858 | Ga0207693_100148583 | 326 |
| 489 | 3300025916 | Ga0207663_10060053 | Ga0207663_100600532 | 326 |
| 490 | 3300025918 | Ga0207662_10073964 | Ga0207662_100739642 | 326 |
| 491 | 3300025918 | Ga0207662_10137091 | Ga0207662_101370911 | 326 |
| 492 | 3300025919 | Ga0207657_10024231 | Ga0207657_100242314 | 326 |
| 493 | 3300025924 | Ga0207694_10038798 | Ga0207694_100387982 | 326 |
| 494 | 3300025925 | Ga0207650_10002081 | Ga0207650_100020812 | 326 |
| 495 | 3300025928 | Ga0207700_10057899 | Ga0207700_100578992 | 326 |
| 496 | 3300025928 | Ga0207700_10185655 | Ga0207700_101856551 | 326 |
| 497 | 3300025936 | Ga0207670_10105118 | Ga0207670_101051182 | 326 |
| 498 | 3300025939 | Ga0207665_10003664 | Ga0207665_100036642 | 326 |
| 499 | 3300025940 | Ga0207691_10053994 | Ga0207691_100539944 | 326 |
| 500 | 3300025941 | Ga0207711_10435983 | Ga0207711_104359832 | 326 |
| 501 | 3300025944 | Ga0207661_10314216 | Ga0207661_103142162 | 326 |
| 502 | 3300025960 | Ga0207651_10183520 | Ga0207651_101835202 | 326 |
| 503 | 3300025960 | Ga0207651_10226603 | Ga0207651_102266032 | 326 |
| 504 | 3300025961 | Ga0207712_10174653 | Ga0207712_101746532 | 326 |
| 505 | 3300026078 | Ga0207702_10108403 | Ga0207702_101084032 | 326 |
| 506 | 3300026089 | Ga0207648_10031802 | Ga0207648_100318022 | 326 |
| 507 | 3300026095 | Ga0207676_10046205 | Ga0207676_100462052 | 326 |
| 508 | 3300026095 | Ga0207676_10286517 | Ga0207676_102865172 | 326 |
| 509 | 3300026118 | Ga0207675_100044150 | Ga0207675_1000441504 | 326 |
| 510 | 3300026121 | Ga0207683_10000755 | Ga0207683_1000075529 | 326 |
| 511 | 3300027512 | Ga0209179_1003214 | Ga0209179_10032142 | 326 |
| 512 | 3300028577 | Ga0265318_10006701 | Ga0265318_100067015 | 326 |
| 513 | 3300028794 | Ga0307515_10063235 | Ga0307515_100632356 | 326 |
| 514 | 3300031238 | Ga0265332_10000310 | Ga0265332_1000031021 | 326 |
| 515 | 3300031238 | Ga0265332_10015644 | Ga0265332_100156443 | 326 |
| 516 | 3300031238 | Ga0265332_10060909 | Ga0265332_100609092 | 326 |
| 517 | 3300031240 | Ga0265320_10033117 | Ga0265320_100331173 | 326 |
| 518 | 3300031241 | Ga0265325_10006109 | Ga0265325_100061096 | 326 |
| 519 | 3300031247 | Ga0265340_10006782 | Ga0265340_100067826 | 326 |
| 520 | 3300031249 | Ga0265339_10001481 | Ga0265339_1000148110 | 326 |
| 521 | 3300031250 | Ga0265331_10024928 | Ga0265331_100249282 | 326 |
| 522 | 3300031250 | Ga0265331_10033074 | Ga0265331_100330742 | 326 |
| 523 | 3300031344 | Ga0265316_10118829 | Ga0265316_101188292 | 326 |
| 524 | 3300031344 | Ga0265316_10258394 | Ga0265316_102583941 | 326 |
| 525 | 3300031691 | Ga0316579_10033433 | Ga0316579_100334333 | 326 |
| 526 | 3300031711 | Ga0265314_10106115 | Ga0265314_101061152 | 326 |
| 527 | 3300031712 | Ga0265342_10000175 | Ga0265342_1000017544 | 326 |
| 528 | 3300031712 | Ga0265342_10174231 | Ga0265342_101742311 | 326 |
| 529 | 3300031730 | Ga0307516_10002086 | Ga0307516_100020866 | 326 |
| 530 | 3300031730 | Ga0307516_10084832 | Ga0307516_100848322 | 326 |
