F476012

General Info

Members Datasets Scaffolds Average Seq Length
699 367 694 325

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100113722|Ga0070678_1001137222
Length 332
Sequence MGGRGFSMAELTYRDAVAAGIAQEMERDERVVFLGEDVADAGGVFKATVGLLDKFGPKRVRDCPISEQAILGAAMGAAMTGLRPIAEIMFSDFLAVCWDIVANEIAKSRYMTNGQISLPLVIRTANGAGSRFGAQHSQAVENWAMMIPGIKVVAPAFPADVKGLLAAAVRDPDPVLFFEQKSLYPMKGEVPDGEYVDQLGKARVLRSGKDCTIVALASMVHKSMDAAAALEKEHGIACTVIDLRSLVPLDTQTILGEVGKTGRLFTVEENPRLCGWGAEIVSIVAEECFWNLDAPIVRITTPHVPLPSADLLEDNTIPSVARIVREIREKMG

Samples

Sample ID Description Type Environment
1 2512875024 Mesorhizobium loti R88b Isolate Nodule
2 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
3 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
4 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
5 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
223 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
356 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
361 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.44
Nodule 0.43
Rhizoplane 7.73
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008875 3300003203 Bacteria 4524
2 JGI25153J46596_10000010 3300003215 Bacteria 337769
3 Ga0065715_10135985 3300005293 Bacteria 1930
4 Ga0070676_10119615 3300005328 Bacteria 1651
5 Ga0070683_100039965 3300005329 Bacteria 4310
6 Ga0070683_100047446 3300005329 Bacteria 3969
7 Ga0070683_100088335 3300005329 Bacteria 2908
8 Ga0070670_100005194 3300005331 Bacteria 10961
9 Ga0070670_100010828 3300005331 Bacteria 7790
10 Ga0070670_100069160 3300005331 Bacteria 3031
11 Ga0070670_100103417 3300005331 Bacteria 2453
12 Ga0070677_10057758 3300005333 Bacteria 1591
13 Ga0070680_100098358 3300005336 Bacteria 2427
14 Ga0068868_100000544 3300005338 Bacteria 25315
15 Ga0070660_100213577 3300005339 Bacteria 1567
16 Ga0070689_100050245 3300005340 Bacteria 3221
17 Ga0070689_100061702 3300005340 Bacteria 2916
18 Ga0070689_100061730 3300005340 Bacteria 2915
19 Ga0070691_10131909 3300005341 Bacteria 1267
20 Ga0070661_100014017 3300005344 Bacteria 5637
21 Ga0070692_10051973 3300005345 Bacteria 2133
22 Ga0070668_100024657 3300005347 Bacteria 4558
23 Ga0070668_100113176 3300005347 Bacteria 2162
24 Ga0070669_100081605 3300005353 Bacteria 2409
25 Ga0070675_100015371 3300005354 Bacteria 6050
26 Ga0070675_100108494 3300005354 Bacteria 2344
27 Ga0070671_100016634 3300005355 Bacteria 5945
28 Ga0070671_100035497 3300005355 Bacteria 4130
29 Ga0070674_100095128 3300005356 Bacteria 2159
30 Ga0070673_100005459 3300005364 Bacteria 8141
31 Ga0070673_100148486 3300005364 Bacteria 1983
32 Ga0070688_100055393 3300005365 Bacteria 2487
33 Ga0070659_100039631 3300005366 Bacteria 3678
34 Ga0070659_100057549 3300005366 Bacteria 3066
35 Ga0070667_100169799 3300005367 Bacteria 1925
36 Ga0070709_10001838 3300005434 Bacteria 11515
37 Ga0070709_10172580 3300005434 Bacteria 1512
38 Ga0070714_100085203 3300005435 Bacteria 2759
39 Ga0070713_100008135 3300005436 Bacteria 7422
40 Ga0070701_10014594 3300005438 Bacteria 3606
41 Ga0070711_100285695 3300005439 Bacteria 1307
42 Ga0070705_100000495 3300005440 Bacteria 22727
43 Ga0070705_100277279 3300005440 Bacteria 1190
44 Ga0070700_100126592 3300005441 Bacteria 1718
45 Ga0070700_100276567 3300005441 Bacteria 1215
46 Ga0070694_100015470 3300005444 Bacteria 4794
47 Ga0070694_100126229 3300005444 Bacteria 1842
48 Ga0070708_100003217 3300005445 Bacteria 12740
49 Ga0070663_100082371 3300005455 Bacteria 2367
50 Ga0070678_100000281 3300005456 Bacteria 23641
51 Ga0070678_100028549 3300005456 Bacteria 3807
52 Ga0070678_100113722 3300005456 Bacteria 2122
53 Ga0070662_100102734 3300005457 Bacteria 2166
54 Ga0070662_100143198 3300005457 Bacteria 1855
55 Ga0070685_10010154 3300005466 Bacteria 4888
56 Ga0070685_10047169 3300005466 Bacteria 2476
57 Ga0070706_100121271 3300005467 Bacteria 2437
58 Ga0070707_100006922 3300005468 Bacteria 10508
59 Ga0070699_100000158 3300005518 Bacteria 64029
60 Ga0070684_100016240 3300005535 Bacteria 6081
61 Ga0070684_100193002 3300005535 Bacteria 1854
62 Ga0070697_100041288 3300005536 Bacteria 3733
63 Ga0070697_100125137 3300005536 Bacteria 2153
64 Ga0068853_100081302 3300005539 Bacteria 2836
65 Ga0070672_100001595 3300005543 Bacteria 14069
66 Ga0070672_100004204 3300005543 Bacteria 9409
67 Ga0070672_100195682 3300005543 Bacteria 1689
68 Ga0070686_100003659 3300005544 Bacteria 8439
69 Ga0070686_100152520 3300005544 Bacteria 1619
70 Ga0070686_100357081 3300005544 Bacteria 1100
71 Ga0070695_100009449 3300005545 Bacteria 5806
72 Ga0070695_100171523 3300005545 Bacteria 1531
73 Ga0070696_100010445 3300005546 Bacteria 6222
74 Ga0070693_100161697 3300005547 Bacteria 1427
75 Ga0070665_100106145 3300005548 Bacteria 2811
76 Ga0070665_100228361 3300005548 Bacteria 1861
77 Ga0070704_100009759 3300005549 Bacteria 5818
78 Ga0070664_100007947 3300005564 Bacteria 8569
79 Ga0068857_100056849 3300005577 Bacteria 3472
80 Ga0068854_100015614 3300005578 Bacteria 5036
81 Ga0068856_100115685 3300005614 Bacteria 2682
82 Ga0070702_100028493 3300005615 Bacteria 3027
83 Ga0070702_100038821 3300005615 Bacteria 2654
84 Ga0068852_100000200 3300005616 Bacteria 40742
85 Ga0068859_100085823 3300005617 Bacteria 3193
86 Ga0068864_100036691 3300005618 Bacteria 4180
87 Ga0068864_100060098 3300005618 Bacteria 3290
88 Ga0068864_100157016 3300005618 Bacteria 2065
89 Ga0068866_10053799 3300005718 Bacteria 2060
90 Ga0068861_100261891 3300005719 Bacteria 1481
91 Ga0068870_10060060 3300005840 Bacteria 2040
92 Ga0068863_100009972 3300005841 Bacteria 9248
93 Ga0068863_100017201 3300005841 Bacteria 6934
94 Ga0068863_100112376 3300005841 Bacteria 2594
95 Ga0068858_100220300 3300005842 Bacteria 1797
96 Ga0068860_100005729 3300005843 Bacteria 12528
97 Ga0068860_100161614 3300005843 Bacteria 2160
98 Ga0068862_100001649 3300005844 Bacteria 20295
99 Ga0068862_100018237 3300005844 Bacteria 5843
100 Ga0068862_100302721 3300005844 Bacteria 1471
101 Ga0081538_10004000 3300005981 Bacteria 13727
102 Ga0081538_10016393 3300005981 Bacteria 5685
103 Ga0081540_1005998 3300005983 Bacteria 8951
104 Ga0081540_1014080 3300005983 Bacteria 5152
105 Ga0081540_1064427 3300005983 Bacteria 1729
106 Ga0081539_10002801 3300005985 Bacteria 23305
107 Ga0081539_10039440 3300005985 Bacteria 2786
108 Ga0081539_10161189 3300005985 Bacteria 1069
109 Ga0070717_10027405 3300006028 Bacteria 4554
110 Ga0075365_10053360 3300006038 Bacteria 2677
111 Ga0075365_10103751 3300006038 Bacteria 1949
112 Ga0075365_10175835 3300006038 Bacteria 1495
113 Ga0075363_100004257 3300006048 Bacteria 6222
114 Ga0075363_100040646 3300006048 Bacteria 2451
115 Ga0075364_10158854 3300006051 Bacteria 1525
116 Ga0075364_10232414 3300006051 Bacteria 1252
117 Ga0070715_10001029 3300006163 Bacteria 7873
118 Ga0070716_100076910 3300006173 Bacteria 1979
119 Ga0075362_10001107 3300006177 Bacteria 8361
120 Ga0075367_10037538 3300006178 Bacteria 2816
121 Ga0075367_10096575 3300006178 Bacteria 1802
122 Ga0075367_10161251 3300006178 Bacteria 1394
123 Ga0075366_10008250 3300006195 Bacteria 5782
124 Ga0097621_100003433 3300006237 Bacteria 10913
125 Ga0075370_10100220 3300006353 Bacteria 1676
126 Ga0075428_100005978 3300006844 Bacteria 13519
127 Ga0075428_100672413 3300006844 Bacteria 1104
128 Ga0075430_100001391 3300006846 Bacteria 19638
129 Ga0075430_100056675 3300006846 Bacteria 3296
130 Ga0075430_100117562 3300006846 Bacteria 2216
131 Ga0075431_100007118 3300006847 Bacteria 11115
132 Ga0075431_100024240 3300006847 Bacteria 6214
133 Ga0075431_100052784 3300006847 Bacteria 4191
134 Ga0075431_100254998 3300006847 Bacteria 1781
135 Ga0075431_100259582 3300006847 Bacteria 1763
136 Ga0075431_100624674 3300006847 Bacteria 1059
137 Ga0075433_10026200 3300006852 Bacteria 4934
138 Ga0075434_100061854 3300006871 Bacteria 3726
139 Ga0075429_100024317 3300006880 Bacteria 5256
140 Ga0075429_100107365 3300006880 Bacteria 2440
141 Ga0075436_100002520 3300006914 Bacteria 12602
142 Ga0097620_100085819 3300006931 Bacteria 3193
143 Ga0099794_10000104 3300007265 Bacteria 31247
144 Ga0099794_10096702 3300007265 Bacteria 1470
145 Ga0099795_10045891 3300007788 Bacteria 1572
146 Ga0105251_10086645 3300009011 Bacteria 1442
147 Ga0105240_10032455 3300009093 Bacteria 6761
148 Ga0105240_10130173 3300009093 Bacteria 3019
149 Ga0105240_10156897 3300009093 Bacteria 2706
150 Ga0111539_10072415 3300009094 Bacteria 4064
151 Ga0111539_10074818 3300009094 Bacteria 3991
152 Ga0105247_10046857 3300009101 Bacteria 2654
153 Ga0114129_10086220 3300009147 Bacteria 4355
154 Ga0114129_10457215 3300009147 Bacteria 1673
155 Ga0105243_10188172 3300009148 Bacteria 1801
156 Ga0105242_10198974 3300009176 Bacteria 1779