| 531 | 3300035086 | Ga0373934_0039193 | Ga0373934_0039193_584_1564 | 326 |
| 532 | 3300035111 | Ga0373923_0000157 | Ga0373923_0000157_1307_2287 | 326 |
| 533 | 3300035113 | Ga0373936_0035416 | Ga0373936_0035416_264_1244 | 326 |
| 534 | 3300035116 | Ga0373945_0004209 | Ga0373945_0004209_2447_3427 | 326 |
| 535 | 3300035117 | Ga0373953_0007423 | Ga0373953_0007423_2171_3151 | 326 |
| 536 | 3300035118 | Ga0373954_0029599 | Ga0373954_0029599_389_1369 | 326 |
| 537 | 3300035170 | Ga0373943_0001586 | Ga0373943_0001586_5368_6348 | 326 |
| 538 | 3300035170 | Ga0373943_0094381 | Ga0373943_0094381_19_999 | 326 |
| 539 | 3300035171 | Ga0373946_0003086 | Ga0373946_0003086_1629_2609 | 326 |
| 540 | 3300035172 | Ga0373955_0000562 | Ga0373955_0000562_8439_9419 | 326 |
| 541 | 3300035410 | Ga0373924_0005771 | Ga0373924_0005771_2616_3596 | 326 |
| 542 | 3300035692 | Ga0373935_0255045 | Ga0373935_0255045_199_1179 | 326 |
| 543 | 3300035724 | Ga0373933_0045120 | Ga0373933_0045120_211_1191 | 326 |
| 544 | 3300035725 | Ga0373947_0049565 | Ga0373947_0049565_986_1966 | 326 |
| 545 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_76135_77115 | 326 |
| 546 | 3300036647 | Ga0316582_0199445 | Ga0316582_0199445_324_1304 | 326 |
| 547 | 3300037068 | Ga0373925_0000194 | Ga0373925_0000194_35083_36063 | 326 |
| 548 | 3300037068 | Ga0373925_0004439 | Ga0373925_0004439_6131_7114 | 326 |
| 549 | 3300037068 | Ga0373925_0007047 | Ga0373925_0007047_3075_4055 | 326 |
| 550 | 3300037068 | Ga0373925_0024598 | Ga0373925_0024598_2686_3666 | 326 |
| 551 | 3300037068 | Ga0373925_0091665 | Ga0373925_0091665_684_1664 | 326 |
| 552 | 3300037471 | Ga0395905_0001088 | Ga0395905_0001088_2678_3661 | 326 |
| 553 | 3300037853 | Ga0436364_0216969 | Ga0436364_0216969_32_1012 | 326 |
| 554 | 3300039437 | Ga0436365_0047572 | Ga0436365_0047572_1564_2550 | 326 |
| 555 | 3300039437 | Ga0436365_0803180 | Ga0436365_0803180_236_1216 | 326 |
| 556 | 3300039437 | Ga0436365_1535122 | Ga0436365_1535122_952_1932 | 326 |
| 557 | 3300039437 | Ga0436365_1613453 | Ga0436365_1613453_1643_2623 | 326 |
| 558 | 3300039447 | Ga0436361_0668552 | Ga0436361_0668552_954_1934 | 326 |
| 559 | 3300039450 | Ga0436363_0979456 | Ga0436363_0979456_61_1041 | 326 |
| 560 | 3300039453 | Ga0436362_0471479 | Ga0436362_0471479_3355_4341 | 326 |
| 561 | 3300041410 | Ga0439461_0013081 | Ga0439461_0013081_512_1492 | 326 |
| 562 | 3300042436 | Ga0439435_0000853 | Ga0439435_0000853_1858_2838 | 326 |
| 563 | 3300046454 | Ga0495592_0000018 | Ga0495592_0000018_13226_14206 | 326 |
| 564 | 3300046455 | Ga0495603_0036468 | Ga0495603_0036468_412_1392 | 326 |
| 565 | 3300046459 | Ga0495629_0005894 | Ga0495629_0005894_4204_5184 | 326 |
| 566 | 3300046459 | Ga0495629_0103941 | Ga0495629_0103941_20_1000 | 326 |
| 567 | 3300046460 | Ga0495638_0007358 | Ga0495638_0007358_4557_5537 | 326 |
| 568 | 3300046460 | Ga0495638_0025383 | Ga0495638_0025383_1501_2496 | 326 |
| 569 | 3300046462 | Ga0495651_0002271 | Ga0495651_0002271_9990_10970 | 326 |
| 570 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_45336_46316 | 326 |
| 571 | 3300046472 | Ga0495580_0314286 | Ga0495580_0314286_62_1042 | 326 |
| 572 | 3300046473 | Ga0495582_0039554 | Ga0495582_0039554_768_1748 | 326 |
| 573 | 3300046474 | Ga0495605_0063268 | Ga0495605_0063268_109_1089 | 326 |
| 574 | 3300046475 | Ga0495639_0081300 | Ga0495639_0081300_448_1428 | 326 |
| 575 | 3300046475 | Ga0495639_0106743 | Ga0495639_0106743_24_1004 | 326 |
| 576 | 3300046476 | Ga0495662_0007065 | Ga0495662_0007065_635_1615 | 326 |
| 577 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_191396_192376 | 326 |
| 578 | 3300046491 | Ga0495584_0040269 | Ga0495584_0040269_675_1655 | 326 |
| 579 | 3300046491 | Ga0495584_0045185 | Ga0495584_0045185_275_1255 | 326 |
| 580 | 3300046501 | Ga0495607_0098868 | Ga0495607_0098868_567_1547 | 326 |
| 581 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_76273_77253 | 326 |
| 582 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_193669_194649 | 326 |
| 583 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_191424_192404 | 326 |
| 584 | 3300046517 | Ga0495630_0005324 | Ga0495630_0005324_6320_7300 | 326 |
| 585 | 3300046517 | Ga0495630_0193828 | Ga0495630_0193828_556_1536 | 326 |
| 586 | 3300046523 | Ga0495644_0013428 | Ga0495644_0013428_1173_2153 | 326 |
| 587 | 3300046525 | Ga0495663_0068005 | Ga0495663_0068005_133_1113 | 326 |
| 588 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_75963_76943 | 326 |
| 589 | 3300046533 | Ga0495640_0000009 | Ga0495640_0000009_24715_25695 | 326 |
| 590 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_305142_306122 | 326 |
| 591 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_45336_46316 | 326 |
| 592 | 3300046558 | Ga0495633_0019278 | Ga0495633_0019278_1577_2557 | 326 |
| 593 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_191424_192404 | 326 |
| 594 | 3300046559 | Ga0495667_0194649 | Ga0495667_0194649_118_1098 | 326 |
| 595 | 3300046615 | Ga0495656_0033241 | Ga0495656_0033241_763_1743 | 326 |
| 596 | 3300046616 | Ga0495668_0019322 | Ga0495668_0019322_1690_2679 | 326 |
| 597 | 3300046642 | Ga0495634_0000223 | Ga0495634_0000223_31605_32585 | 326 |
| 598 | 3300046660 | Ga0495625_0083178 | Ga0495625_0083178_903_1892 | 326 |
| 599 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_75946_76926 | 326 |
| 600 | 3300046674 | Ga0495588_0031067 | Ga0495588_0031067_332_1312 | 326 |
| 601 | 3300046675 | Ga0495657_0000058 | Ga0495657_0000058_30699_31679 | 326 |
| 602 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_75963_76943 | 326 |
| 603 | 3300046679 | Ga0495623_0000085 | Ga0495623_0000085_12496_13476 | 326 |
| 604 | 3300046680 | Ga0495646_0000021 | Ga0495646_0000021_75918_76898 | 326 |
| 605 | 3300046681 | Ga0495647_0019538 | Ga0495647_0019538_887_1867 | 326 |
| 606 | 3300046683 | Ga0495658_0128265 | Ga0495658_0128265_378_1358 | 326 |
| 607 | 3300046684 | Ga0495669_0094739 | Ga0495669_0094739_361_1341 | 326 |