157 Ga0105242_10231955 3300009176 Bacteria 1655
158 Ga0105248_10071779 3300009177 Bacteria 3890
159 Ga0105248_10100379 3300009177 Bacteria 3261
160 Ga0105237_10345963 3300009545 Bacteria 1491
161 Ga0105238_10067684 3300009551 Bacteria 3572
162 Ga0105249_10000475 3300009553 Bacteria 37277
163 Ga0099796_10034050 3300010159 Bacteria 1680
164 Ga0105239_10012459 3300010375 Bacteria 9470
165 Ga0105239_10286325 3300010375 Bacteria 1855
166 Ga0105246_10206033 3300011119 Bacteria 1532
167 Ga0105246_10238293 3300011119 Bacteria 1437
168 Ga0157374_10000653 3300013296 Bacteria 30599
169 Ga0157378_10001132 3300013297 Bacteria 24292
170 Ga0163162_10131050 3300013306 Bacteria 2616
171 Ga0163162_10145173 3300013306 Bacteria 2488
172 Ga0163162_10335970 3300013306 Bacteria 1643
173 Ga0157372_10408424 3300013307 Bacteria 1582
174 Ga0157375_10001703 3300013308 Bacteria 18876
175 Ga0157375_10321053 3300013308 Bacteria 1713
176 Ga0163163_10021730 3300014325 Bacteria 6061
177 Ga0163163_10069852 3300014325 Bacteria 3497
178 Ga0163163_10131176 3300014325 Bacteria 2546
179 Ga0157380_10133590 3300014326 Bacteria 2121
180 Ga0157380_10187983 3300014326 Bacteria 1821
181 Ga0157380_10284305 3300014326 Bacteria 1515
182 Ga0157377_10009768 3300014745 Bacteria 4723
183 Ga0157377_10013216 3300014745 Bacteria 4175
184 Ga0157379_10113188 3300014968 Bacteria 2439
185 Ga0157376_10020667 3300014969 Bacteria 5099
186 Ga0213876_10003329 3300021384 Bacteria 9208
187 Ga0213876_10008211 3300021384 Bacteria 5652
188 Ga0213876_10021721 3300021384 Bacteria 3395
189 Ga0213876_10163658 3300021384 Bacteria 1184
190 Ga0209758_1000033 3300025297 Bacteria 469998
191 Ga0207697_10011678 3300025315 Bacteria 3707
192 Ga0207656_10020204 3300025321 Bacteria 2645
193 Ga0207653_10011499 3300025885 Bacteria 2761
194 Ga0207682_10002135 3300025893 Bacteria 8970
195 Ga0207682_10059324 3300025893 Bacteria 1599
196 Ga0207692_10062025 3300025898 Bacteria 1940
197 Ga0207692_10077089 3300025898 Bacteria 1772
198 Ga0207688_10004400 3300025901 Bacteria 7669
199 Ga0207685_10017899 3300025905 Bacteria 2303
200 Ga0207699_10326254 3300025906 Bacteria 1078
201 Ga0207645_10006895 3300025907 Bacteria 8102
202 Ga0207645_10013908 3300025907 Bacteria 5397
203 Ga0207643_10000132 3300025908 Bacteria 50824
204 Ga0207643_10002110 3300025908 Bacteria 10953
205 Ga0207654_10257721 3300025911 Bacteria 1171
206 Ga0207707_10093239 3300025912 Bacteria 2630
207 Ga0207695_10052905 3300025913 Bacteria 4251
208 Ga0207695_10139652 3300025913 Bacteria 2373
209 Ga0207695_10145384 3300025913 Bacteria 2316
210 Ga0207693_10000988 3300025915 Bacteria 25527
211 Ga0207693_10014858 3300025915 Bacteria 6254
212 Ga0207693_10024106 3300025915 Bacteria 4831
213 Ga0207663_10060053 3300025916 Bacteria 2408
214 Ga0207660_10122750 3300025917 Bacteria 1969
215 Ga0207662_10073964 3300025918 Bacteria 2068
216 Ga0207662_10137091 3300025918 Bacteria 1547
217 Ga0207657_10024231 3300025919 Bacteria 5630
218 Ga0207649_10031311 3300025920 Bacteria 3161
219 Ga0207652_10255689 3300025921 Bacteria 1580
220 Ga0207646_10091008 3300025922 Bacteria 2730
221 Ga0207694_10038798 3300025924 Bacteria 3663
222 Ga0207650_10001197 3300025925 Bacteria 19048
223 Ga0207650_10002081 3300025925 Bacteria 13987
224 Ga0207650_10003351 3300025925 Bacteria 11021
225 Ga0207650_10016727 3300025925 Bacteria 5128
226 Ga0207650_10181740 3300025925 Bacteria 1676
227 Ga0207650_10274901 3300025925 Bacteria 1370
228 Ga0207659_10011997 3300025926 Bacteria 5491
229 Ga0207659_10029082 3300025926 Bacteria 3762
230 Ga0207700_10057899 3300025928 Bacteria 2924
231 Ga0207700_10185655 3300025928 Bacteria 1744
232 Ga0207644_10000669 3300025931 Bacteria 21644
233 Ga0207644_10127627 3300025931 Bacteria 1943
234 Ga0207690_10295359 3300025932 Bacteria 1266
235 Ga0207706_10003081 3300025933 Bacteria 16020
236 Ga0207706_10070011 3300025933 Bacteria 3085
237 Ga0207686_10014996 3300025934 Bacteria 4326
238 Ga0207686_10124121 3300025934 Bacteria 1762
239 Ga0207709_10172122 3300025935 Bacteria 1521
240 Ga0207670_10004147 3300025936 Bacteria 7766
241 Ga0207670_10105118 3300025936 Bacteria 2023
242 Ga0207669_10063577 3300025937 Bacteria 2279
243 Ga0207704_10111779 3300025938 Bacteria 1848
244 Ga0207665_10003664 3300025939 Bacteria 10262
245 Ga0207691_10000470 3300025940 Bacteria 39893
246 Ga0207691_10053994 3300025940 Bacteria 3666
247 Ga0207711_10012335 3300025941 Bacteria 7103
248 Ga0207711_10435983 3300025941 Bacteria 1219
249 Ga0207661_10002744 3300025944 Bacteria 12121
250 Ga0207661_10314216 3300025944 Bacteria 1407
251 Ga0207679_10047223 3300025945 Bacteria 3127
252 Ga0207651_10020371 3300025960 Bacteria 4001
253 Ga0207651_10110726 3300025960 Bacteria 2060
254 Ga0207651_10183520 3300025960 Bacteria 1662
255 Ga0207651_10226603 3300025960 Bacteria 1514
256 Ga0207712_10001185 3300025961 Bacteria 18034
257 Ga0207712_10174653 3300025961 Bacteria 1683
258 Ga0207668_10244922 3300025972 Bacteria 1452
259 Ga0207668_10479557 3300025972 Bacteria 1066
260 Ga0207677_10001341 3300026023 Bacteria 13198
261 Ga0207703_10059555 3300026035 Bacteria 3119
262 Ga0207678_10005470 3300026067 Bacteria 11361
263 Ga0207678_10059999 3300026067 Bacteria 3272
264 Ga0207708_10015889 3300026075 Bacteria 5652
265 Ga0207702_10108403 3300026078 Bacteria 2464
266 Ga0207702_10138984 3300026078 Bacteria 2196
267 Ga0207641_10010430 3300026088 Bacteria 7635
268 Ga0207641_10418873 3300026088 Bacteria 1289
269 Ga0207648_10012278 3300026089 Bacteria 8020
270 Ga0207648_10015184 3300026089 Bacteria 7088
271 Ga0207648_10031802 3300026089 Bacteria 4663
272 Ga0207676_10001530 3300026095 Bacteria 17068
273 Ga0207676_10007595 3300026095 Bacteria 7696
274 Ga0207676_10009147 3300026095 Bacteria 7052
275 Ga0207676_10032741 3300026095 Bacteria 3921
276 Ga0207676_10046205 3300026095 Bacteria 3368
277 Ga0207676_10286517 3300026095 Bacteria 1498
278 Ga0207674_10003960 3300026116 Bacteria 18007
279 Ga0207675_100040881 3300026118 Bacteria 4331
280 Ga0207675_100044150 3300026118 Bacteria 4164
281 Ga0207675_100081085 3300026118 Bacteria 3042
282 Ga0207683_10000581 3300026121 Bacteria 33773
283 Ga0207683_10000755 3300026121 Bacteria 29385
284 Ga0207683_10021344 3300026121 Bacteria 5542
285 Ga0207683_10070780 3300026121 Bacteria 3082
286 Ga0207698_10000953 3300026142 Bacteria 16813
287 Ga0209967_1001698 3300027364 Bacteria 2830
288 Ga0209179_1003214 3300027512 Bacteria 2325
289 Ga0209999_1005118 3300027543 Bacteria 2359
290 Ga0209588_1000009 3300027671 Bacteria 174900
291 Ga0209974_10001468 3300027876 Bacteria 8552
292 Ga0207428_10006759 3300027907 Bacteria 10522
293 Ga0268266_10411813 3300028379 Bacteria 1280
294 Ga0268265_10001944 3300028380 Bacteria 16407
295 Ga0268265_10087925 3300028380 Bacteria 2474
296 Ga0268265_10186540 3300028380 Bacteria 1787
297 Ga0268265_10275676 3300028380 Bacteria 1502
298 Ga0268264_10009120 3300028381 Bacteria 8226
299 Ga0268264_10357760 3300028381 Bacteria 1391
300 Ga0265318_10006701 3300028577 Bacteria 5277
301 Ga0265318_10027395 3300028577 Bacteria 2240
302 Ga0307515_10063235 3300028794 Bacteria 5205
303 Ga0265338_10053521 3300028800 Bacteria 3610
304 Ga0265332_10000310 3300031238 Bacteria 37390
305 Ga0265332_10003853 3300031238 Bacteria 7164
306 Ga0265332_10015644 3300031238 Bacteria 3349
307 Ga0265332_10060909 3300031238 Bacteria 1614
308 Ga0265328_10028090 3300031239 Bacteria 2106
309 Ga0265320_10019572 3300031240 Bacteria 3698
310 Ga0265320_10033117 3300031240 Bacteria 2640
311 Ga0265325_10006109 3300031241 Bacteria 7355
312 Ga0265329_10011028 3300031242 Bacteria 3296
313 Ga0265340_10006782 3300031247 Bacteria 6268
314 Ga0265339_10001481 3300031249 Bacteria 17344
315 Ga0265331_10004097 3300031250 Bacteria 9158
316 Ga0265331_10024928 3300031250 Bacteria 3022
317 Ga0265331_10033074 3300031250 Bacteria 2558
318 Ga0265316_10118829 3300031344 Bacteria 1997
319 Ga0265316_10258394 3300031344 Bacteria 1278
320 Ga0316579_10033433 3300031691 Bacteria 2361
321 Ga0265314_10106115 3300031711 Bacteria 1795
322 Ga0265342_10000175 3300031712 Bacteria 71083
323 Ga0265342_10023796 3300031712 Bacteria 3871
324 Ga0265342_10174231 3300031712 Bacteria 1181
325 Ga0316576_10014919 3300031727 Bacteria 5198
326 Ga0307516_10002086 3300031730 Bacteria 27199
327 Ga0307516_10084832 3300031730 Bacteria 3006
328 Ga0307405_10022972 3300031731 Bacteria 3536
329 Ga0307405_10416536 3300031731 Bacteria 1056
330 Ga0316577_10008457 3300031733 Bacteria 5518
331 Ga0307413_10251226 3300031824 Bacteria 1312
332 Ga0307410_10296870 3300031852 Bacteria 1273
333 Ga0307407_10017234 3300031903 Bacteria 3618
334 Ga0307416_100007220 3300032002 Bacteria 7039