| 608 | 3300046689 | Ga0495613_0016426 | Ga0495613_0016426_514_1494 | 326 |
| 609 | 3300046690 | Ga0495624_0094266 | Ga0495624_0094266_556_1536 | 326 |
| 610 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_75963_76943 | 326 |
| 611 | 3300047315 | Ga0495581_0161680 | Ga0495581_0161680_256_1236 | 326 |
| 612 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_191411_192391 | 326 |
| 613 | 3300047317 | Ga0495604_0073579 | Ga0495604_0073579_594_1574 | 326 |
| 614 | 3300047318 | Ga0495636_0091357 | Ga0495636_0091357_77_1057 | 326 |
| 615 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_193697_194677 | 326 |
| 616 | 3300047321 | Ga0495676_0080664 | Ga0495676_0080664_503_1483 | 326 |
| 617 | 3300047322 | Ga0495680_0001281 | Ga0495680_0001281_22439_23419 | 326 |
| 618 | 3300047444 | Ga0495675_0000096 | Ga0495675_0000096_37881_38861 | 326 |
| 619 | 3300047471 | Ga0495684_0000084 | Ga0495684_0000084_19285_20265 | 326 |
| 620 | 3300047673 | Ga0495593_0001526 | Ga0495593_0001526_12550_13530 | 326 |
| 621 | 3300048088 | Ga0495602_0000073 | Ga0495602_0000073_75946_76926 | 326 |
| 622 | 3300048903 | Ga0496100_0015237 | Ga0496100_0015237_1606_2586 | 326 |
| 623 | 3300048903 | Ga0496100_0107444 | Ga0496100_0107444_26_1006 | 326 |
| 624 | 3300048903 | Ga0496100_0144316 | Ga0496100_0144316_271_1251 | 326 |
| 625 | 3300048904 | Ga0496101_0014939 | Ga0496101_0014939_1763_2743 | 326 |
| 626 | 3300048905 | Ga0496102_0092173 | Ga0496102_0092173_1734_2714 | 326 |
| 627 | 3300048905 | Ga0496102_0212232 | Ga0496102_0212232_651_1631 | 326 |
| 628 | 3300048907 | Ga0496104_0000445 | Ga0496104_0000445_17788_18768 | 326 |
| 629 | 3300048907 | Ga0496104_0001219 | Ga0496104_0001219_12859_13839 | 326 |
| 630 | 3300048907 | Ga0496104_0002378 | Ga0496104_0002378_1819_2799 | 326 |
| 631 | 3300048908 | Ga0496105_0046477 | Ga0496105_0046477_903_1883 | 326 |
| 632 | 3300048909 | Ga0496106_0230729 | Ga0496106_0230729_168_1148 | 326 |
| 633 | 3300048910 | Ga0496107_0022084 | Ga0496107_0022084_3032_4012 | 326 |
| 634 | 3300048910 | Ga0496107_0081615 | Ga0496107_0081615_1091_2071 | 326 |
| 635 | 3300048911 | Ga0496108_0003673 | Ga0496108_0003673_6385_7365 | 326 |
| 636 | 3300048911 | Ga0496108_0004728 | Ga0496108_0004728_7494_8474 | 326 |
| 637 | 3300048912 | Ga0496109_0001694 | Ga0496109_0001694_11703_12683 | 326 |
| 638 | 3300048912 | Ga0496109_0004263 | Ga0496109_0004263_6591_7571 | 326 |
| 639 | 3300048913 | Ga0496110_0002379 | Ga0496110_0002379_6486_7466 | 326 |
| 640 | 3300048913 | Ga0496110_0413055 | Ga0496110_0413055_180_1160 | 326 |
| 641 | 3300048914 | Ga0496111_0000375 | Ga0496111_0000375_14359_15339 | 326 |
| 642 | 3300048914 | Ga0496111_0007514 | Ga0496111_0007514_5677_6657 | 326 |
| 643 | 3300048914 | Ga0496111_0359750 | Ga0496111_0359750_41_1021 | 326 |
| 644 | 3300048915 | Ga0496112_0009605 | Ga0496112_0009605_7699_8679 | 326 |
| 645 | 3300048915 | Ga0496112_0074254 | Ga0496112_0074254_310_1290 | 326 |
| 646 | 3300048916 | Ga0496113_0016155 | Ga0496113_0016155_489_1469 | 326 |
| 647 | 3300048916 | Ga0496113_0049815 | Ga0496113_0049815_1131_2111 | 326 |
| 648 | 3300048916 | Ga0496113_0108789 | Ga0496113_0108789_923_1903 | 326 |
| 649 | 3300048917 | Ga0496114_0197813 | Ga0496114_0197813_594_1574 | 326 |
| 650 | 3300048917 | Ga0496114_0287434 | Ga0496114_0287434_89_1069 | 326 |
| 651 | 3300048918 | Ga0496115_0045185 | Ga0496115_0045185_2168_3148 | 326 |
| 652 | 3300048918 | Ga0496115_0158594 | Ga0496115_0158594_661_1641 | 326 |
| 653 | 3300048918 | Ga0496115_0250833 | Ga0496115_0250833_46_1026 | 326 |
| 654 | 3300048924 | Ga0496121_0240390 | Ga0496121_0240390_19_1005 | 326 |
| 655 | 3300049588 | Ga0501072_0285854 | Ga0501072_0285854_261_1247 | 326 |
| 656 | 3300049590 | Ga0501074_0076131 | Ga0501074_0076131_689_1669 | 326 |
| 657 | 3300049592 | Ga0501076_0398644 | Ga0501076_0398644_54_1034 | 326 |
| 658 | 3300049593 | Ga0501077_0194975 | Ga0501077_0194975_250_1236 | 326 |
| 659 | 3300049741 | Ga0501079_0066529 | Ga0501079_0066529_1427_2413 | 326 |
| 660 | 3300049743 | Ga0501081_0162780 | Ga0501081_0162780_262_1242 | 326 |
| 661 | 3300050489 | nmdc:mga03683_12449_c1 | nmdc:mga03683_12449_c1_255_1235 | 326 |
| 662 | 3300050489 | nmdc:mga03683_762_c1 | nmdc:mga03683_762_c1_6986_7975 | 326 |
| 663 | 3300050490 | nmdc:mga03n38_66496_c1 | nmdc:mga03n38_66496_c1_405_1394 | 326 |
| 664 | 3300050490 | nmdc:mga03n38_8935_c1 | nmdc:mga03n38_8935_c1_2613_3593 | 326 |
| 665 | 3300050491 | nmdc:mga00v17_207188_c1 | nmdc:mga00v17_207188_c1_90_1079 | 326 |
| 666 | 3300050492 | nmdc:mga0yw44_12424_c1 | nmdc:mga0yw44_12424_c1_1456_2436 | 326 |
| 667 | 3300050492 | nmdc:mga0yw44_7591_c1 | nmdc:mga0yw44_7591_c1_4320_5300 | 326 |
| 668 | 3300050492 | nmdc:mga0yw44_86722_c1 | nmdc:mga0yw44_86722_c1_237_1217 | 326 |
| 669 | 3300050493 | nmdc:mga0k408_7030_c1 | nmdc:mga0k408_7030_c1_2111_3091 | 326 |
| 670 | 3300050494 | nmdc:mga06z11_45959_c1 | nmdc:mga06z11_45959_c1_133_1113 | 326 |
| 671 | 3300050496 | nmdc:mga07m45_65286_c1 | nmdc:mga07m45_65286_c1_796_1785 | 326 |
| 672 | 3300050508 | nmdc:mga09592_291054_c1 | nmdc:mga09592_291054_c1_204_1184 | 326 |
| 673 | 3300050508 | nmdc:mga09592_44949_c1 | nmdc:mga09592_44949_c1_2685_3665 | 326 |
| 674 | 3300050509 | nmdc:mga0qj67_17402_c1 | nmdc:mga0qj67_17402_c1_4136_5116 | 326 |
| 675 | 3300050510 | nmdc:mga06r32_199488_c1 | nmdc:mga06r32_199488_c1_159_1139 | 326 |
| 676 | 3300050512 | nmdc:mga0n895_106961_c1 | nmdc:mga0n895_106961_c1_1227_2207 | 326 |
| 677 | 3300050512 | nmdc:mga0n895_115366_c1 | nmdc:mga0n895_115366_c1_1618_2598 | 326 |
| 678 | 3300050512 | nmdc:mga0n895_549856_c1 | nmdc:mga0n895_549856_c1_25_1005 | 326 |
| 679 | 3300050512 | nmdc:mga0n895_73249_c1 | nmdc:mga0n895_73249_c1_1543_2523 | 326 |
| 680 | 3300050514 | nmdc:mga08x19_110857_c1 | nmdc:mga08x19_110857_c1_649_1629 | 326 |
| 681 | 3300050514 | nmdc:mga08x19_21691_c1 | nmdc:mga08x19_21691_c1_2582_3562 | 326 |
| 682 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_75946_76926 | 326 |