335 Ga0307411_10226459 3300032005 Bacteria 1454
336 Ga0373934_0039193 3300035086 Bacteria 1867
337 Ga0373923_0000157 3300035111 Bacteria 13326
338 Ga0373936_0035416 3300035113 Bacteria 1987
339 Ga0373945_0004209 3300035116 Bacteria 4561
340 Ga0373953_0007423 3300035117 Bacteria 3671
341 Ga0373954_0029599 3300035118 Bacteria 2522
342 Ga0373943_0001586 3300035170 Bacteria 10296
343 Ga0373943_0043005 3300035170 Bacteria 2192
344 Ga0373943_0094381 3300035170 Bacteria 1554
345 Ga0373946_0003086 3300035171 Bacteria 5900
346 Ga0373955_0000562 3300035172 Bacteria 15770
347 Ga0373962_0005165 3300035242 Bacteria 3155
348 Ga0316574_0136391 3300035398 Bacteria 1580
349 Ga0373924_0005771 3300035410 Bacteria 4402
350 Ga0373935_0255045 3300035692 Bacteria 1228
351 Ga0373933_0045120 3300035724 Bacteria 2613
352 Ga0373947_0049565 3300035725 Bacteria 2522
353 Ga0373937_0000009 3300036401 Bacteria 169521
354 Ga0316582_0199445 3300036647 Bacteria 1365
355 Ga0316584_0033327 3300036712 Bacteria 3815
356 Ga0373925_0000194 3300037068 Bacteria 66124
357 Ga0373925_0004439 3300037068 Bacteria 10600
358 Ga0373925_0007047 3300037068 Bacteria 8213
359 Ga0373925_0024598 3300037068 Bacteria 4398
360 Ga0373925_0091665 3300037068 Bacteria 2324
361 Ga0373925_0115129 3300037068 Bacteria 2082
362 Ga0395905_0001088 3300037471 Bacteria 34174
363 Ga0395905_0173156 3300037471 Bacteria 2027
364 Ga0436364_0104023 3300037853 Bacteria 1128
365 Ga0436364_0216969 3300037853 Unclassified 1032
366 Ga0436365_0047572 3300039437 Bacteria 8696
367 Ga0436365_0803180 3300039437 Bacteria 1528
368 Ga0436365_1535122 3300039437 Bacteria 8641
369 Ga0436365_1613453 3300039437 Bacteria 24235
370 Ga0436361_0668552 3300039447 Bacteria 2982
371 Ga0436363_0153896 3300039450 Bacteria 3361
372 Ga0436363_0979456 3300039450 Bacteria 1052
373 Ga0436362_0471479 3300039453 Bacteria 6434
374 Ga0439461_0013081 3300041410 Bacteria 1562
375 Ga0439435_0000853 3300042436 Bacteria 5221
376 Ga0439435_0025327 3300042436 Bacteria 1572
377 Ga0495592_0000018 3300046454 Bacteria 140962
378 Ga0495603_0036468 3300046455 Bacteria 2952
379 Ga0495629_0005894 3300046459 Bacteria 9132
380 Ga0495629_0103941 3300046459 Bacteria 1981
381 Ga0495638_0007358 3300046460 Bacteria 7903
382 Ga0495638_0025383 3300046460 Bacteria 3853
383 Ga0495651_0002271 3300046462 Bacteria 14833
384 Ga0495653_0000032 3300046463 Bacteria 132763
385 Ga0495580_0314286 3300046472 Bacteria 1065
386 Ga0495582_0005975 3300046473 Bacteria 6784
387 Ga0495582_0039554 3300046473 Bacteria 2596
388 Ga0495605_0063268 3300046474 Bacteria 1765
389 Ga0495639_0081300 3300046475 Bacteria 1510
390 Ga0495639_0106743 3300046475 Bacteria 1326
391 Ga0495662_0007065 3300046476 Bacteria 5576
392 Ga0495664_0000010 3300046477 Bacteria 268381
393 Ga0495584_0040269 3300046491 Bacteria 2359
394 Ga0495584_0045185 3300046491 Bacteria 2222
395 Ga0495607_0098868 3300046501 Bacteria 1566
396 Ga0495608_0000008 3300046511 Bacteria 268629
397 Ga0495618_0000002 3300046514 Bacteria 271353
398 Ga0495628_0000009 3300046516 Bacteria 237611
399 Ga0495628_0074585 3300046516 Bacteria 2642
400 Ga0495630_0005324 3300046517 Bacteria 9079
401 Ga0495630_0193828 3300046517 Bacteria 1550
402 Ga0495644_0013428 3300046523 Bacteria 3143
403 Ga0495663_0068005 3300046525 Bacteria 1130
404 Ga0495652_0000011 3300046529 Bacteria 255329
405 Ga0495654_0076317 3300046530 Bacteria 1579
406 Ga0495665_0012720 3300046531 Bacteria 4554
407 Ga0495640_0000009 3300046533 Bacteria 217086
408 Ga0495587_0000006 3300046536 Bacteria 310070
409 Ga0495587_0018219 3300046536 Bacteria 4355
410 Ga0495621_0020602 3300046539 Bacteria 2166
411 Ga0495645_0000010 3300046543 Bacteria 238337
412 Ga0495633_0019278 3300046558 Bacteria 3451
413 Ga0495667_0000005 3300046559 Bacteria 268252
414 Ga0495667_0194649 3300046559 Bacteria 1298
415 Ga0495656_0033241 3300046615 Bacteria 2104
416 Ga0495668_0019322 3300046616 Bacteria 3929
417 Ga0495668_0084296 3300046616 Bacteria 1743
418 Ga0495634_0000223 3300046642 Bacteria 53103
419 Ga0495625_0083178 3300046660 Bacteria 2225
420 Ga0495635_0000008 3300046663 Bacteria 268349
421 Ga0495588_0031067 3300046674 Bacteria 2687
422 Ga0495657_0000058 3300046675 Bacteria 97827
423 Ga0495599_0000007 3300046678 Bacteria 236638
424 Ga0495623_0000085 3300046679 Bacteria 55527
425 Ga0495646_0000021 3300046680 Bacteria 115358
426 Ga0495647_0019538 3300046681 Bacteria 2423
427 Ga0495658_0049538 3300046683 Bacteria 2373
428 Ga0495658_0128265 3300046683 Bacteria 1541
429 Ga0495658_0208317 3300046683 Bacteria 1221
430 Ga0495669_0094739 3300046684 Bacteria 1382
431 Ga0495613_0016426 3300046689 Bacteria 5513
432 Ga0495624_0094266 3300046690 Bacteria 1845
433 Ga0495670_0050454 3300046691 Bacteria 2083
434 Ga0495589_0094778 3300046794 Bacteria 1448
435 Ga0495600_0000001 3300046809 Bacteria 214870
436 Ga0495581_0046995 3300047315 Bacteria 2494
437 Ga0495581_0161680 3300047315 Bacteria 1309
438 Ga0495604_0000012 3300047317 Bacteria 268341
439 Ga0495604_0073579 3300047317 Bacteria 2579
440 Ga0495636_0091357 3300047318 Bacteria 1322
441 Ga0495674_0000011 3300047319 Bacteria 270911
442 Ga0495676_0080664 3300047321 Bacteria 2469
443 Ga0495680_0001281 3300047322 Bacteria 27427
444 Ga0495680_0347626 3300047322 Bacteria 1033
445 Ga0495675_0000096 3300047444 Bacteria 62617
446 Ga0495684_0000084 3300047471 Bacteria 65600
447 Ga0495593_0001526 3300047673 Bacteria 13624
448 Ga0495602_0000073 3300048088 Bacteria 98745
449 Ga0495615_0033202 3300048090 Bacteria 1249
450 Ga0496100_0015237 3300048903 Bacteria 4486
451 Ga0496100_0028490 3300048903 Bacteria 3445
452 Ga0496100_0065531 3300048903 Bacteria 2407
453 Ga0496100_0107444 3300048903 Bacteria 1933
454 Ga0496100_0144316 3300048903 Bacteria 1691
455 Ga0496101_0014939 3300048904 Bacteria 5224
456 Ga0496101_0015869 3300048904 Bacteria 5083
457 Ga0496102_0028797 3300048905 Bacteria 4965
458 Ga0496102_0080917 3300048905 Bacteria 2994
459 Ga0496102_0092173 3300048905 Bacteria 2806
460 Ga0496102_0212232 3300048905 Unclassified 1825
461 Ga0496103_0005890 3300048906 Bacteria 7326
462 Ga0496104_0000445 3300048907 Bacteria 35921
463 Ga0496104_0001219 3300048907 Bacteria 22114
464 Ga0496104_0002378 3300048907 Bacteria 16215
465 Ga0496104_0077142 3300048907 Bacteria 3174
466 Ga0496104_0446002 3300048907 Bacteria 1206
467 Ga0496105_0046477 3300048908 Bacteria 3583
468 Ga0496106_0000388 3300048909 Bacteria 31323
469 Ga0496106_0004954 3300048909 Bacteria 9851
470 Ga0496106_0230729 3300048909 Bacteria 1478
471 Ga0496107_0004447 3300048910 Bacteria 9503
472 Ga0496107_0022084 3300048910 Bacteria 4496
473 Ga0496107_0081615 3300048910 Bacteria 2358
474 Ga0496108_0003673 3300048911 Bacteria 12302
475 Ga0496108_0004728 3300048911 Bacteria 10980
476 Ga0496108_0062222 3300048911 Bacteria 3143
477 Ga0496109_0001694 3300048912 Bacteria 18370
478 Ga0496109_0001818 3300048912 Bacteria 17745
479 Ga0496109_0004263 3300048912 Bacteria 11944
480 Ga0496110_0002379 3300048913 Bacteria 14095
481 Ga0496110_0004198 3300048913 Bacteria 11135
482 Ga0496110_0413055 3300048913 Bacteria 1230
483 Ga0496110_0466053 3300048913 Bacteria 1151
484 Ga0496110_0567569 3300048913 Bacteria 1031
485 Ga0496111_0000375 3300048914 Bacteria 22279
486 Ga0496111_0007514 3300048914 Bacteria 7150
487 Ga0496111_0359750 3300048914 Bacteria 1077
488 Ga0496112_0009605 3300048915 Bacteria 8726
489 Ga0496112_0074254 3300048915 Bacteria 3362
490 Ga0496112_0108034 3300048915 Bacteria 2752
491 Ga0496112_0438064 3300048915 Bacteria 1245
492 Ga0496113_0014110 3300048916 Bacteria 5438
493 Ga0496113_0016155 3300048916 Bacteria 5152
494 Ga0496113_0049815 3300048916 Bacteria 3120
495 Ga0496113_0108789 3300048916 Bacteria 2155
496 Ga0496114_0018470 3300048917 Bacteria 5638
497 Ga0496114_0052250 3300048917 Bacteria 3404
498 Ga0496114_0197813 3300048917 Unclassified 1760
499 Ga0496114_0287434 3300048917 Bacteria 1450
500 Ga0496115_0045185 3300048918 Bacteria 3516
501 Ga0496115_0113604 3300048918 Bacteria 2225
502 Ga0496115_0158594 3300048918 Bacteria 1869
503 Ga0496115_0250833 3300048918 Bacteria 1457
504 Ga0496121_0240390 3300048924 Bacteria 1262
505 Ga0501031_0020357 3300049568 Bacteria 4324
506 Ga0501033_0023284 3300049570 Bacteria 4671
507 Ga0501033_0026890 3300049570 Bacteria 4329
508 Ga0501033_0035637 3300049570 Bacteria 3730
509 Ga0501034_0004413 3300049571 Bacteria 15657
510 Ga0501036_0015406 3300049572 Bacteria 6385
511 Ga0501036_0018718 3300049572 Bacteria 5807
512 Ga0501036_0020831 3300049572 Bacteria 5507
513 Ga0501036_0034448 3300049572 Bacteria 4283
514 Ga0501036_0212713 3300049572 Bacteria 1624
515 Ga0501037_0012501 3300049573 Bacteria 6253
516 Ga0501037_0027717 3300049573 Bacteria 4186
517 Ga0501037_0085302 3300049573 Bacteria 2286
518 Ga0501038_0001483 3300049574 Bacteria 21610
519 Ga0501038_0039646 3300049574 Bacteria 4119
520 Ga0501038_0081595 3300049574 Bacteria 2724
521 Ga0501039_0002955 3300049575 Bacteria 12718
522 Ga0501039_0014481 3300049575 Bacteria 6038
523 Ga0501039_0106253 3300049575 Bacteria 2192
524 Ga0501039_0138657 3300049575 Bacteria 1910
525 Ga0501040_0002082 3300049576 Bacteria 12885
526 Ga0501040_0017695 3300049576 Bacteria 4730
527 Ga0501040_0038640 3300049576 Bacteria 3244
528 Ga0501040_0041694 3300049576 Bacteria 3126
529 Ga0501040_0043695 3300049576 Bacteria 3055
530 Ga0501041_0002051 3300049577 Bacteria 11341
531 Ga0501041_0003848 3300049577 Bacteria 8632
532 Ga0501041_0004416 3300049577 Bacteria 8132
533 Ga0501041_0044025 3300049577 Bacteria 2713
534 Ga0501041_0098880 3300049577 Bacteria 1805
535 Ga0501042_0006501 3300049578 Bacteria 7589
536 Ga0501042_0008572 3300049578 Bacteria 6762
537 Ga0501042_0035032 3300049578 Bacteria 3561
538 Ga0501042_0059051 3300049578 Bacteria 2738
539 Ga0501042_0146936 3300049578 Bacteria 1700
540 Ga0501042_0221097 3300049578 Bacteria 1366
541 Ga0501043_0025776 3300049579 Bacteria 4612
542 Ga0501043_0028283 3300049579 Bacteria 4400
543 Ga0501043_0067206 3300049579 Bacteria 2815
544 Ga0501046_0005973 3300049580 Bacteria 10837
545 Ga0501046_0010727 3300049580 Bacteria 7858
546 Ga0501046_0079239 3300049580 Bacteria 2540
547 Ga0501046_0080472 3300049580 Bacteria 2517
548 Ga0501046_0102555 3300049580 Bacteria 2193
549 Ga0501046_0105293 3300049580 Bacteria 2161
550 Ga0501047_0407601 3300049581 Bacteria 1192
551 Ga0501048_0017493 3300049582 Bacteria 5278
552 Ga0501048_0028264 3300049582 Bacteria 4071
553 Ga0501048_0087749 3300049582 Bacteria 2194
554 Ga0501068_0009909 3300049584 Bacteria 5340
555 Ga0501068_0021171 3300049584 Bacteria 3795
556 Ga0501068_0073670 3300049584 Bacteria 2086
557 Ga0501068_0228745 3300049584 Bacteria 1182
558 Ga0501069_0106615 3300049585 Bacteria 1593
559 Ga0501069_0190503 3300049585 Bacteria 1187
560 Ga0501071_0032246 3300049587 Bacteria 3719
561 Ga0501071_0041132 3300049587 Bacteria 3309
562 Ga0501071_0055178 3300049587 Bacteria 2868
563 Ga0501071_0282318 3300049587 Bacteria 1257
564 Ga0501072_0001271 3300049588 Bacteria 18833
565 Ga0501072_0009293 3300049588 Bacteria 7471
566 Ga0501072_0038467 3300049588 Bacteria 3755
567 Ga0501072_0120850 3300049588 Bacteria 2087
568 Ga0501072_0285854 3300049588 Bacteria 1311
569 Ga0501073_0002264 3300049589 Bacteria 14398
570 Ga0501074_0001230 3300049590 Bacteria 16892
571 Ga0501074_0064092 3300049590 Bacteria 2646
572 Ga0501074_0076131 3300049590 Bacteria 2409
573 Ga0501074_0079731 3300049590 Bacteria 2349
574 Ga0501074_0085815 3300049590 Bacteria 2255
575 Ga0501074_0337020 3300049590 Bacteria 1070
576 Ga0501075_0003461 3300049591 Bacteria 10555
577 Ga0501075_0012910 3300049591 Bacteria 5950
578 Ga0501075_0016310 3300049591 Bacteria 5348
579 Ga0501075_0026034 3300049591 Bacteria 4301
580 Ga0501075_0045440 3300049591 Bacteria 3296
581 Ga0501075_0058529 3300049591 Bacteria 2902
582 Ga0501076_0006995 3300049592 Bacteria 8196
583 Ga0501076_0010342 3300049592 Bacteria 6919
584 Ga0501076_0036537 3300049592 Bacteria 3849
585 Ga0501076_0335648 3300049592 Bacteria 1240
586 Ga0501076_0398644 3300049592 Bacteria 1131
587 Ga0501077_0037560 3300049593 Bacteria 3084
588 Ga0501077_0113646 3300049593 Bacteria 1717
589 Ga0501077_0194975 3300049593 Bacteria 1287
590 Ga0501079_0001328 3300049741 Bacteria 17387
591 Ga0501079_0004670 3300049741 Bacteria 10145
592 Ga0501079_0052091 3300049741 Bacteria 3160
593 Ga0501079_0056402 3300049741 Bacteria 3031
594 Ga0501079_0066529 3300049741 Bacteria 2781
595 Ga0501080_0005631 3300049742 Bacteria 11193
596 Ga0501080_0048254 3300049742 Bacteria 3963
597 Ga0501080_0055289 3300049742 Bacteria 3697
598 Ga0501080_0351334 3300049742 Bacteria 1331
599 Ga0501081_0000347 3300049743 Bacteria 24912
600 Ga0501081_0009005 3300049743 Bacteria 6488
601 Ga0501081_0010042 3300049743 Bacteria 6172
602 Ga0501081_0010184 3300049743 Bacteria 6135
603 Ga0501081_0027372 3300049743 Bacteria 3846
604 Ga0501081_0038104 3300049743 Bacteria 3282
605 Ga0501081_0041336 3300049743 Bacteria 3157
606 Ga0501081_0048196 3300049743 Bacteria 2932
607 Ga0501081_0162780 3300049743 Bacteria 1608
608 Ga0501083_0005244 3300049744 Bacteria 9166
609 Ga0501083_0008226 3300049744 Bacteria 7375
610 Ga0501083_0013741 3300049744 Bacteria 5662
611 Ga0501083_0051936 3300049744 Bacteria 2755
612 Ga0501083_0249010 3300049744 Bacteria 1157
613 Ga0501035_0217947 3300049822 Bacteria 1630
614 Ga0501035_0479243 3300049822 Bacteria 1026
615 Ga0501044_0059434 3300049823 Bacteria 3916
616 Ga0501044_0174210 3300049823 Bacteria 2121
617 Ga0501045_0001638 3300049824 Bacteria 15023
618 Ga0501045_0011396 3300049824 Bacteria 6243
619 Ga0501045_0021776 3300049824 Bacteria 4588
620 Ga0501045_0024960 3300049824 Bacteria 4294
621 nmdc:mga03683_12449_c1 3300050489 Bacteria 3108
622 nmdc:mga03683_762_c1 3300050489 Bacteria 9224
623 nmdc:mga03n38_66496_c1 3300050490 Bacteria 1656
624 nmdc:mga03n38_8935_c1 3300050490 Bacteria 3618
625 nmdc:mga00v17_207188_c1 3300050491 Bacteria 1268
626 nmdc:mga0yw44_12424_c1 3300050492 Bacteria 4438
627 nmdc:mga0yw44_3606_c1 3300050492 Bacteria 6907
628 nmdc:mga0yw44_7591_c1 3300050492 Bacteria 5347
629 nmdc:mga0yw44_86722_c1 3300050492 Bacteria 1972
630 nmdc:mga0k408_7030_c1 3300050493 Bacteria 6007
631 nmdc:mga06z11_45959_c1 3300050494 Bacteria 2210
632 nmdc:mga07m45_65286_c1 3300050496 Bacteria 2066
633 nmdc:mga05p37_98899_c1 3300050507 Bacteria 3594
634 nmdc:mga09592_114863_c1 3300050508 Bacteria 2311
635 nmdc:mga09592_173869_c1 3300050508 Bacteria 1863
636 nmdc:mga09592_291054_c1 3300050508 Bacteria 1416
637 nmdc:mga09592_44949_c1 3300050508 Bacteria 3719
638 nmdc:mga0qj67_17402_c1 3300050509 Bacteria 5464
639 nmdc:mga0qj67_212311_c1 3300050509 Bacteria 1572
640 nmdc:mga0qj67_71664_c1 3300050509 Bacteria 2766
641 nmdc:mga06r32_199488_c1 3300050510 Bacteria 1989
642 nmdc:mga06r32_218532_c1 3300050510 Bacteria 1894
643 nmdc:mga08y16_11692_c1 3300050511 Bacteria 9224
644 nmdc:mga08y16_119084_c1 3300050511 Bacteria 2748
645 nmdc:mga08y16_58758_c1 3300050511 Bacteria 4018
646 nmdc:mga08y16_96694_c1 3300050511 Bacteria 3075
647 nmdc:mga0n895_106961_c1 3300050512 Bacteria 2810
648 nmdc:mga0n895_115366_c1 3300050512 Bacteria 2704
649 nmdc:mga0n895_132887_c1 3300050512 Bacteria 2514
650 nmdc:mga0n895_549856_c1 3300050512 Bacteria 1160
651 nmdc:mga0n895_73249_c1 3300050512 Bacteria 3400
652 nmdc:mga08x19_110857_c1 3300050514 Bacteria 1830
653 nmdc:mga08x19_21691_c1 3300050514 Bacteria 3969
654 nmdc:mga08x19_294442_c1 3300050514 Bacteria 1126
655 nmdc:mga0a205_24943_c1 3300050515 Bacteria 5041
656 Ga0495601_0000009 3300053077 Bacteria 270622
657 Ga0495601_0004968 3300053077 Bacteria 7718
658 Ga0495612_0000019 3300053078 Bacteria 137844
659 Ga0495612_0000090 3300053078 Bacteria 40215
660 Ga0500610_0112927 3300053079 Bacteria 1395
661 Ga0495595_0000015 3300053084 Bacteria 144946
662 Ga0495619_0000012 3300053085 Bacteria 268349
663 Ga0495619_0018391 3300053085 Bacteria 4434
664 Ga0495619_0087536 3300053085 Bacteria 2106
665 Ga0495619_0112881 3300053085 Bacteria 1858
666 Ga0500593_002797 3300053117 Bacteria 6468
667 Ga0500595_001729 3300053119 Bacteria 11391
668 Ga0500588_0001660 3300053146 Bacteria 4308
669 Ga0500588_0047309 3300053146 Bacteria 1326
670 Ga0500604_0001281 3300053151 Bacteria 7035
671 Ga0500604_0007299 3300053151 Bacteria 2929
672 Ga0500616_0041337 3300053153 Bacteria 2475
673 Ga0500627_0019554 3300053158 Bacteria 2701
674 Ga0500627_0098299 3300053158 Bacteria 1313
675 Ga0500637_0011014 3300053178 Bacteria 4655
676 Ga0501084_0003640 3300054114 Bacteria 12515
677 Ga0501084_0013611 3300054114 Bacteria 6731
678 Ga0501084_0041440 3300054114 Bacteria 3852
679 Ga0501084_0052208 3300054114 Bacteria 3421
680 Ga0501084_0069409 3300054114 Bacteria 2950
681 Ga0501082_0002535 3300060353 Bacteria 15994
682 Ga0501082_0005369 3300060353 Bacteria 11118
683 Ga0501082_0015536 3300060353 Bacteria 6554
684 Ga0501082_0028880 3300060353 Bacteria 4778
685 Ga0501082_0039944 3300060353 Bacteria 4048
686 Ga0501082_0064574 3300060353 Bacteria 3152
687 Ga0530510_0027909 3300061734 Bacteria 4045
688 Ga0530510_0037230 3300061734 Bacteria 3507
689 Ga0530510_0079593 3300061734 Bacteria 2384
690 Ga0530510_0119304 3300061734 Bacteria 1936
691 Ga0530510_0121744 3300061734 Bacteria 1915
692 Ga0530510_0127595 3300061734 Bacteria 1870
693 Ga0530510_0161347 3300061734 Bacteria 1658
694 Ga0530510_0200050 3300061734 Bacteria 1483

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0012720 Ga0495665_0012720_10_828 272
2 3300046683 Ga0495658_0208317 Ga0495658_0208317_23_847 274
3 3300047322 Ga0495680_0347626 Ga0495680_0347626_193_1017 274
4 3300035242 Ga0373962_0005165 Ga0373962_0005165_22_852 276
5 3300046473 Ga0495582_0005975 Ga0495582_0005975_19_849 276
6 3300046516 Ga0495628_0074585 Ga0495628_0074585_1773_2603 276
7 3300046536 Ga0495587_0018219 Ga0495587_0018219_19_849 276
8 3300047315 Ga0495581_0046995 Ga0495581_0046995_1646_2476 276
9 3300049587 Ga0501071_0282318 Ga0501071_0282318_12_854 280
10 3300049574 Ga0501038_0039646 Ga0501038_0039646_507_1433 286
11 3300049744 Ga0501083_0249010 Ga0501083_0249010_276_1145 289
12 3300048915 Ga0496112_0438064 Ga0496112_0438064_299_1171 290
13 3300053078 Ga0495612_0000090 Ga0495612_0000090_9990_10976 298
14 3300049590 Ga0501074_0337020 Ga0501074_0337020_13_927 300
15 3300049822 Ga0501035_0479243 Ga0501035_0479243_66_980 300
16 3300061734 Ga0530510_0121744 Ga0530510_0121744_988_1902 300
17 3300049824 Ga0501045_0021776 Ga0501045_0021776_1868_3121 306
18 3300006844 Ga0075428_100005978 Ga0075428_1000059788 308
19 3300027907 Ga0207428_10006759 Ga0207428_100067595 308
20 3300050508 nmdc:mga09592_173869_c1 nmdc:mga09592_173869_c1_772_1749 308
21 3300050511 nmdc:mga08y16_11692_c1 nmdc:mga08y16_11692_c1_5104_6081 308
22 3300035398 Ga0316574_0136391 Ga0316574_0136391_160_1137 309
23 3300037471 Ga0395905_0173156 Ga0395905_0173156_1082_2014 309
24 3300039450 Ga0436363_0153896 Ga0436363_0153896_31_960 309
25 3300048913 Ga0496110_0466053 Ga0496110_0466053_32_961 309
26 3300049585 Ga0501069_0106615 Ga0501069_0106615_308_1285 310
27 3300005545 Ga0070695_100171523 Ga0070695_1001715232 315
28 3300009094 Ga0111539_10072415 Ga0111539_100724153 315
29 3300014326 Ga0157380_10187983 Ga0157380_101879832 315
30 3300049584 Ga0501068_0021171 Ga0501068_0021171_38_994 315
31 3300050511 nmdc:mga08y16_96694_c1 nmdc:mga08y16_96694_c1_1108_2085 315
32 3300049744 Ga0501083_0005244 Ga0501083_0005244_2391_3641 318
33 3300031731 Ga0307405_10416536 Ga0307405_104165361 320
34 iso_pu_bacteria 2889790730 2889792695 321
35 iso_pu_bacteria 2889914905 2889918909 321
36 iso_pu_bacteria 2512875024 2512962156 322
37 iso_pu_bacteria 2869162929 2869166041 322
38 iso_pu_bacteria 2987652177 2987653346 322
39 3300031727 Ga0316576_10014919 Ga0316576_100149192 323
40 3300031733 Ga0316577_10008457 Ga0316577_100084574 323
41 3300036712 Ga0316584_0033327 Ga0316584_0033327_1587_2558 323
42 3300005336 Ga0070680_100098358 Ga0070680_1000983582 324
43 3300005341 Ga0070691_10131909 Ga0070691_101319092 324
44 3300005345 Ga0070692_10051973 Ga0070692_100519732 324
45 3300005438 Ga0070701_10014594 Ga0070701_100145943 324
46 3300005440 Ga0070705_100000495 Ga0070705_10000049517 324
47 3300005444 Ga0070694_100015470 Ga0070694_1000154707 324
48 3300005455 Ga0070663_100082371 Ga0070663_1000823713 324
49 3300005518 Ga0070699_100000158 Ga0070699_1000001588 324
50 3300005535 Ga0070684_100016240 Ga0070684_1000162402 324
51 3300005545 Ga0070695_100009449 Ga0070695_1000094492 324
52 3300005546 Ga0070696_100010445 Ga0070696_1000104452 324
53 3300005549 Ga0070704_100009759 Ga0070704_1000097597 324
54 3300005577 Ga0068857_100056849 Ga0068857_1000568495 324
55 3300005615 Ga0070702_100038821 Ga0070702_1000388213 324
56 3300005841 Ga0068863_100017201 Ga0068863_1000172012 324
57 3300005842 Ga0068858_100220300 Ga0068858_1002203002 324
58 3300005843 Ga0068860_100005729 Ga0068860_1000057292 324
59 3300005844 Ga0068862_100001649 Ga0068862_10000164914 324
60 3300005985 Ga0081539_10039440 Ga0081539_100394402 324
61 3300006846 Ga0075430_100001391 Ga0075430_10000139118 324
62 3300006847 Ga0075431_100007118 Ga0075431_10000711811 324
63 3300009553 Ga0105249_10000475 Ga0105249_1000047533 324
64 3300013306 Ga0163162_10145173 Ga0163162_101451732 324
65 3300014325 Ga0163163_10069852 Ga0163163_100698524 324
66 3300014326 Ga0157380_10284305 Ga0157380_102843051 324
67 3300014745 Ga0157377_10013216 Ga0157377_100132163 324
68 3300025908 Ga0207643_10000132 Ga0207643_100001323 324
69 3300025917 Ga0207660_10122750 Ga0207660_101227501 324
70 3300025921 Ga0207652_10255689 Ga0207652_102556891 324
71 3300025925 Ga0207650_10016727 Ga0207650_100167274 324
72 3300025961 Ga0207712_10001185 Ga0207712_1000118511 324
73 3300026067 Ga0207678_10059999 Ga0207678_100599992 324
74 3300026088 Ga0207641_10418873 Ga0207641_104188732 324
75 3300026095 Ga0207676_10007595 Ga0207676_100075954 324
76 3300026095 Ga0207676_10032741 Ga0207676_100327413 324
77 3300026116 Ga0207674_10003960 Ga0207674_100039607 324
78 3300026118 Ga0207675_100081085 Ga0207675_1000810853 324
79 3300028380 Ga0268265_10001944 Ga0268265_100019447 324
80 3300028380 Ga0268265_10087925 Ga0268265_100879252 324
81 3300028381 Ga0268264_10009120 Ga0268264_100091209 324
82 3300031824 Ga0307413_10251226 Ga0307413_102512262 324
83 3300031852 Ga0307410_10296870 Ga0307410_102968702 324
84 3300031903 Ga0307407_10017234 Ga0307407_100172343 324
85 3300035170 Ga0373943_0043005 Ga0373943_0043005_937_1911 324
86 3300048905 Ga0496102_0028797 Ga0496102_0028797_3401_4375 324
87 3300048906 Ga0496103_0005890 Ga0496103_0005890_505_1479 324
88 3300048909 Ga0496106_0000388 Ga0496106_0000388_23527_24501 324
89 3300048910 Ga0496107_0004447 Ga0496107_0004447_4604_5578 324
90 3300048912 Ga0496109_0001818 Ga0496109_0001818_10193_11167 324
91 3300049577 Ga0501041_0098880 Ga0501041_0098880_443_1417 324
92 3300049578 Ga0501042_0221097 Ga0501042_0221097_53_1027 324
93 3300049580 Ga0501046_0079239 Ga0501046_0079239_152_1126 324
94 3300049580 Ga0501046_0105293 Ga0501046_0105293_1083_2057 324
95 3300049592 Ga0501076_0335648 Ga0501076_0335648_148_1122 324
96 3300049743 Ga0501081_0027372 Ga0501081_0027372_2849_3823 324
97 3300049743 Ga0501081_0041336 Ga0501081_0041336_360_1334 324
98 3300049743 Ga0501081_0048196 Ga0501081_0048196_1840_2814 324
99 3300050508 nmdc:mga09592_114863_c1 nmdc:mga09592_114863_c1_1001_1975 324
100 3300050509 nmdc:mga0qj67_71664_c1 nmdc:mga0qj67_71664_c1_643_1617 324
101 3300060353 Ga0501082_0039944 Ga0501082_0039944_50_1024 324
102 3300061734 Ga0530510_0127595 Ga0530510_0127595_217_1191 324
103 3300061734 Ga0530510_0200050 Ga0530510_0200050_471_1445 324
104 3300005328 Ga0070676_10119615 Ga0070676_101196152 325
105 3300005329 Ga0070683_100039965 Ga0070683_1000399653 325
106 3300005329 Ga0070683_100047446 Ga0070683_1000474462 325
107 3300005329 Ga0070683_100088335 Ga0070683_1000883352 325
108 3300005331 Ga0070670_100005194 Ga0070670_1000051947 325
109 3300005331 Ga0070670_100069160 Ga0070670_1000691603 325
110 3300005331 Ga0070670_100103417 Ga0070670_1001034173 325
111 3300005333 Ga0070677_10057758 Ga0070677_100577582 325
112 3300005338 Ga0068868_100000544 Ga0068868_1000005448 325
113 3300005340 Ga0070689_100050245 Ga0070689_1000502452 325
114 3300005340 Ga0070689_100061702 Ga0070689_1000617023 325
115 3300005344 Ga0070661_100014017 Ga0070661_1000140172 325
116 3300005347 Ga0070668_100024657 Ga0070668_1000246573 325
117 3300005353 Ga0070669_100081605 Ga0070669_1000816051 325
118 3300005354 Ga0070675_100015371 Ga0070675_1000153712 325
119 3300005354 Ga0070675_100108494 Ga0070675_1001084942 325
120 3300005355 Ga0070671_100016634 Ga0070671_1000166342 325
121 3300005355 Ga0070671_100035497 Ga0070671_1000354972 325
122 3300005356 Ga0070674_100095128 Ga0070674_1000951282 325
123 3300005364 Ga0070673_100005459 Ga0070673_1000054592 325
124 3300005364 Ga0070673_100148486 Ga0070673_1001484862 325
125 3300005365 Ga0070688_100055393 Ga0070688_1000553932 325
126 3300005366 Ga0070659_100039631 Ga0070659_1000396314 325
127 3300005366 Ga0070659_100057549 Ga0070659_1000575492 325
128 3300005367 Ga0070667_100169799 Ga0070667_1001697992 325
129 3300005440 Ga0070705_100277279 Ga0070705_1002772791 325
130 3300005441 Ga0070700_100126592 Ga0070700_1001265922 325
131 3300005441 Ga0070700_100276567 Ga0070700_1002765671 325
132 3300005444 Ga0070694_100126229 Ga0070694_1001262292 325
133 3300005445 Ga0070708_100003217 Ga0070708_1000032178 325
134 3300005456 Ga0070678_100000281 Ga0070678_10000028114 325
135 3300005456 Ga0070678_100113722 Ga0070678_1001137222 325
136 3300005457 Ga0070662_100102734 Ga0070662_1001027342 325
137 3300005457 Ga0070662_100143198 Ga0070662_1001431982 325
138 3300005466 Ga0070685_10010154 Ga0070685_100101543 325
139 3300005467 Ga0070706_100121271 Ga0070706_1001212712 325
140 3300005468 Ga0070707_100006922 Ga0070707_1000069222 325
141 3300005535 Ga0070684_100193002 Ga0070684_1001930022 325
142 3300005536 Ga0070697_100041288 Ga0070697_1000412883 325
143 3300005536 Ga0070697_100125137 Ga0070697_1001251372 325
144 3300005539 Ga0068853_100081302 Ga0068853_1000813021 325
145 3300005543 Ga0070672_100001595 Ga0070672_10000159511 325
146 3300005543 Ga0070672_100004204 Ga0070672_1000042046 325
147 3300005544 Ga0070686_100003659 Ga0070686_1000036598 325
148 3300005544 Ga0070686_100152520 Ga0070686_1001525202 325
149 3300005547 Ga0070693_100161697 Ga0070693_1001616972 325
150 3300005548 Ga0070665_100228361 Ga0070665_1002283612 325
151 3300005564 Ga0070664_100007947 Ga0070664_1000079475 325
152 3300005578 Ga0068854_100015614 Ga0068854_1000156144 325
153 3300005615 Ga0070702_100028493 Ga0070702_1000284932 325
154 3300005616 Ga0068852_100000200 Ga0068852_10000020014 325
155 3300005617 Ga0068859_100085823 Ga0068859_1000858232 325
156 3300005618 Ga0068864_100036691 Ga0068864_1000366913 325
157 3300005618 Ga0068864_100060098 Ga0068864_1000600982 325
158 3300005618 Ga0068864_100157016 Ga0068864_1001570162 325
159 3300005718 Ga0068866_10053799 Ga0068866_100537992 325
160 3300005840 Ga0068870_10060060 Ga0068870_100600602 325
161 3300005841 Ga0068863_100009972 Ga0068863_1000099726 325
162 3300005841 Ga0068863_100112376 Ga0068863_1001123762 325
163 3300005843 Ga0068860_100161614 Ga0068860_1001616142 325
164 3300005844 Ga0068862_100018237 Ga0068862_1000182372 325
165 3300005844 Ga0068862_100302721 Ga0068862_1003027212 325
166 3300005985 Ga0081539_10161189 Ga0081539_101611891 325
167 3300006038 Ga0075365_10053360 Ga0075365_100533602 325
168 3300006178 Ga0075367_10096575 Ga0075367_100965752 325
169 3300006237 Ga0097621_100003433 Ga0097621_1000034336 325
170 3300006847 Ga0075431_100024240 Ga0075431_1000242404 325
171 3300006852 Ga0075433_10026200 Ga0075433_100262003 325
172 3300006871 Ga0075434_100061854 Ga0075434_1000618543 325
173 3300006931 Ga0097620_100085819 Ga0097620_1000858192 325
174 3300007265 Ga0099794_10000104 Ga0099794_1000010421 325
175 3300007265 Ga0099794_10096702 Ga0099794_100967022 325
176 3300009011 Ga0105251_10086645 Ga0105251_100866451 325
177 3300009094 Ga0111539_10074818 Ga0111539_100748182 325
178 3300009147 Ga0114129_10457215 Ga0114129_104572152 325
179 3300009176 Ga0105242_10231955 Ga0105242_102319552 325
180 3300009177 Ga0105248_10071779 Ga0105248_100717793 325
181 3300009177 Ga0105248_10100379 Ga0105248_101003792 325
182 3300010375 Ga0105239_10012459 Ga0105239_100124591 325
183 3300011119 Ga0105246_10206033 Ga0105246_102060332 325
184 3300011119 Ga0105246_10238293 Ga0105246_102382932 325
185 3300013296 Ga0157374_10000653 Ga0157374_1000065320 325
186 3300013297 Ga0157378_10001132 Ga0157378_1000113216 325
187 3300013306 Ga0163162_10131050 Ga0163162_101310503 325
188 3300013306 Ga0163162_10335970 Ga0163162_103359702 325
189 3300013308 Ga0157375_10001703 Ga0157375_1000170316 325
190 3300013308 Ga0157375_10321053 Ga0157375_103210532 325
191 3300014325 Ga0163163_10021730 Ga0163163_100217302 325
192 3300014326 Ga0157380_10133590 Ga0157380_101335902 325
193 3300014745 Ga0157377_10009768 Ga0157377_100097682 325
194 3300014968 Ga0157379_10113188 Ga0157379_101131881 325
195 3300014969 Ga0157376_10020667 Ga0157376_100206672 325
196 3300025315 Ga0207697_10011678 Ga0207697_100116782 325
197 3300025321 Ga0207656_10020204 Ga0207656_100202043 325
198 3300025893 Ga0207682_10002135 Ga0207682_100021353 325
199 3300025893 Ga0207682_10059324 Ga0207682_100593242 325
200 3300025901 Ga0207688_10004400 Ga0207688_100044004 325
201 3300025907 Ga0207645_10006895 Ga0207645_100068957 325
202 3300025907 Ga0207645_10013908 Ga0207645_100139085 325
203 3300025908 Ga0207643_10002110 Ga0207643_100021102 325
204 3300025912 Ga0207707_10093239 Ga0207707_100932392 325
205 3300025915 Ga0207693_10024106 Ga0207693_100241064 325
206 3300025920 Ga0207649_10031311 Ga0207649_100313112 325
207 3300025922 Ga0207646_10091008 Ga0207646_100910082 325
208 3300025925 Ga0207650_10001197 Ga0207650_100011979 325
209 3300025925 Ga0207650_10003351 Ga0207650_100033518 325
210 3300025925 Ga0207650_10181740 Ga0207650_101817402 325
211 3300025925 Ga0207650_10274901 Ga0207650_102749011 325
212 3300025926 Ga0207659_10011997 Ga0207659_100119974 325
213 3300025926 Ga0207659_10029082 Ga0207659_100290822 325
214 3300025931 Ga0207644_10000669 Ga0207644_100006697 325
215 3300025931 Ga0207644_10127627 Ga0207644_101276272 325
216 3300025932 Ga0207690_10295359 Ga0207690_102953591 325
217 3300025933 Ga0207706_10003081 Ga0207706_100030816 325
218 3300025933 Ga0207706_10070011 Ga0207706_100700113 325
219 3300025934 Ga0207686_10014996 Ga0207686_100149964 325
220 3300025934 Ga0207686_10124121 Ga0207686_101241212 325
221 3300025935 Ga0207709_10172122 Ga0207709_101721222 325
222 3300025936 Ga0207670_10004147 Ga0207670_100041471 325
223 3300025937 Ga0207669_10063577 Ga0207669_100635772 325
224 3300025938 Ga0207704_10111779 Ga0207704_101117792 325
225 3300025940 Ga0207691_10000470 Ga0207691_1000047019 325
226 3300025941 Ga0207711_10012335 Ga0207711_100123356 325
227 3300025944 Ga0207661_10002744 Ga0207661_100027448 325
228 3300025945 Ga0207679_10047223 Ga0207679_100472233 325
229 3300025960 Ga0207651_10020371 Ga0207651_100203713 325
230 3300025960 Ga0207651_10110726 Ga0207651_101107261 325
231 3300025972 Ga0207668_10244922 Ga0207668_102449222 325
232 3300025972 Ga0207668_10479557 Ga0207668_104795571 325
233 3300026023 Ga0207677_10001341 Ga0207677_100013414 325
234 3300026035 Ga0207703_10059555 Ga0207703_100595551 325
235 3300026067 Ga0207678_10005470 Ga0207678_100054702 325
236 3300026075 Ga0207708_10015889 Ga0207708_100158893 325
237 3300026078 Ga0207702_10138984 Ga0207702_101389842 325
238 3300026088 Ga0207641_10010430 Ga0207641_100104307 325
239 3300026089 Ga0207648_10012278 Ga0207648_100122782 325
240 3300026089 Ga0207648_10015184 Ga0207648_100151846 325
241 3300026095 Ga0207676_10001530 Ga0207676_100015302 325
242 3300026095 Ga0207676_10009147 Ga0207676_100091472 325
243 3300026118 Ga0207675_100040881 Ga0207675_1000408814 325
244 3300026121 Ga0207683_10000581 Ga0207683_1000058117 325
245 3300026121 Ga0207683_10021344 Ga0207683_100213443 325
246 3300026121 Ga0207683_10070780 Ga0207683_100707802 325
247 3300026142 Ga0207698_10000953 Ga0207698_100009538 325
248 3300027364 Ga0209967_1001698 Ga0209967_10016982 325
249 3300027543 Ga0209999_1005118 Ga0209999_10051182 325
250 3300027671 Ga0209588_1000009 Ga0209588_100000940 325
251 3300027876 Ga0209974_10001468 Ga0209974_100014683 325
252 3300028379 Ga0268266_10411813 Ga0268266_104118132 325
253 3300028380 Ga0268265_10186540 Ga0268265_101865402 325
254 3300028380 Ga0268265_10275676 Ga0268265_102756761 325
255 3300028381 Ga0268264_10357760 Ga0268264_103577602 325
256 3300028577 Ga0265318_10027395 Ga0265318_100273952 325
257 3300028800 Ga0265338_10053521 Ga0265338_100535212 325
258 3300031238 Ga0265332_10003853 Ga0265332_100038533 325
259 3300031239 Ga0265328_10028090 Ga0265328_100280901 325
260 3300031240 Ga0265320_10019572 Ga0265320_100195722 325
261 3300031242 Ga0265329_10011028 Ga0265329_100110281 325
262 3300031250 Ga0265331_10004097 Ga0265331_100040977 325
263 3300031712 Ga0265342_10023796 Ga0265342_100237964 325
264 3300031731 Ga0307405_10022972 Ga0307405_100229722 325
265 3300032002 Ga0307416_100007220 Ga0307416_1000072203 325
266 3300032005 Ga0307411_10226459 Ga0307411_102264592 325
267 3300037068 Ga0373925_0115129 Ga0373925_0115129_941_1921 325
268 3300037853 Ga0436364_0104023 Ga0436364_0104023_20_997 325
269 3300042436 Ga0439435_0025327 Ga0439435_0025327_123_1100 325
270 3300046530 Ga0495654_0076317 Ga0495654_0076317_459_1436 325
271 3300046539 Ga0495621_0020602 Ga0495621_0020602_1041_2018 325
272 3300046616 Ga0495668_0084296 Ga0495668_0084296_427_1404 325
273 3300046683 Ga0495658_0049538 Ga0495658_0049538_737_1714 325
274 3300046691 Ga0495670_0050454 Ga0495670_0050454_203_1180 325
275 3300046794 Ga0495589_0094778 Ga0495589_0094778_410_1387 325
276 3300048090 Ga0495615_0033202 Ga0495615_0033202_133_1110 325
277 3300048903 Ga0496100_0028490 Ga0496100_0028490_600_1577 325
278 3300048903 Ga0496100_0065531 Ga0496100_0065531_636_1613 325
279 3300048904 Ga0496101_0015869 Ga0496101_0015869_2876_3853 325
280 3300048905 Ga0496102_0080917 Ga0496102_0080917_1142_2119 325
281 3300048907 Ga0496104_0077142 Ga0496104_0077142_1004_1981 325
282 3300048907 Ga0496104_0446002 Ga0496104_0446002_177_1154 325
283 3300048909 Ga0496106_0004954 Ga0496106_0004954_6722_7699 325
284 3300048911 Ga0496108_0062222 Ga0496108_0062222_350_1327 325
285 3300048913 Ga0496110_0004198 Ga0496110_0004198_7886_8863 325
286 3300048913 Ga0496110_0567569 Ga0496110_0567569_32_1009 325
287 3300048915 Ga0496112_0108034 Ga0496112_0108034_76_1053 325
288 3300048916 Ga0496113_0014110 Ga0496113_0014110_3164_4141 325
289 3300048917 Ga0496114_0018470 Ga0496114_0018470_1879_2856 325
290 3300048917 Ga0496114_0052250 Ga0496114_0052250_2153_3130 325
291 3300048918 Ga0496115_0113604 Ga0496115_0113604_1173_2150 325
292 3300049568 Ga0501031_0020357 Ga0501031_0020357_323_1303 325
293 3300049570 Ga0501033_0023284 Ga0501033_0023284_1009_1998 325
294 3300049570 Ga0501033_0026890 Ga0501033_0026890_2493_3482 325
295 3300049570 Ga0501033_0035637 Ga0501033_0035637_172_1152 325
296 3300049571 Ga0501034_0004413 Ga0501034_0004413_2191_3168 325
297 3300049572 Ga0501036_0015406 Ga0501036_0015406_4095_5075 325
298 3300049572 Ga0501036_0018718 Ga0501036_0018718_1831_2820 325
299 3300049572 Ga0501036_0020831 Ga0501036_0020831_227_1216 325
300 3300049572 Ga0501036_0034448 Ga0501036_0034448_1511_2500 325
301 3300049572 Ga0501036_0212713 Ga0501036_0212713_319_1296 325
302 3300049573 Ga0501037_0012501 Ga0501037_0012501_3168_4157 325
303 3300049573 Ga0501037_0027717 Ga0501037_0027717_572_1549 325
304 3300049573 Ga0501037_0085302 Ga0501037_0085302_470_1450 325
305 3300049574 Ga0501038_0001483 Ga0501038_0001483_10476_11465 325
306 3300049574 Ga0501038_0081595 Ga0501038_0081595_1575_2564 325
307 3300049575 Ga0501039_0002955 Ga0501039_0002955_6826_7803 325
308 3300049575 Ga0501039_0014481 Ga0501039_0014481_3475_4464 325
309 3300049575 Ga0501039_0106253 Ga0501039_0106253_960_1949 325
310 3300049575 Ga0501039_0138657 Ga0501039_0138657_591_1571 325
311 3300049576 Ga0501040_0002082 Ga0501040_0002082_1192_2181 325
312 3300049576 Ga0501040_0017695 Ga0501040_0017695_930_1910 325
313 3300049576 Ga0501040_0038640 Ga0501040_0038640_1332_2321 325
314 3300049576 Ga0501040_0041694 Ga0501040_0041694_919_1896 325
315 3300049576 Ga0501040_0043695 Ga0501040_0043695_714_1700 325
316 3300049577 Ga0501041_0002051 Ga0501041_0002051_1192_2181 325
317 3300049577 Ga0501041_0003848 Ga0501041_0003848_4686_5663 325
318 3300049577 Ga0501041_0004416 Ga0501041_0004416_3926_4915 325
319 3300049577 Ga0501041_0044025 Ga0501041_0044025_533_1522 325
320 3300049578 Ga0501042_0006501 Ga0501042_0006501_991_1980 325
321 3300049578 Ga0501042_0008572 Ga0501042_0008572_3970_4950 325
322 3300049578 Ga0501042_0035032 Ga0501042_0035032_1324_2313 325
323 3300049578 Ga0501042_0059051 Ga0501042_0059051_776_1765 325
324 3300049578 Ga0501042_0146936 Ga0501042_0146936_261_1238 325
325 3300049579 Ga0501043_0025776 Ga0501043_0025776_121_1110 325
326 3300049579 Ga0501043_0028283 Ga0501043_0028283_1204_2193 325
327 3300049579 Ga0501043_0067206 Ga0501043_0067206_1186_2163 325
328 3300049580 Ga0501046_0005973 Ga0501046_0005973_5968_6957 325
329 3300049580 Ga0501046_0010727 Ga0501046_0010727_5295_6284 325
330 3300049580 Ga0501046_0080472 Ga0501046_0080472_1192_2181 325
331 3300049580 Ga0501046_0102555 Ga0501046_0102555_113_1093 325
332 3300049581 Ga0501047_0407601 Ga0501047_0407601_71_1060 325
333 3300049582 Ga0501048_0017493 Ga0501048_0017493_533_1522 325
334 3300049582 Ga0501048_0028264 Ga0501048_0028264_2328_3305 325
335 3300049582 Ga0501048_0087749 Ga0501048_0087749_533_1522 325
336 3300049584 Ga0501068_0009909 Ga0501068_0009909_64_1044 325
337 3300049584 Ga0501068_0073670 Ga0501068_0073670_134_1123 325
338 3300049584 Ga0501068_0228745 Ga0501068_0228745_75_1064 325
339 3300049585 Ga0501069_0190503 Ga0501069_0190503_68_1057 325
340 3300049587 Ga0501071_0032246 Ga0501071_0032246_1567_2556 325
341 3300049587 Ga0501071_0041132 Ga0501071_0041132_1122_2111 325
342 3300049587 Ga0501071_0055178 Ga0501071_0055178_1601_2587 325
343 3300049588 Ga0501072_0001271 Ga0501072_0001271_13793_14773 325
344 3300049588 Ga0501072_0009293 Ga0501072_0009293_505_1494 325
345 3300049588 Ga0501072_0038467 Ga0501072_0038467_1117_2106 325
346 3300049588 Ga0501072_0120850 Ga0501072_0120850_466_1452 325
347 3300049589 Ga0501073_0002264 Ga0501073_0002264_12737_13726 325
348 3300049590 Ga0501074_0001230 Ga0501074_0001230_3876_4856 325
349 3300049590 Ga0501074_0064092 Ga0501074_0064092_846_1835 325
350 3300049590 Ga0501074_0079731 Ga0501074_0079731_501_1487 325
351 3300049590 Ga0501074_0085815 Ga0501074_0085815_154_1143 325
352 3300049591 Ga0501075_0003461 Ga0501075_0003461_3975_4964 325
353 3300049591 Ga0501075_0012910 Ga0501075_0012910_4133_5119 325
354 3300049591 Ga0501075_0016310 Ga0501075_0016310_3177_4157 325
355 3300049591 Ga0501075_0026034 Ga0501075_0026034_1955_2932 325
356 3300049591 Ga0501075_0045440 Ga0501075_0045440_1116_2105 325
357 3300049591 Ga0501075_0058529 Ga0501075_0058529_940_1929 325
358 3300049592 Ga0501076_0006995 Ga0501076_0006995_1132_2121 325
359 3300049592 Ga0501076_0010342 Ga0501076_0010342_332_1321 325
360 3300049592 Ga0501076_0036537 Ga0501076_0036537_1294_2283 325
361 3300049593 Ga0501077_0037560 Ga0501077_0037560_960_1949 325
362 3300049593 Ga0501077_0113646 Ga0501077_0113646_255_1241 325
363 3300049741 Ga0501079_0001328 Ga0501079_0001328_14415_15395 325
364 3300049741 Ga0501079_0004670 Ga0501079_0004670_7059_8048 325
365 3300049741 Ga0501079_0052091 Ga0501079_0052091_980_1969 325
366 3300049741 Ga0501079_0056402 Ga0501079_0056402_505_1494 325
367 3300049742 Ga0501080_0005631 Ga0501080_0005631_540_1529 325
368 3300049742 Ga0501080_0048254 Ga0501080_0048254_2156_3136 325
369 3300049742 Ga0501080_0055289 Ga0501080_0055289_1574_2563 325
370 3300049742 Ga0501080_0351334 Ga0501080_0351334_32_1018 325
371 3300049743 Ga0501081_0000347 Ga0501081_0000347_12974_13951 325
372 3300049743 Ga0501081_0009005 Ga0501081_0009005_72_1061 325
373 3300049743 Ga0501081_0010042 Ga0501081_0010042_526_1515 325
374 3300049743 Ga0501081_0010184 Ga0501081_0010184_1000_1986 325
375 3300049743 Ga0501081_0038104 Ga0501081_0038104_1169_2158 325
376 3300049744 Ga0501083_0008226 Ga0501083_0008226_881_1870 325
377 3300049744 Ga0501083_0013741 Ga0501083_0013741_3775_4755 325
378 3300049744 Ga0501083_0051936 Ga0501083_0051936_1254_2243 325
379 3300049822 Ga0501035_0217947 Ga0501035_0217947_526_1515 325
380 3300049823 Ga0501044_0059434 Ga0501044_0059434_2337_3326 325
381 3300049823 Ga0501044_0174210 Ga0501044_0174210_245_1234 325
382 3300049824 Ga0501045_0001638 Ga0501045_0001638_171_1151 325
383 3300049824 Ga0501045_0011396 Ga0501045_0011396_1047_2036 325
384 3300049824 Ga0501045_0024960 Ga0501045_0024960_533_1522 325
385 3300050492 nmdc:mga0yw44_3606_c1 nmdc:mga0yw44_3606_c1_3450_4427 325
386 3300050507 nmdc:mga05p37_98899_c1 nmdc:mga05p37_98899_c1_2402_3379 325
387 3300050509 nmdc:mga0qj67_212311_c1 nmdc:mga0qj67_212311_c1_562_1539 325
388 3300050510 nmdc:mga06r32_218532_c1 nmdc:mga06r32_218532_c1_571_1548 325
389 3300050511 nmdc:mga08y16_119084_c1 nmdc:mga08y16_119084_c1_1408_2385 325
390 3300050511 nmdc:mga08y16_58758_c1 nmdc:mga08y16_58758_c1_1733_2710 325
391 3300050512 nmdc:mga0n895_132887_c1 nmdc:mga0n895_132887_c1_999_1976 325
392 3300050514 nmdc:mga08x19_294442_c1 nmdc:mga08x19_294442_c1_75_1052 325
393 3300050515 nmdc:mga0a205_24943_c1 nmdc:mga0a205_24943_c1_2223_3200 325
394 3300053085 Ga0495619_0112881 Ga0495619_0112881_680_1657 325
395 3300053178 Ga0500637_0011014 Ga0500637_0011014_2952_3929 325
396 3300054114 Ga0501084_0003640 Ga0501084_0003640_11271_12251 325
397 3300054114 Ga0501084_0013611 Ga0501084_0013611_3882_4871 325
398 3300054114 Ga0501084_0041440 Ga0501084_0041440_898_1875 325
399 3300054114 Ga0501084_0052208 Ga0501084_0052208_477_1463 325
400 3300054114 Ga0501084_0069409 Ga0501084_0069409_1112_2101 325
401 3300060353 Ga0501082_0002535 Ga0501082_0002535_6749_7726 325
402 3300060353 Ga0501082_0005369 Ga0501082_0005369_3988_4977 325
403 3300060353 Ga0501082_0015536 Ga0501082_0015536_2200_3189 325
404 3300060353 Ga0501082_0028880 Ga0501082_0028880_1676_2662 325
405 3300060353 Ga0501082_0064574 Ga0501082_0064574_1192_2181 325
406 3300061734 Ga0530510_0027909 Ga0530510_0027909_264_1244 325
407 3300061734 Ga0530510_0037230 Ga0530510_0037230_417_1406 325
408 3300061734 Ga0530510_0079593 Ga0530510_0079593_136_1122 325
409 3300061734 Ga0530510_0119304 Ga0530510_0119304_694_1671 325
410 3300003203 JGI25406J46586_10008875 JGI25406J46586_100088753 326
411 3300003215 JGI25153J46596_10000010 JGI25153J46596_10000010193 326
412 3300005293 Ga0065715_10135985 Ga0065715_101359852 326
413 3300005331 Ga0070670_100010828 Ga0070670_1000108282 326
414 3300005339 Ga0070660_100213577 Ga0070660_1002135771 326
415 3300005340 Ga0070689_100061730 Ga0070689_1000617302 326
416 3300005347 Ga0070668_100113176 Ga0070668_1001131762 326
417 3300005434 Ga0070709_10001838 Ga0070709_100018383 326
418 3300005434 Ga0070709_10172580 Ga0070709_101725802 326
419 3300005435 Ga0070714_100085203 Ga0070714_1000852032 326
420 3300005436 Ga0070713_100008135 Ga0070713_1000081353 326
421 3300005439 Ga0070711_100285695 Ga0070711_1002856952 326
422 3300005456 Ga0070678_100028549 Ga0070678_1000285492 326
423 3300005466 Ga0070685_10047169 Ga0070685_100471692 326
424 3300005543 Ga0070672_100195682 Ga0070672_1001956821 326
425 3300005544 Ga0070686_100357081 Ga0070686_1003570811 326
426 3300005548 Ga0070665_100106145 Ga0070665_1001061453 326
427 3300005614 Ga0068856_100115685 Ga0068856_1001156853 326
428 3300005719 Ga0068861_100261891 Ga0068861_1002618912 326
429 3300005981 Ga0081538_10004000 Ga0081538_100040003 326
430 3300005981 Ga0081538_10016393 Ga0081538_100163934 326
431 3300005983 Ga0081540_1005998 Ga0081540_10059988 326
432 3300005983 Ga0081540_1014080 Ga0081540_10140802 326
433 3300005983 Ga0081540_1064427 Ga0081540_10644272 326
434 3300005985 Ga0081539_10002801 Ga0081539_100028014 326
435 3300006028 Ga0070717_10027405 Ga0070717_100274052 326
436 3300006038 Ga0075365_10103751 Ga0075365_101037512 326
437 3300006038 Ga0075365_10175835 Ga0075365_101758352 326
438 3300006048 Ga0075363_100004257 Ga0075363_1000042576 326
439 3300006048 Ga0075363_100040646 Ga0075363_1000406462 326
440 3300006051 Ga0075364_10158854 Ga0075364_101588542 326
441 3300006051 Ga0075364_10232414 Ga0075364_102324142 326
442 3300006163 Ga0070715_10001029 Ga0070715_100010295 326
443 3300006173 Ga0070716_100076910 Ga0070716_1000769102 326
444 3300006177 Ga0075362_10001107 Ga0075362_100011079 326
445 3300006178 Ga0075367_10037538 Ga0075367_100375382 326
446 3300006178 Ga0075367_10161251 Ga0075367_101612511 326
447 3300006195 Ga0075366_10008250 Ga0075366_100082504 326
448 3300006353 Ga0075370_10100220 Ga0075370_101002202 326
449 3300006844 Ga0075428_100672413 Ga0075428_1006724131 326
450 3300006846 Ga0075430_100056675 Ga0075430_1000566753 326
451 3300006846 Ga0075430_100117562 Ga0075430_1001175622 326
452 3300006847 Ga0075431_100052784 Ga0075431_1000527843 326
453 3300006847 Ga0075431_100254998 Ga0075431_1002549982 326
454 3300006847 Ga0075431_100259582 Ga0075431_1002595822 326
455 3300006847 Ga0075431_100624674 Ga0075431_1006246741 326
456 3300006880 Ga0075429_100024317 Ga0075429_1000243172 326
457 3300006880 Ga0075429_100107365 Ga0075429_1001073653 326
458 3300006914 Ga0075436_100002520 Ga0075436_1000025208 326
459 3300007788 Ga0099795_10045891 Ga0099795_100458912 326
460 3300009093 Ga0105240_10032455 Ga0105240_100324552 326
461 3300009093 Ga0105240_10130173 Ga0105240_101301734 326
462 3300009093 Ga0105240_10156897 Ga0105240_101568974 326
463 3300009101 Ga0105247_10046857 Ga0105247_100468572 326
464 3300009147 Ga0114129_10086220 Ga0114129_100862202 326
465 3300009148 Ga0105243_10188172 Ga0105243_101881722 326
466 3300009176 Ga0105242_10198974 Ga0105242_101989742 326
467 3300009545 Ga0105237_10345963 Ga0105237_103459632 326
468 3300009551 Ga0105238_10067684 Ga0105238_100676841 326
469 3300010159 Ga0099796_10034050 Ga0099796_100340502 326
470 3300010375 Ga0105239_10286325 Ga0105239_102863252 326
471 3300013307 Ga0157372_10408424 Ga0157372_104084241 326
472 3300014325 Ga0163163_10131176 Ga0163163_101311762 326
473 3300021384 Ga0213876_10003329 Ga0213876_100033292 326
474 3300021384 Ga0213876_10008211 Ga0213876_100082115 326
475 3300021384 Ga0213876_10021721 Ga0213876_100217213 326
476 3300021384 Ga0213876_10163658 Ga0213876_101636582 326
477 3300025297 Ga0209758_1000033 Ga0209758_1000033334 326
478 3300025885 Ga0207653_10011499 Ga0207653_100114992 326
479 3300025898 Ga0207692_10062025 Ga0207692_100620252 326
480 3300025898 Ga0207692_10077089 Ga0207692_100770892 326
481 3300025905 Ga0207685_10017899 Ga0207685_100178992 326
482 3300025906 Ga0207699_10326254 Ga0207699_103262541 326
483 3300025911 Ga0207654_10257721 Ga0207654_102577212 326
484 3300025913 Ga0207695_10052905 Ga0207695_100529054 326
485 3300025913 Ga0207695_10139652 Ga0207695_101396522 326
486 3300025913 Ga0207695_10145384 Ga0207695_101453841 326
487 3300025915 Ga0207693_10000988 Ga0207693_100009885 326
488 3300025915 Ga0207693_10014858 Ga0207693_100148583 326
489 3300025916 Ga0207663_10060053 Ga0207663_100600532 326
490 3300025918 Ga0207662_10073964 Ga0207662_100739642 326
491 3300025918 Ga0207662_10137091 Ga0207662_101370911 326
492 3300025919 Ga0207657_10024231 Ga0207657_100242314 326
493 3300025924 Ga0207694_10038798 Ga0207694_100387982 326
494 3300025925 Ga0207650_10002081 Ga0207650_100020812 326
495 3300025928 Ga0207700_10057899 Ga0207700_100578992 326
496 3300025928 Ga0207700_10185655 Ga0207700_101856551 326
497 3300025936 Ga0207670_10105118 Ga0207670_101051182 326
498 3300025939 Ga0207665_10003664 Ga0207665_100036642 326
499 3300025940 Ga0207691_10053994 Ga0207691_100539944 326
500 3300025941 Ga0207711_10435983 Ga0207711_104359832 326
501 3300025944 Ga0207661_10314216 Ga0207661_103142162 326
502 3300025960 Ga0207651_10183520 Ga0207651_101835202 326
503 3300025960 Ga0207651_10226603 Ga0207651_102266032 326
504 3300025961 Ga0207712_10174653 Ga0207712_101746532 326
505 3300026078 Ga0207702_10108403 Ga0207702_101084032 326
506 3300026089 Ga0207648_10031802 Ga0207648_100318022 326
507 3300026095 Ga0207676_10046205 Ga0207676_100462052 326
508 3300026095 Ga0207676_10286517 Ga0207676_102865172 326
509 3300026118 Ga0207675_100044150 Ga0207675_1000441504 326
510 3300026121 Ga0207683_10000755 Ga0207683_1000075529 326
511 3300027512 Ga0209179_1003214 Ga0209179_10032142 326
512 3300028577 Ga0265318_10006701 Ga0265318_100067015 326
513 3300028794 Ga0307515_10063235 Ga0307515_100632356 326
514 3300031238 Ga0265332_10000310 Ga0265332_1000031021 326
515 3300031238 Ga0265332_10015644 Ga0265332_100156443 326
516 3300031238 Ga0265332_10060909 Ga0265332_100609092 326
517 3300031240 Ga0265320_10033117 Ga0265320_100331173 326
518 3300031241 Ga0265325_10006109 Ga0265325_100061096 326
519 3300031247 Ga0265340_10006782 Ga0265340_100067826 326
520 3300031249 Ga0265339_10001481 Ga0265339_1000148110 326
521 3300031250 Ga0265331_10024928 Ga0265331_100249282 326
522 3300031250 Ga0265331_10033074 Ga0265331_100330742 326
523 3300031344 Ga0265316_10118829 Ga0265316_101188292 326
524 3300031344 Ga0265316_10258394 Ga0265316_102583941 326
525 3300031691 Ga0316579_10033433 Ga0316579_100334333 326
526 3300031711 Ga0265314_10106115 Ga0265314_101061152 326
527 3300031712 Ga0265342_10000175 Ga0265342_1000017544 326
528 3300031712 Ga0265342_10174231 Ga0265342_101742311 326
529 3300031730 Ga0307516_10002086 Ga0307516_100020866 326
530 3300031730 Ga0307516_10084832 Ga0307516_100848322 326
531 3300035086 Ga0373934_0039193 Ga0373934_0039193_584_1564 326
532 3300035111 Ga0373923_0000157 Ga0373923_0000157_1307_2287 326
533 3300035113 Ga0373936_0035416 Ga0373936_0035416_264_1244 326
534 3300035116 Ga0373945_0004209 Ga0373945_0004209_2447_3427 326
535 3300035117 Ga0373953_0007423 Ga0373953_0007423_2171_3151 326
536 3300035118 Ga0373954_0029599 Ga0373954_0029599_389_1369 326
537 3300035170 Ga0373943_0001586 Ga0373943_0001586_5368_6348 326
538 3300035170 Ga0373943_0094381 Ga0373943_0094381_19_999 326
539 3300035171 Ga0373946_0003086 Ga0373946_0003086_1629_2609 326
540 3300035172 Ga0373955_0000562 Ga0373955_0000562_8439_9419 326
541 3300035410 Ga0373924_0005771 Ga0373924_0005771_2616_3596 326
542 3300035692 Ga0373935_0255045 Ga0373935_0255045_199_1179 326
543 3300035724 Ga0373933_0045120 Ga0373933_0045120_211_1191 326
544 3300035725 Ga0373947_0049565 Ga0373947_0049565_986_1966 326
545 3300036401 Ga0373937_0000009 Ga0373937_0000009_76135_77115 326
546 3300036647 Ga0316582_0199445 Ga0316582_0199445_324_1304 326
547 3300037068 Ga0373925_0000194 Ga0373925_0000194_35083_36063 326
548 3300037068 Ga0373925_0004439 Ga0373925_0004439_6131_7114 326
549 3300037068 Ga0373925_0007047 Ga0373925_0007047_3075_4055 326
550 3300037068 Ga0373925_0024598 Ga0373925_0024598_2686_3666 326
551 3300037068 Ga0373925_0091665 Ga0373925_0091665_684_1664 326
552 3300037471 Ga0395905_0001088 Ga0395905_0001088_2678_3661 326
553 3300037853 Ga0436364_0216969 Ga0436364_0216969_32_1012 326
554 3300039437 Ga0436365_0047572 Ga0436365_0047572_1564_2550 326
555 3300039437 Ga0436365_0803180 Ga0436365_0803180_236_1216 326
556 3300039437 Ga0436365_1535122 Ga0436365_1535122_952_1932 326
557 3300039437 Ga0436365_1613453 Ga0436365_1613453_1643_2623 326
558 3300039447 Ga0436361_0668552 Ga0436361_0668552_954_1934 326
559 3300039450 Ga0436363_0979456 Ga0436363_0979456_61_1041 326
560 3300039453 Ga0436362_0471479 Ga0436362_0471479_3355_4341 326
561 3300041410 Ga0439461_0013081 Ga0439461_0013081_512_1492 326
562 3300042436 Ga0439435_0000853 Ga0439435_0000853_1858_2838 326
563 3300046454 Ga0495592_0000018 Ga0495592_0000018_13226_14206 326
564 3300046455 Ga0495603_0036468 Ga0495603_0036468_412_1392 326
565 3300046459 Ga0495629_0005894 Ga0495629_0005894_4204_5184 326
566 3300046459 Ga0495629_0103941 Ga0495629_0103941_20_1000 326
567 3300046460 Ga0495638_0007358 Ga0495638_0007358_4557_5537 326
568 3300046460 Ga0495638_0025383 Ga0495638_0025383_1501_2496 326
569 3300046462 Ga0495651_0002271 Ga0495651_0002271_9990_10970 326
570 3300046463 Ga0495653_0000032 Ga0495653_0000032_45336_46316 326
571 3300046472 Ga0495580_0314286 Ga0495580_0314286_62_1042 326
572 3300046473 Ga0495582_0039554 Ga0495582_0039554_768_1748 326
573 3300046474 Ga0495605_0063268 Ga0495605_0063268_109_1089 326
574 3300046475 Ga0495639_0081300 Ga0495639_0081300_448_1428 326
575 3300046475 Ga0495639_0106743 Ga0495639_0106743_24_1004 326
576 3300046476 Ga0495662_0007065 Ga0495662_0007065_635_1615 326
577 3300046477 Ga0495664_0000010 Ga0495664_0000010_191396_192376 326
578 3300046491 Ga0495584_0040269 Ga0495584_0040269_675_1655 326
579 3300046491 Ga0495584_0045185 Ga0495584_0045185_275_1255 326
580 3300046501 Ga0495607_0098868 Ga0495607_0098868_567_1547 326
581 3300046511 Ga0495608_0000008 Ga0495608_0000008_76273_77253 326
582 3300046514 Ga0495618_0000002 Ga0495618_0000002_193669_194649 326
583 3300046516 Ga0495628_0000009 Ga0495628_0000009_191424_192404 326
584 3300046517 Ga0495630_0005324 Ga0495630_0005324_6320_7300 326
585 3300046517 Ga0495630_0193828 Ga0495630_0193828_556_1536 326
586 3300046523 Ga0495644_0013428 Ga0495644_0013428_1173_2153 326
587 3300046525 Ga0495663_0068005 Ga0495663_0068005_133_1113 326
588 3300046529 Ga0495652_0000011 Ga0495652_0000011_75963_76943 326
589 3300046533 Ga0495640_0000009 Ga0495640_0000009_24715_25695 326
590 3300046536 Ga0495587_0000006 Ga0495587_0000006_305142_306122 326
591 3300046543 Ga0495645_0000010 Ga0495645_0000010_45336_46316 326
592 3300046558 Ga0495633_0019278 Ga0495633_0019278_1577_2557 326
593 3300046559 Ga0495667_0000005 Ga0495667_0000005_191424_192404 326
594 3300046559 Ga0495667_0194649 Ga0495667_0194649_118_1098 326
595 3300046615 Ga0495656_0033241 Ga0495656_0033241_763_1743 326
596 3300046616 Ga0495668_0019322 Ga0495668_0019322_1690_2679 326
597 3300046642 Ga0495634_0000223 Ga0495634_0000223_31605_32585 326
598 3300046660 Ga0495625_0083178 Ga0495625_0083178_903_1892 326
599 3300046663 Ga0495635_0000008 Ga0495635_0000008_75946_76926 326
600 3300046674 Ga0495588_0031067 Ga0495588_0031067_332_1312 326
601 3300046675 Ga0495657_0000058 Ga0495657_0000058_30699_31679 326
602 3300046678 Ga0495599_0000007 Ga0495599_0000007_75963_76943 326
603 3300046679 Ga0495623_0000085 Ga0495623_0000085_12496_13476 326
604 3300046680 Ga0495646_0000021 Ga0495646_0000021_75918_76898 326
605 3300046681 Ga0495647_0019538 Ga0495647_0019538_887_1867 326
606 3300046683 Ga0495658_0128265 Ga0495658_0128265_378_1358 326
607 3300046684 Ga0495669_0094739 Ga0495669_0094739_361_1341 326
608 3300046689 Ga0495613_0016426 Ga0495613_0016426_514_1494 326
609 3300046690 Ga0495624_0094266 Ga0495624_0094266_556_1536 326
610 3300046809 Ga0495600_0000001 Ga0495600_0000001_75963_76943 326
611 3300047315 Ga0495581_0161680 Ga0495581_0161680_256_1236 326
612 3300047317 Ga0495604_0000012 Ga0495604_0000012_191411_192391 326
613 3300047317 Ga0495604_0073579 Ga0495604_0073579_594_1574 326
614 3300047318 Ga0495636_0091357 Ga0495636_0091357_77_1057 326
615 3300047319 Ga0495674_0000011 Ga0495674_0000011_193697_194677 326
616 3300047321 Ga0495676_0080664 Ga0495676_0080664_503_1483 326
617 3300047322 Ga0495680_0001281 Ga0495680_0001281_22439_23419 326
618 3300047444 Ga0495675_0000096 Ga0495675_0000096_37881_38861 326
619 3300047471 Ga0495684_0000084 Ga0495684_0000084_19285_20265 326
620 3300047673 Ga0495593_0001526 Ga0495593_0001526_12550_13530 326
621 3300048088 Ga0495602_0000073 Ga0495602_0000073_75946_76926 326
622 3300048903 Ga0496100_0015237 Ga0496100_0015237_1606_2586 326
623 3300048903 Ga0496100_0107444 Ga0496100_0107444_26_1006 326
624 3300048903 Ga0496100_0144316 Ga0496100_0144316_271_1251 326
625 3300048904 Ga0496101_0014939 Ga0496101_0014939_1763_2743 326
626 3300048905 Ga0496102_0092173 Ga0496102_0092173_1734_2714 326
627 3300048905 Ga0496102_0212232 Ga0496102_0212232_651_1631 326
628 3300048907 Ga0496104_0000445 Ga0496104_0000445_17788_18768 326
629 3300048907 Ga0496104_0001219 Ga0496104_0001219_12859_13839 326
630 3300048907 Ga0496104_0002378 Ga0496104_0002378_1819_2799 326
631 3300048908 Ga0496105_0046477 Ga0496105_0046477_903_1883 326
632 3300048909 Ga0496106_0230729 Ga0496106_0230729_168_1148 326
633 3300048910 Ga0496107_0022084 Ga0496107_0022084_3032_4012 326
634 3300048910 Ga0496107_0081615 Ga0496107_0081615_1091_2071 326
635 3300048911 Ga0496108_0003673 Ga0496108_0003673_6385_7365 326
636 3300048911 Ga0496108_0004728 Ga0496108_0004728_7494_8474 326
637 3300048912 Ga0496109_0001694 Ga0496109_0001694_11703_12683 326
638 3300048912 Ga0496109_0004263 Ga0496109_0004263_6591_7571 326
639 3300048913 Ga0496110_0002379 Ga0496110_0002379_6486_7466 326
640 3300048913 Ga0496110_0413055 Ga0496110_0413055_180_1160 326
641 3300048914 Ga0496111_0000375 Ga0496111_0000375_14359_15339 326
642 3300048914 Ga0496111_0007514 Ga0496111_0007514_5677_6657 326
643 3300048914 Ga0496111_0359750 Ga0496111_0359750_41_1021 326
644 3300048915 Ga0496112_0009605 Ga0496112_0009605_7699_8679 326
645 3300048915 Ga0496112_0074254 Ga0496112_0074254_310_1290 326
646 3300048916 Ga0496113_0016155 Ga0496113_0016155_489_1469 326
647 3300048916 Ga0496113_0049815 Ga0496113_0049815_1131_2111 326
648 3300048916 Ga0496113_0108789 Ga0496113_0108789_923_1903 326
649 3300048917 Ga0496114_0197813 Ga0496114_0197813_594_1574 326
650 3300048917 Ga0496114_0287434 Ga0496114_0287434_89_1069 326
651 3300048918 Ga0496115_0045185 Ga0496115_0045185_2168_3148 326
652 3300048918 Ga0496115_0158594 Ga0496115_0158594_661_1641 326
653 3300048918 Ga0496115_0250833 Ga0496115_0250833_46_1026 326
654 3300048924 Ga0496121_0240390 Ga0496121_0240390_19_1005 326
655 3300049588 Ga0501072_0285854 Ga0501072_0285854_261_1247 326
656 3300049590 Ga0501074_0076131 Ga0501074_0076131_689_1669 326
657 3300049592 Ga0501076_0398644 Ga0501076_0398644_54_1034 326
658 3300049593 Ga0501077_0194975 Ga0501077_0194975_250_1236 326
659 3300049741 Ga0501079_0066529 Ga0501079_0066529_1427_2413 326
660 3300049743 Ga0501081_0162780 Ga0501081_0162780_262_1242 326
661 3300050489 nmdc:mga03683_12449_c1 nmdc:mga03683_12449_c1_255_1235 326
662 3300050489 nmdc:mga03683_762_c1 nmdc:mga03683_762_c1_6986_7975 326
663 3300050490 nmdc:mga03n38_66496_c1 nmdc:mga03n38_66496_c1_405_1394 326
664 3300050490 nmdc:mga03n38_8935_c1 nmdc:mga03n38_8935_c1_2613_3593 326
665 3300050491 nmdc:mga00v17_207188_c1 nmdc:mga00v17_207188_c1_90_1079 326
666 3300050492 nmdc:mga0yw44_12424_c1 nmdc:mga0yw44_12424_c1_1456_2436 326
667 3300050492 nmdc:mga0yw44_7591_c1 nmdc:mga0yw44_7591_c1_4320_5300 326
668 3300050492 nmdc:mga0yw44_86722_c1 nmdc:mga0yw44_86722_c1_237_1217 326
669 3300050493 nmdc:mga0k408_7030_c1 nmdc:mga0k408_7030_c1_2111_3091 326
670 3300050494 nmdc:mga06z11_45959_c1 nmdc:mga06z11_45959_c1_133_1113 326
671 3300050496 nmdc:mga07m45_65286_c1 nmdc:mga07m45_65286_c1_796_1785 326
672 3300050508 nmdc:mga09592_291054_c1 nmdc:mga09592_291054_c1_204_1184 326
673 3300050508 nmdc:mga09592_44949_c1 nmdc:mga09592_44949_c1_2685_3665 326
674 3300050509 nmdc:mga0qj67_17402_c1 nmdc:mga0qj67_17402_c1_4136_5116 326
675 3300050510 nmdc:mga06r32_199488_c1 nmdc:mga06r32_199488_c1_159_1139 326
676 3300050512 nmdc:mga0n895_106961_c1 nmdc:mga0n895_106961_c1_1227_2207 326
677 3300050512 nmdc:mga0n895_115366_c1 nmdc:mga0n895_115366_c1_1618_2598 326
678 3300050512 nmdc:mga0n895_549856_c1 nmdc:mga0n895_549856_c1_25_1005 326
679 3300050512 nmdc:mga0n895_73249_c1 nmdc:mga0n895_73249_c1_1543_2523 326
680 3300050514 nmdc:mga08x19_110857_c1 nmdc:mga08x19_110857_c1_649_1629 326
681 3300050514 nmdc:mga08x19_21691_c1 nmdc:mga08x19_21691_c1_2582_3562 326
682 3300053077 Ga0495601_0000009 Ga0495601_0000009_75946_76926 326
683 3300053077 Ga0495601_0004968 Ga0495601_0004968_838_1818 326
684 3300053078 Ga0495612_0000019 Ga0495612_0000019_60902_61882 326
685 3300053079 Ga0500610_0112927 Ga0500610_0112927_82_1062 326
686 3300053084 Ga0495595_0000015 Ga0495595_0000015_57201_58181 326
687 3300053085 Ga0495619_0000012 Ga0495619_0000012_75946_76926 326
688 3300053085 Ga0495619_0018391 Ga0495619_0018391_3144_4124 326
689 3300053085 Ga0495619_0087536 Ga0495619_0087536_814_1794 326
690 3300053117 Ga0500593_002797 Ga0500593_002797_2866_3846 326
691 3300053119 Ga0500595_001729 Ga0500595_001729_6863_7843 326
692 3300053146 Ga0500588_0001660 Ga0500588_0001660_2339_3319 326
693 3300053146 Ga0500588_0047309 Ga0500588_0047309_199_1188 326
694 3300053151 Ga0500604_0001281 Ga0500604_0001281_2866_3855 326
695 3300053151 Ga0500604_0007299 Ga0500604_0007299_1501_2481 326
696 3300053153 Ga0500616_0041337 Ga0500616_0041337_630_1610 326
697 3300053158 Ga0500627_0019554 Ga0500627_0019554_332_1321 326
698 3300053158 Ga0500627_0098299 Ga0500627_0098299_320_1303 326
699 3300061734 Ga0530510_0161347 Ga0530510_0161347_225_1205 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

200

323

0.98

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

9

187

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w88-assembly2.cif.gz_F the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9621 2 326
1w88-assembly2.cif.gz_F the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9591 2 326
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9579 2 326
6cer-assembly1.cif.gz_D human pyruvate dehydrogenase complex e1 component v138m mutation 0.9568 2 326
1w88-assembly2.cif.gz_H the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9565 2 326
ID Description Score Start End Superfamily
1w85B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9506 192 326 3.40.50.920
1um9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9497 2 194 3.40.50.970
1qs0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9454 189 322 3.40.50.920
1w85B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9437 192 326 3.40.50.920
af_Q10G39_79_267_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9426 4 190 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A6B0WP24-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9791 1 294 GO:0000287
GO:0003824
AF-A0A227J0R1-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9772 201 293 GO:0003824
AF-A0A6N7FA51-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9769 131 324 GO:0003824
AF-A0A6B0WP24-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9758 1 294 GO:0000287
GO:0003824
AF-A0A534YDB8-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9723 2 322 GO:0003824

Feature Viewer

pLDDT pTM Quality
90.87 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map