| 683 | 3300053077 | Ga0495601_0004968 | Ga0495601_0004968_838_1818 | 326 |
| 684 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_60902_61882 | 326 |
| 685 | 3300053079 | Ga0500610_0112927 | Ga0500610_0112927_82_1062 | 326 |
| 686 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_57201_58181 | 326 |
| 687 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_75946_76926 | 326 |
| 688 | 3300053085 | Ga0495619_0018391 | Ga0495619_0018391_3144_4124 | 326 |
| 689 | 3300053085 | Ga0495619_0087536 | Ga0495619_0087536_814_1794 | 326 |
| 690 | 3300053117 | Ga0500593_002797 | Ga0500593_002797_2866_3846 | 326 |
| 691 | 3300053119 | Ga0500595_001729 | Ga0500595_001729_6863_7843 | 326 |
| 692 | 3300053146 | Ga0500588_0001660 | Ga0500588_0001660_2339_3319 | 326 |
| 693 | 3300053146 | Ga0500588_0047309 | Ga0500588_0047309_199_1188 | 326 |
| 694 | 3300053151 | Ga0500604_0001281 | Ga0500604_0001281_2866_3855 | 326 |
| 695 | 3300053151 | Ga0500604_0007299 | Ga0500604_0007299_1501_2481 | 326 |
| 696 | 3300053153 | Ga0500616_0041337 | Ga0500616_0041337_630_1610 | 326 |
| 697 | 3300053158 | Ga0500627_0019554 | Ga0500627_0019554_332_1321 | 326 |
| 698 | 3300053158 | Ga0500627_0098299 | Ga0500627_0098299_320_1303 | 326 |
| 699 | 3300061734 | Ga0530510_0161347 | Ga0530510_0161347_225_1205 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w88-assembly2.cif.gz_F | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9621 | 2 | 326 |
| 1w88-assembly2.cif.gz_F | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9591 | 2 | 326 |
| 1umd-assembly1.cif.gz_D | branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate | 0.9579 | 2 | 326 |
| 6cer-assembly1.cif.gz_D | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9568 | 2 | 326 |
| 1w88-assembly2.cif.gz_H | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9565 | 2 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1w85B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9506 | 192 | 326 | 3.40.50.920 |
| 1um9B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9497 | 2 | 194 | 3.40.50.970 |
| 1qs0B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9454 | 189 | 322 | 3.40.50.920 |
| 1w85B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9437 | 192 | 326 | 3.40.50.920 |
| af_Q10G39_79_267_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9426 | 4 | 190 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B0WP24-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9791 | 1 | 294 |
GO:0000287
GO:0003824 |
| AF-A0A227J0R1-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9772 | 201 | 293 |
GO:0003824
|
| AF-A0A6N7FA51-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9769 | 131 | 324 |
GO:0003824
|
| AF-A0A6B0WP24-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9758 | 1 | 294 |
GO:0000287
GO:0003824 |
| AF-A0A534YDB8-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9723 | 2 | 322 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar