F476006
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 344 | 660 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300003781|Ga0055536_1000002|Ga0055536_1000002196 |
| Length | 350 |
| Sequence | VESFIFDQRQNSKKENLIMNIDVLEEINKKGFAEEEIDPTLDLFAEIERLKREKNAIILAHYYQEPDIQDIADYIGDSLGLSQEAAKTDADVIVFAGVHFMAETAKILSPDKKVLLPDVKAGCSLADSCPPHLFKKFKEKYPDHLVITYVNCTAELKALSDIVCTSTNAVQIVQSLPKDQKIIFGPDRNLGAYVAKKTGRDLVLWNGACMVHEIFSQEKITKLKERHPNAKFIAHPECEEVILKMADYVGSTTGLLKYTISNPATEFIVATESGIIHQMEKANPDKTFIPAPPNNSCACNDCPYMKRNTLEKLYLCIKNGYPEVTVPEHIIEQARKPIQRMLDISAELGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 7 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 8 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 9 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 10 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 11 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 12 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 13 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 14 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 15 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 16 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 17 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 18 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 19 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 20 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 21 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 22 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 23 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 24 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 25 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 26 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 27 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 28 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 29 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 30 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 31 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 32 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 33 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 34 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 35 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 36 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 37 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 38 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 39 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 40 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 41 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 42 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 43 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 44 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 45 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 47 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 50 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 51 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 67 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 204 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 205 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 206 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 319 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 340 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 344 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.99 |
| Metatranscriptomes | 0.43 |
| Isolates | 5.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.58 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1075644 | 2162886007 | Bacteria | 9333 |
| 2 | SwRhRL2b_contig_255488 | 2162886007 | Bacteria | 22786 |
| 3 | SwRhRL2b_contig_3484740 | 2162886007 | Bacteria | 2338 |
| 4 | JGI24736J21556_1000770 | 3300001904 | Bacteria | 5872 |
| 5 | JGI24740J21852_10004111 | 3300001979 | Bacteria | 6289 |
| 6 | JGI24737J22298_10000017 | 3300001990 | Bacteria | 46988 |
| 7 | JGI24737J22298_10005039 | 3300001990 | Bacteria | 4577 |
| 8 | JGI24735J21928_10000024 | 3300002067 | Bacteria | 95227 |
| 9 | JGI24735J21928_10013453 | 3300002067 | Bacteria | 2573 |
| 10 | JGI25162J39368_1000056 | 3300002737 | Bacteria | 146755 |
| 11 | JGI25162J39368_1000620 | 3300002737 | Bacteria | 25397 |
| 12 | JGI25164J39214_1000942 | 3300002772 | Bacteria | 9436 |
| 13 | JGI25152J39213_1000337 | 3300002773 | Bacteria | 29791 |
| 14 | JGI25150J39212_1000006 | 3300002774 | Bacteria | 257228 |
| 15 | JGI25151J46595_10000024 | 3300003187 | Bacteria | 217596 |
| 16 | JGI25165J46597_1000916 | 3300003214 | Bacteria | 20448 |
| 17 | JGI25153J46596_10000026 | 3300003215 | Bacteria | 217245 |
| 18 | rootH1_10003552 | 3300003316 | Bacteria | 4241 |
| 19 | rootH1_10026676 | 3300003316 | Bacteria | 7472 |
| 20 | rootH2_10000579 | 3300003320 | Bacteria | 178428 |
| 21 | rootH2_10042766 | 3300003320 | Bacteria | 27178 |
| 22 | rootH2_10055718 | 3300003320 | Bacteria | 2133 |
| 23 | rootH2_10244504 | 3300003320 | Bacteria | 1170 |
| 24 | rootH1_10060032 | 3300003323 | Bacteria | 5010 |
| 25 | rootH1_10066500 | 3300003323 | Bacteria | 9935 |
| 26 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 27 | Ga0055530_10011132 | 3300003791 | Bacteria | 3258 |
| 28 | Ga0058863_11436476 | 3300004799 | Bacteria | 1953 |
| 29 | Ga0065714_10004217 | 3300005288 | Bacteria | 14624 |
| 30 | Ga0065714_10010214 | 3300005288 | Bacteria | 2794 |
| 31 | Ga0065714_10064535 | 3300005288 | Bacteria | 40118 |
| 32 | Ga0065714_10069686 | 3300005288 | Bacteria | 4116 |
| 33 | Ga0065714_10100080 | 3300005288 | Bacteria | 1672 |
| 34 | Ga0065714_10130465 | 3300005288 | Bacteria | 1255 |
| 35 | Ga0065704_10000218 | 3300005289 | Bacteria | 76484 |
| 36 | Ga0065704_10077907 | 3300005289 | Bacteria | 4586 |
| 37 | Ga0065704_10142975 | 3300005289 | Bacteria | 1499 |
| 38 | Ga0070658_10000032 | 3300005327 | Bacteria | 147726 |
| 39 | Ga0070658_10094307 | 3300005327 | Bacteria | 2469 |
| 40 | Ga0070676_10002072 | 3300005328 | Bacteria | 10201 |
| 41 | Ga0070683_100067207 | 3300005329 | Bacteria | 3339 |
| 42 | Ga0070690_100255051 | 3300005330 | Bacteria | 1242 |
| 43 | Ga0068869_100008852 | 3300005334 | Bacteria | 6513 |
| 44 | Ga0070666_10000030 | 3300005335 | Bacteria | 137543 |
| 45 | Ga0070680_100006592 | 3300005336 | Bacteria | 8829 |
| 46 | Ga0070680_100365554 | 3300005336 | Bacteria | 1227 |
| 47 | Ga0068868_100035950 | 3300005338 | Bacteria | 3831 |
| 48 | Ga0070660_100023968 | 3300005339 | Bacteria | 4526 |
| 49 | Ga0070689_100002402 | 3300005340 | Bacteria | 12222 |
| 50 | Ga0070689_100003633 | 3300005340 | Bacteria | 10289 |
| 51 | Ga0070689_100023414 | 3300005340 | Bacteria | 4623 |
| 52 | Ga0070689_100052373 | 3300005340 | Bacteria | 3157 |
| 53 | Ga0070691_10139215 | 3300005341 | Bacteria | 1235 |
| 54 | Ga0070687_100026314 | 3300005343 | Bacteria | 2800 |
| 55 | Ga0070671_100001424 | 3300005355 | Bacteria | 17882 |
| 56 | Ga0070673_100201153 | 3300005364 | Bacteria | 1716 |
| 57 | Ga0070659_100000412 | 3300005366 | Bacteria | 32519 |
| 58 | Ga0070667_100022732 | 3300005367 | Bacteria | 5200 |
| 59 | Ga0070714_100007178 | 3300005435 | Bacteria | 8645 |
| 60 | Ga0070701_10107227 | 3300005438 | Bacteria | 1556 |
| 61 | Ga0070711_100005204 | 3300005439 | Bacteria | 7761 |
| 62 | Ga0070694_100141549 | 3300005444 | Bacteria | 1748 |
| 63 | Ga0070663_100139642 | 3300005455 | Bacteria | 1848 |
| 64 | Ga0070678_100002739 | 3300005456 | Bacteria | 9728 |
| 65 | Ga0070662_100001063 | 3300005457 | Bacteria | 16771 |
| 66 | Ga0070681_10009105 | 3300005458 | Bacteria | 9757 |
| 67 | Ga0070681_10033602 | 3300005458 | Bacteria | 5148 |
| 68 | Ga0070681_10184017 | 3300005458 | Bacteria | 2010 |
| 69 | Ga0068867_100000088 | 3300005459 | Bacteria | 58016 |
| 70 | Ga0070679_100141543 | 3300005530 | Bacteria | 2384 |
| 71 | Ga0070679_100322430 | 3300005530 | Bacteria | 1494 |
| 72 | Ga0070684_100174832 | 3300005535 | Bacteria | 1951 |
| 73 | Ga0070684_100388952 | 3300005535 | Bacteria | 1285 |
| 74 | Ga0068853_100067797 | 3300005539 | Bacteria | 3101 |
| 75 | Ga0068853_100413110 | 3300005539 | Bacteria | 1265 |
| 76 | Ga0070672_100087877 | 3300005543 | Bacteria | 2502 |
| 77 | Ga0070686_100026851 | 3300005544 | Bacteria | 3479 |
| 78 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 79 | Ga0070704_100012892 | 3300005549 | Bacteria | 5172 |
| 80 | Ga0068855_100000160 | 3300005563 | Bacteria | 86118 |
| 81 | Ga0068855_100000919 | 3300005563 | Bacteria | 36613 |
| 82 | Ga0068855_100003038 | 3300005563 | Bacteria | 20548 |
| 83 | Ga0068855_100029065 | 3300005563 | Bacteria | 6610 |
| 84 | Ga0068855_100047909 | 3300005563 | Bacteria | 5046 |
| 85 | Ga0068855_100074415 | 3300005563 | Bacteria | 3945 |
| 86 | Ga0068855_100086508 | 3300005563 | Bacteria | 3625 |
| 87 | Ga0068855_100378355 | 3300005563 | Bacteria | 1555 |
| 88 | Ga0068855_100424675 | 3300005563 | Bacteria | 1453 |
| 89 | Ga0068857_100004246 | 3300005577 | Bacteria | 12075 |
| 90 | Ga0068857_100055113 | 3300005577 | Bacteria | 3528 |
| 91 | Ga0068854_100009205 | 3300005578 | Bacteria | 6374 |
| 92 | Ga0068856_100000067 | 3300005614 | Bacteria | 98357 |
| 93 | Ga0068856_100000399 | 3300005614 | Bacteria | 47601 |
| 94 | Ga0068856_100015211 | 3300005614 | Bacteria | 7435 |
| 95 | Ga0068856_100033709 | 3300005614 | Bacteria | 5015 |
| 96 | Ga0068856_100034580 | 3300005614 | Bacteria | 4949 |
| 97 | Ga0068856_100052450 | 3300005614 | Bacteria | 4022 |
| 98 | Ga0068856_100366229 | 3300005614 | Bacteria | 1460 |
| 99 | Ga0068852_100000956 | 3300005616 | Bacteria | 19010 |
| 100 | Ga0068852_100002647 | 3300005616 | Bacteria | 12375 |
| 101 | Ga0068852_100016582 | 3300005616 | Bacteria | 5752 |
| 102 | Ga0068852_100070533 | 3300005616 | Bacteria | 3066 |
| 103 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 104 | Ga0068859_100130718 | 3300005617 | Bacteria | 2582 |
| 105 | Ga0068859_100259507 | 3300005617 | Bacteria | 1829 |
| 106 | Ga0068864_100005897 | 3300005618 | Bacteria | 10041 |
| 107 | Ga0068863_100243144 | 3300005841 | Bacteria | 1737 |
| 108 | Ga0068863_100344341 | 3300005841 | Bacteria | 1450 |
| 109 | Ga0068858_100012504 | 3300005842 | Bacteria | 8006 |
| 110 | Ga0068860_100004265 | 3300005843 | Bacteria | 14642 |
| 111 | Ga0075366_10003996 | 3300006195 | Bacteria | 7880 |
| 112 | Ga0097621_100000017 | 3300006237 | Bacteria | 90529 |
| 113 | Ga0097621_100054503 | 3300006237 | Bacteria | 3262 |
| 114 | Ga0068871_100000053 | 3300006358 | Bacteria | 63957 |
| 115 | Ga0068871_100168833 | 3300006358 | Bacteria | 1874 |
| 116 | Ga0075431_100171401 | 3300006847 | Bacteria | 2229 |
| 117 | Ga0075434_100136277 | 3300006871 | Bacteria | 2474 |
| 118 | Ga0075434_100178372 | 3300006871 | Bacteria | 2144 |
| 119 | Ga0075429_100044531 | 3300006880 | Bacteria | 3860 |
| 120 | Ga0068865_100000213 | 3300006881 | Bacteria | 32484 |
| 121 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 122 | Ga0097620_100130717 | 3300006931 | Bacteria | 2582 |
| 123 | Ga0097620_100259520 | 3300006931 | Bacteria | 1829 |
| 124 | Ga0105244_10016121 | 3300009036 | Bacteria | 4264 |
| 125 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 126 | Ga0105240_10000872 | 3300009093 | Bacteria | 54351 |
| 127 | Ga0105240_10013206 | 3300009093 | Bacteria | 11364 |
| 128 | Ga0105240_10026212 | 3300009093 | Bacteria | 7648 |
| 129 | Ga0105240_10045318 | 3300009093 | Bacteria | 5580 |
| 130 | Ga0105240_10401965 | 3300009093 | Bacteria | 1543 |
| 131 | Ga0105240_10423339 | 3300009093 | Bacteria | 1495 |
| 132 | Ga0111539_10002005 | 3300009094 | Bacteria | 27177 |
| 133 | Ga0111539_10090431 | 3300009094 | Bacteria | 3597 |
| 134 | Ga0111539_10097277 | 3300009094 | Bacteria | 3457 |
| 135 | Ga0111539_10115364 | 3300009094 | Bacteria | 3150 |
| 136 | Ga0111539_10466816 | 3300009094 | Bacteria | 1470 |
| 137 | Ga0105247_10005364 | 3300009101 | Bacteria | 8081 |
| 138 | Ga0105243_10000046 | 3300009148 | Bacteria | 155277 |
| 139 | Ga0105241_10000831 | 3300009174 | Bacteria | 23378 |
| 140 | Ga0105241_10001226 | 3300009174 | Bacteria | 19619 |
| 141 | Ga0105241_10004424 | 3300009174 | Bacteria | 10390 |
| 142 | Ga0105241_10052099 | 3300009174 | Bacteria | 3124 |
| 143 | Ga0105241_10229382 | 3300009174 | Bacteria | 1565 |
| 144 | Ga0105241_10461328 | 3300009174 | Bacteria | 1126 |
| 145 | Ga0105237_10000138 | 3300009545 | Bacteria | 102411 |
| 146 | Ga0105237_10000311 | 3300009545 | Bacteria | 67880 |
| 147 | Ga0105237_10000567 | 3300009545 | Bacteria | 51672 |
| 148 | Ga0105237_10002767 | 3300009545 | Bacteria | 21321 |
| 149 | Ga0105237_10003384 | 3300009545 | Bacteria | 18969 |
| 150 | Ga0105237_10009180 | 3300009545 | Bacteria | 10619 |
| 151 | Ga0105237_10023922 | 3300009545 | Bacteria | 6251 |
| 152 | Ga0105237_10029333 | 3300009545 | Bacteria | 5594 |
| 153 | Ga0105237_10109599 | 3300009545 | Bacteria | 2753 |
| 154 | Ga0105237_10125294 | 3300009545 | Bacteria | 2563 |
| 155 | Ga0105237_10400352 | 3300009545 | Bacteria | 1378 |
| 156 | Ga0105238_10016483 | 3300009551 | Bacteria | 7480 |
| 157 | Ga0105238_10034231 | 3300009551 | Bacteria | 5169 |
| 158 | Ga0105238_10042318 | 3300009551 | Bacteria | 4613 |
| 159 | Ga0105238_10052272 | 3300009551 | Bacteria | 4107 |
| 160 | Ga0105249_10044120 | 3300009553 | Bacteria | 4055 |
| 161 | Ga0105239_10000014 | 3300010375 | Bacteria | 325391 |
| 162 | Ga0105239_10000069 | 3300010375 | Bacteria | 144493 |
| 163 | Ga0105239_10000161 | 3300010375 | Bacteria | 97242 |
| 164 | Ga0105239_10009374 | 3300010375 | Bacteria | 11044 |
| 165 | Ga0105239_10072207 | 3300010375 | Bacteria | 3794 |
| 166 | Ga0105239_10177209 | 3300010375 | Bacteria | 2384 |
| 167 | Ga0105246_10036831 | 3300011119 | Bacteria | 3279 |
| 168 | Ga0105246_10046001 | 3300011119 | Bacteria | 2975 |
| 169 | Ga0157373_10000164 | 3300013100 | Bacteria | 53961 |
| 170 | Ga0157373_10000167 | 3300013100 | Bacteria | 53611 |
| 171 | Ga0157373_10001307 | 3300013100 | Bacteria | 19028 |
| 172 | Ga0157373_10001611 | 3300013100 | Bacteria | 17236 |
| 173 | Ga0157373_10003583 | 3300013100 | Bacteria | 11730 |
| 174 | Ga0157373_10072595 | 3300013100 | Bacteria | 2429 |
| 175 | Ga0157371_10000257 | 3300013102 | Bacteria | 73583 |
| 176 | Ga0157371_10000367 | 3300013102 | Bacteria | 56890 |
| 177 | Ga0157371_10000991 | 3300013102 | Bacteria | 31396 |
| 178 | Ga0157371_10001608 | 3300013102 | Bacteria | 23170 |
| 179 | Ga0157371_10002698 | 3300013102 | Bacteria | 16766 |
| 180 | Ga0157371_10004054 | 3300013102 | Bacteria | 12956 |
| 181 | Ga0157371_10007592 | 3300013102 | Bacteria | 8750 |
| 182 | Ga0157371_10007977 | 3300013102 | Bacteria | 8494 |
| 183 | Ga0157370_10002955 | 3300013104 | Bacteria | 20235 |
| 184 | Ga0157370_10012066 | 3300013104 | Bacteria | 8994 |
| 185 | Ga0157370_10018712 | 3300013104 | Bacteria | 6965 |
| 186 | Ga0157370_10026402 | 3300013104 | Bacteria | 5735 |
| 187 | Ga0157370_10080937 | 3300013104 | Bacteria | 3057 |
| 188 | Ga0157370_10083095 | 3300013104 | Bacteria | 3011 |
| 189 | Ga0157370_10092969 | 3300013104 | Bacteria | 2830 |
| 190 | Ga0157370_10097216 | 3300013104 | Bacteria | 2762 |
| 191 | Ga0157370_10108413 | 3300013104 | Bacteria | 2597 |
| 192 | Ga0157370_10117370 | 3300013104 | Bacteria | 2486 |
| 193 | Ga0157370_10122274 | 3300013104 | Bacteria | 2430 |
| 194 | Ga0157369_10000158 | 3300013105 | Bacteria | 96395 |
| 195 | Ga0157369_10003611 | 3300013105 | Bacteria | 18378 |
| 196 | Ga0157369_10036533 | 3300013105 | Bacteria | 5381 |
| 197 | Ga0157369_10038169 | 3300013105 | Bacteria | 5253 |
| 198 | Ga0157369_10327060 | 3300013105 | Bacteria | 1593 |
| 199 | Ga0157374_10000122 | 3300013296 | Bacteria | 70398 |
| 200 | Ga0157374_10000431 | 3300013296 | Bacteria | 38001 |
| 201 | Ga0157374_10001925 | 3300013296 | Bacteria | 17411 |
| 202 | Ga0157374_10059920 | 3300013296 | Bacteria | 3561 |
| 203 | Ga0157378_10038963 | 3300013297 | Bacteria | 4214 |
| 204 | Ga0157378_10060087 | 3300013297 | Bacteria | 3392 |
| 205 | Ga0157378_10109952 | 3300013297 | Bacteria | 2525 |
| 206 | Ga0157378_10144062 | 3300013297 | Bacteria | 2215 |
| 207 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 208 | Ga0163162_10000071 | 3300013306 | Bacteria | 94831 |
| 209 | Ga0163162_10000824 | 3300013306 | Bacteria | 28851 |
| 210 | Ga0163162_10002735 | 3300013306 | Bacteria | 16742 |
| 211 | Ga0157372_10000037 | 3300013307 | Bacteria | 172444 |
| 212 | Ga0157372_10001036 | 3300013307 | Bacteria | 30412 |
| 213 | Ga0157372_10003224 | 3300013307 | Bacteria | 17614 |
| 214 | Ga0157372_10004621 | 3300013307 | Bacteria | 14638 |
| 215 | Ga0157372_10023053 | 3300013307 | Bacteria | 6746 |
| 216 | Ga0157372_10069770 | 3300013307 | Bacteria | 3953 |
| 217 | Ga0157372_10127825 | 3300013307 | Bacteria | 2922 |
| 218 | Ga0157375_10000111 | 3300013308 | Bacteria | 79589 |
| 219 | Ga0157375_10007484 | 3300013308 | Bacteria | 9551 |
| 220 | Ga0157375_10133363 | 3300013308 | Bacteria | 2605 |
| 221 | Ga0157375_10371713 | 3300013308 | Bacteria | 1596 |
| 222 | Ga0157375_10444414 | 3300013308 | Bacteria | 1462 |
| 223 | Ga0163163_10000020 | 3300014325 | Bacteria | 196885 |
| 224 | Ga0163163_10079855 | 3300014325 | Bacteria | 3270 |
| 225 | Ga0163163_10102041 | 3300014325 | Bacteria | 2892 |
| 226 | Ga0163163_10316019 | 3300014325 | Bacteria | 1615 |
| 227 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 228 | Ga0182008_10000046 | 3300014497 | Bacteria | 111777 |
| 229 | Ga0182008_10000459 | 3300014497 | Bacteria | 31097 |
| 230 | Ga0182008_10007004 | 3300014497 | Bacteria | 6250 |
| 231 | Ga0157379_10303909 | 3300014968 | Bacteria | 1454 |
| 232 | Ga0157376_10156441 | 3300014969 | Bacteria | 2061 |
| 233 | Ga0182006_1000139 | 3300015261 | Bacteria | 77918 |
| 234 | Ga0182006_1000289 | 3300015261 | Bacteria | 44305 |
| 235 | Ga0182006_1001252 | 3300015261 | Bacteria | 15727 |
| 236 | Ga0182006_1002192 | 3300015261 | Bacteria | 10824 |
| 237 | Ga0182006_1002445 | 3300015261 | Bacteria | 10151 |
| 238 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 239 | Ga0182007_10004586 | 3300015262 | Bacteria | 6241 |
| 240 | Ga0182007_10037757 | 3300015262 | Bacteria | 1621 |
| 241 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 242 | Ga0163161_10000355 | 3300017792 | Bacteria | 38658 |
| 243 | Ga0163161_10002183 | 3300017792 | Bacteria | 14111 |
| 244 | Ga0163161_10003056 | 3300017792 | Bacteria | 11803 |
| 245 | Ga0163161_10017615 | 3300017792 | Bacteria | 5002 |
| 246 | Ga0163161_10033166 | 3300017792 | Bacteria | 3689 |
| 247 | Ga0163161_10060112 | 3300017792 | Bacteria | 2765 |
| 248 | Ga0206351_10526440 | 3300020077 | Bacteria | 1166 |
| 249 | Ga0206350_10913138 | 3300020080 | Bacteria | 1887 |
| 250 | Ga0213872_10007723 | 3300021361 | Bacteria | 5261 |
| 251 | Ga0207427_100071 | 3300025231 | Bacteria | 159974 |
| 252 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 253 | Ga0209437_100124 | 3300025233 | Bacteria | 199789 |
| 254 | Ga0209258_107295 | 3300025242 | Bacteria | 1652 |
| 255 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 256 | Ga0209026_1000250 | 3300025250 | Bacteria | 68451 |
| 257 | Ga0209026_1006781 | 3300025250 | Bacteria | 2723 |
| 258 | Ga0209026_1014556 | 3300025250 | Bacteria | 1310 |
| 259 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 260 | Ga0209129_1008338 | 3300025258 | Bacteria | 2900 |
| 261 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 262 | Ga0209233_1008227 | 3300025261 | Bacteria | 3241 |
| 263 | Ga0209233_1020327 | 3300025261 | Bacteria | 1744 |
| 264 | Ga0209455_1002522 | 3300025272 | Bacteria | 7020 |
| 265 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 266 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 267 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 268 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 269 | Ga0207655_1015992 | 3300025728 | Bacteria | 4133 |
| 270 | Ga0207710_10002740 | 3300025900 | Bacteria | 8073 |
| 271 | Ga0207680_10000014 | 3300025903 | Bacteria | 179035 |
| 272 | Ga0207647_10000041 | 3300025904 | Bacteria | 92367 |
| 273 | Ga0207647_10000146 | 3300025904 | Bacteria | 56177 |
| 274 | Ga0207647_10032159 | 3300025904 | Bacteria | 3373 |
| 275 | Ga0207647_10057312 | 3300025904 | Bacteria | 2388 |
| 276 | Ga0207647_10134170 | 3300025904 | Bacteria | 1454 |
| 277 | Ga0207645_10000360 | 3300025907 | Bacteria | 37759 |
| 278 | Ga0207705_10000032 | 3300025909 | Bacteria | 224376 |
| 279 | Ga0207705_10086874 | 3300025909 | Bacteria | 2286 |
| 280 | Ga0207684_10340196 | 3300025910 | Bacteria | 1292 |
| 281 | Ga0207654_10001427 | 3300025911 | Bacteria | 12688 |
| 282 | Ga0207654_10002088 | 3300025911 | Bacteria | 10232 |
| 283 | Ga0207707_10010673 | 3300025912 | Bacteria | 7981 |
| 284 | Ga0207707_10014564 | 3300025912 | Bacteria | 6851 |
| 285 | Ga0207707_10027491 | 3300025912 | Bacteria | 4974 |
| 286 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 287 | Ga0207695_10003909 | 3300025913 | Bacteria | 20614 |
| 288 | Ga0207695_10020975 | 3300025913 | Bacteria | 7465 |
| 289 | Ga0207695_10023389 | 3300025913 | Bacteria | 6982 |
| 290 | Ga0207695_10079432 | 3300025913 | Bacteria | 3325 |
| 291 | Ga0207671_10000635 | 3300025914 | Bacteria | 45980 |
| 292 | Ga0207671_10000979 | 3300025914 | Bacteria | 35379 |
| 293 | Ga0207671_10000991 | 3300025914 | Bacteria | 34985 |
| 294 | Ga0207671_10001361 | 3300025914 | Bacteria | 28549 |
| 295 | Ga0207671_10003727 | 3300025914 | Bacteria | 15021 |
| 296 | Ga0207671_10006047 | 3300025914 | Bacteria | 10917 |
| 297 | Ga0207671_10008901 | 3300025914 | Bacteria | 8452 |
| 298 | Ga0207671_10014401 | 3300025914 | Bacteria | 6252 |
| 299 | Ga0207671_10067636 | 3300025914 | Bacteria | 2661 |
| 300 | Ga0207671_10177824 | 3300025914 | Bacteria | 1655 |
| 301 | Ga0207663_10009269 | 3300025916 | Bacteria | 5193 |
| 302 | Ga0207660_10374510 | 3300025917 | Bacteria | 1144 |
| 303 | Ga0207657_10031472 | 3300025919 | Bacteria | 4805 |
| 304 | Ga0207657_10099972 | 3300025919 | Bacteria | 2409 |
| 305 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 306 | Ga0207652_10021560 | 3300025921 | Bacteria | 5318 |
| 307 | Ga0207652_10156639 | 3300025921 | Bacteria | 2041 |
| 308 | Ga0207694_10018133 | 3300025924 | Bacteria | 5321 |
| 309 | Ga0207694_10061523 | 3300025924 | Bacteria | 2922 |
| 310 | Ga0207694_10087138 | 3300025924 | Bacteria | 2459 |
| 311 | Ga0207664_10007731 | 3300025929 | Bacteria | 7461 |
| 312 | Ga0207690_10000049 | 3300025932 | Bacteria | 113589 |
| 313 | Ga0207690_10164759 | 3300025932 | Bacteria | 1656 |
| 314 | Ga0207706_10000007 | 3300025933 | Bacteria | 211081 |
| 315 | Ga0207709_10000020 | 3300025935 | Bacteria | 392366 |
| 316 | Ga0207670_10001839 | 3300025936 | Bacteria | 11075 |
| 317 | Ga0207704_10000272 | 3300025938 | Bacteria | 24862 |
| 318 | Ga0207691_10093916 | 3300025940 | Bacteria | 2685 |
| 319 | Ga0207689_10022150 | 3300025942 | Bacteria | 5343 |
| 320 | Ga0207661_10202003 | 3300025944 | Bacteria | 1748 |
| 321 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 322 | Ga0207667_10000492 | 3300025949 | Bacteria | 52207 |
| 323 | Ga0207667_10002743 | 3300025949 | Bacteria | 21770 |
| 324 | Ga0207667_10019365 | 3300025949 | Bacteria | 7600 |
| 325 | Ga0207667_10052288 | 3300025949 | Bacteria | 4303 |
| 326 | Ga0207667_10100335 | 3300025949 | Bacteria | 2986 |
| 327 | Ga0207667_10127560 | 3300025949 | Bacteria | 2621 |
| 328 | Ga0207667_10130250 | 3300025949 | Bacteria | 2591 |
| 329 | Ga0207667_10171493 | 3300025949 | Bacteria | 2230 |
| 330 | Ga0207651_10530990 | 3300025960 | Bacteria | 1021 |
| 331 | Ga0207651_10561718 | 3300025960 | Bacteria | 993 |
| 332 | Ga0207712_10019558 | 3300025961 | Bacteria | 4425 |
| 333 | Ga0207640_10006613 | 3300025981 | Bacteria | 6368 |
| 334 | Ga0207703_10009595 | 3300026035 | Bacteria | 7601 |
| 335 | Ga0207639_10108333 | 3300026041 | Bacteria | 2259 |
| 336 | Ga0207678_10078492 | 3300026067 | Bacteria | 2828 |
| 337 | Ga0207702_10001092 | 3300026078 | Bacteria | 27756 |
| 338 | Ga0207702_10006759 | 3300026078 | Bacteria | 9842 |
| 339 | Ga0207702_10022981 | 3300026078 | Bacteria | 5173 |
| 340 | Ga0207702_10027834 | 3300026078 | Bacteria | 4696 |
| 341 | Ga0207702_10045049 | 3300026078 | Bacteria | 3711 |
| 342 | Ga0207702_10157724 | 3300026078 | Bacteria | 2070 |
| 343 | Ga0207702_10186541 | 3300026078 | Bacteria | 1913 |
| 344 | Ga0207702_10214260 | 3300026078 | Bacteria | 1792 |
| 345 | Ga0207702_10279072 | 3300026078 | Bacteria | 1579 |
| 346 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 347 | Ga0207641_10104832 | 3300026088 | Bacteria | 2497 |
| 348 | Ga0207641_10347349 | 3300026088 | Bacteria | 1413 |
| 349 | Ga0207648_10000075 | 3300026089 | Bacteria | 93756 |
| 350 | Ga0207676_10034064 | 3300026095 | Bacteria | 3853 |
| 351 | Ga0207674_10003864 | 3300026116 | Bacteria | 18258 |
| 352 | Ga0207674_10035173 | 3300026116 | Bacteria | 5229 |
| 353 | Ga0207683_10002554 | 3300026121 | Bacteria | 15884 |
| 354 | Ga0207698_10002370 | 3300026142 | Bacteria | 11175 |
| 355 | Ga0207698_10011897 | 3300026142 | Bacteria | 5666 |
| 356 | Ga0207428_10092014 | 3300027907 | Bacteria | 2354 |
| 357 | Ga0268266_10000195 | 3300028379 | Bacteria | 105788 |
| 358 | Ga0268264_10006198 | 3300028381 | Bacteria | 10098 |
| 359 | Ga0265337_1001468 | 3300028556 | Bacteria | 11548 |
| 360 | Ga0265337_1004220 | 3300028556 | Bacteria | 6016 |
| 361 | Ga0265337_1018602 | 3300028556 | Bacteria | 2204 |
| 362 | Ga0265337_1029255 | 3300028556 | Bacteria | 1648 |
| 363 | Ga0265319_1012654 | 3300028563 | Bacteria | 3398 |
| 364 | Ga0265334_10012854 | 3300028573 | Bacteria | 3510 |
| 365 | Ga0265334_10054499 | 3300028573 | Bacteria | 1525 |
| 366 | Ga0265323_10012987 | 3300028653 | Bacteria | 3330 |
| 367 | Ga0265323_10025579 | 3300028653 | Bacteria | 2232 |
| 368 | Ga0265336_10005438 | 3300028666 | Bacteria | 4694 |
| 369 | Ga0265336_10044228 | 3300028666 | Bacteria | 1355 |
| 370 | Ga0307517_10000335 | 3300028786 | Bacteria | 81908 |
| 371 | Ga0307515_10000528 | 3300028794 | Bacteria | 90438 |
| 372 | Ga0307515_10003943 | 3300028794 | Bacteria | 30968 |
| 373 | Ga0307515_10109008 | 3300028794 | Bacteria | 3257 |
| 374 | Ga0307515_10123215 | 3300028794 | Bacteria | 2918 |
| 375 | Ga0265338_10000016 | 3300028800 | Bacteria | 347424 |
| 376 | Ga0265338_10000111 | 3300028800 | Bacteria | 151469 |
| 377 | Ga0265338_10000382 | 3300028800 | Bacteria | 79298 |
| 378 | Ga0265338_10000510 | 3300028800 | Bacteria | 68748 |
| 379 | Ga0265338_10003109 | 3300028800 | Bacteria | 23752 |
| 380 | Ga0265338_10003369 | 3300028800 | Bacteria | 22563 |
| 381 | Ga0265338_10003690 | 3300028800 | Bacteria | 21328 |
| 382 | Ga0265338_10005161 | 3300028800 | Bacteria | 17170 |
| 383 | Ga0265338_10007043 | 3300028800 | Bacteria | 14104 |
| 384 | Ga0265338_10018926 | 3300028800 | Bacteria | 7342 |
| 385 | Ga0265338_10037030 | 3300028800 | Bacteria | 4653 |
| 386 | Ga0265338_10038589 | 3300028800 | Bacteria | 4521 |
| 387 | Ga0265338_10040143 | 3300028800 | Bacteria | 4400 |
| 388 | Ga0265338_10050076 | 3300028800 | Bacteria | 3779 |
| 389 | Ga0265338_10124118 | 3300028800 | Bacteria | 2052 |
| 390 | Ga0265338_10140858 | 3300028800 | Bacteria | 1889 |
| 391 | Ga0265338_10153931 | 3300028800 | Bacteria | 1783 |
| 392 | Ga0265338_10305366 | 3300028800 | Bacteria | 1155 |
| 393 | Ga0265324_10001661 | 3300029957 | Bacteria | 12308 |
| 394 | Ga0265324_10001805 | 3300029957 | Bacteria | 11634 |
| 395 | Ga0265324_10002570 | 3300029957 | Bacteria | 9162 |
| 396 | Ga0265324_10005257 | 3300029957 | Bacteria | 5628 |
| 397 | Ga0265324_10043394 | 3300029957 | Bacteria | 1552 |
| 398 | Ga0316177_1191726 | 3300030731 | Bacteria | 13692 |
| 399 | Ga0316176_1138145 | 3300030732 | Bacteria | 6542 |
| 400 | Ga0316183_1037277 | 3300030742 | Bacteria | 60977 |
| 401 | Ga0316181_1123353 | 3300030744 | Bacteria | 27179 |
| 402 | Ga0265320_10000572 | 3300031240 | Bacteria | 28290 |
| 403 | Ga0265320_10001941 | 3300031240 | Bacteria | 14613 |
| 404 | Ga0265320_10056739 | 3300031240 | Bacteria | 1881 |
| 405 | Ga0265320_10089068 | 3300031240 | Bacteria | 1431 |
| 406 | Ga0265325_10002864 | 3300031241 | Bacteria | 11500 |
| 407 | Ga0265325_10047547 | 3300031241 | Bacteria | 2220 |
| 408 | Ga0265329_10051913 | 3300031242 | Bacteria | 1305 |
| 409 | Ga0265340_10006048 | 3300031247 | Bacteria | 6672 |
| 410 | Ga0265340_10006637 | 3300031247 | Bacteria | 6347 |
| 411 | Ga0265339_10021164 | 3300031249 | Bacteria | 3789 |
| 412 | Ga0265331_10023224 | 3300031250 | Bacteria | 3154 |
| 413 | Ga0265327_10000709 | 3300031251 | Bacteria | 52606 |
| 414 | Ga0265327_10003147 | 3300031251 | Bacteria | 16190 |
| 415 | Ga0265316_10006780 | 3300031344 | Bacteria | 10900 |
| 416 | Ga0265316_10008622 | 3300031344 | Bacteria | 9443 |
| 417 | Ga0265316_10033857 | 3300031344 | Bacteria | 4156 |
| 418 | Ga0265316_10055751 | 3300031344 | Bacteria | 3090 |
| 419 | Ga0265316_10137515 | 3300031344 | Bacteria | 1837 |
| 420 | Ga0265316_10138974 | 3300031344 | Bacteria | 1826 |
| 421 | Ga0307509_10033314 | 3300031507 | Bacteria | 5672 |
| 422 | Ga0307408_100000164 | 3300031548 | Bacteria | 73855 |
| 423 | Ga0307408_100001486 | 3300031548 | Bacteria | 17405 |
| 424 | Ga0265313_10000385 | 3300031595 | Bacteria | 47503 |
| 425 | Ga0265313_10000877 | 3300031595 | Bacteria | 30400 |
| 426 | Ga0265314_10000088 | 3300031711 | Bacteria | 138315 |
| 427 | Ga0265314_10006238 | 3300031711 | Bacteria | 10586 |
| 428 | Ga0265314_10056731 | 3300031711 | Bacteria | 2694 |
| 429 | Ga0265342_10072777 | 3300031712 | Bacteria | 2000 |
| 430 | Ga0307405_10000045 | 3300031731 | Bacteria | 71537 |
| 431 | Ga0307405_10104337 | 3300031731 | Bacteria | 1907 |
| 432 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 433 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 434 | Ga0307412_10000697 | 3300031911 | Bacteria | 19377 |
| 435 | Ga0307412_10065524 | 3300031911 | Bacteria | 2459 |
| 436 | Ga0307412_10074025 | 3300031911 | Bacteria | 2333 |
| 437 | Ga0307412_10083239 | 3300031911 | Bacteria | 2217 |
| 438 | Ga0307409_100004241 | 3300031995 | Bacteria | 8003 |
| 439 | Ga0307409_100280770 | 3300031995 | Bacteria | 1539 |
| 440 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 441 | Ga0307414_10000952 | 3300032004 | Bacteria | 14793 |
| 442 | Ga0307414_10017292 | 3300032004 | Bacteria | 4408 |
| 443 | Ga0307414_10023579 | 3300032004 | Bacteria | 3906 |
| 444 | Ga0307414_10028685 | 3300032004 | Bacteria | 3613 |
| 445 | Ga0307414_10029693 | 3300032004 | Bacteria | 3562 |
| 446 | Ga0307414_10031226 | 3300032004 | Bacteria | 3492 |
| 447 | Ga0307414_10083648 | 3300032004 | Bacteria | 2344 |
| 448 | Ga0307414_10151972 | 3300032004 | Bacteria | 1827 |
| 449 | Ga0307507_10001000 | 3300033179 | Bacteria | 62890 |
| 450 | Ga0307510_10002118 | 3300033180 | Bacteria | 22455 |
| 451 | Ga0373950_0015370 | 3300034818 | Bacteria | 1297 |
| 452 | Ga0373928_0000099 | 3300035084 | Bacteria | 15539 |
| 453 | Ga0373929_0000255 | 3300035085 | Bacteria | 9860 |
| 454 | Ga0373944_0000221 | 3300035089 | Bacteria | 12292 |
| 455 | Ga0373951_0010052 | 3300035091 | Bacteria | 2123 |
| 456 | Ga0373952_0021056 | 3300035092 | Bacteria | 1373 |
| 457 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 458 | Ga0373954_0070522 | 3300035118 | Bacteria | 1660 |
| 459 | Ga0373962_0000025 | 3300035242 | Bacteria | 39712 |
| 460 | Ga0373924_0097339 | 3300035410 | Bacteria | 1264 |
| 461 | Ga0373931_0000004 | 3300035691 | Bacteria | 535140 |
| 462 | Ga0373935_0190246 | 3300035692 | Bacteria | 1413 |
| 463 | Ga0373927_0025476 | 3300035695 | Bacteria | 3868 |
| 464 | Ga0373947_0169275 | 3300035725 | Bacteria | 1417 |
| 465 | Ga0373937_0045011 | 3300036401 | Bacteria | 4032 |
| 466 | Ga0373937_0223162 | 3300036401 | Bacteria | 1774 |
| 467 | Ga0373925_0002234 | 3300037068 | Bacteria | 15717 |
| 468 | Ga0373925_0003683 | 3300037068 | Bacteria | 11784 |
| 469 | Ga0373925_0017992 | 3300037068 | Bacteria | 5132 |
| 470 | Ga0373925_0072241 | 3300037068 | Bacteria | 2611 |
| 471 | Ga0373925_0146157 | 3300037068 | Bacteria | 1854 |
| 472 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 473 | Ga0395899_0000152 | 3300037312 | Bacteria | 105233 |
| 474 | Ga0395899_0023158 | 3300037312 | Bacteria | 4707 |
| 475 | Ga0395899_0153716 | 3300037312 | Bacteria | 1629 |
| 476 | Ga0395900_0000288 | 3300037418 | Bacteria | 75715 |
| 477 | Ga0395900_0003963 | 3300037418 | Bacteria | 15800 |
| 478 | Ga0395900_0009792 | 3300037418 | Bacteria | 9821 |
| 479 | Ga0395900_0023483 | 3300037418 | Bacteria | 6311 |
| 480 | Ga0395900_0027143 | 3300037418 | Bacteria | 5862 |
| 481 | Ga0395900_0099655 | 3300037418 | Bacteria | 2984 |
| 482 | Ga0395898_0003999 | 3300037466 | Bacteria | 16224 |
| 483 | Ga0395898_0045114 | 3300037466 | Bacteria | 4334 |
| 484 | Ga0395898_0150420 | 3300037466 | Bacteria | 2228 |
| 485 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 486 | Ga0395905_0000411 | 3300037471 | Bacteria | 60254 |
| 487 | Ga0395905_0029207 | 3300037471 | Bacteria | 5196 |
| 488 | Ga0395905_0157834 | 3300037471 | Bacteria | 2133 |
| 489 | Ga0395901_0158625 | 3300038443 | Bacteria | 2376 |
| 490 | Ga0436361_1111083 | 3300039447 | Bacteria | 43355 |
| 491 | Ga0439448_0004770 | 3300042005 | Bacteria | 3838 |
| 492 | Ga0451577_0022119 | 3300042876 | Bacteria | 5808 |
| 493 | Ga0451577_0110484 | 3300042876 | Bacteria | 2459 |
| 494 | Ga0466969_0159152 | 3300044656 | Bacteria | 1038 |
| 495 | Ga0453683_0070290 | 3300044673 | Bacteria | 2189 |
| 496 | Ga0466966_0062890 | 3300044684 | Bacteria | 2339 |
| 497 | Ga0453684_0000666 | 3300044712 | Bacteria | 122914 |
| 498 | Ga0453684_0002068 | 3300044712 | Bacteria | 51026 |
| 499 | Ga0453684_0006469 | 3300044712 | Bacteria | 22230 |
| 500 | Ga0453684_0247057 | 3300044712 | Bacteria | 2051 |
| 501 | Ga0453684_0287358 | 3300044712 | Bacteria | 1874 |
| 502 | Ga0453684_0614054 | 3300044712 | Bacteria | 1190 |
| 503 | Ga0466970_0207038 | 3300044765 | Bacteria | 1092 |
| 504 | Ga0466959_0000904 | 3300045049 | Bacteria | 17527 |
| 505 | Ga0466959_0109921 | 3300045049 | Bacteria | 1968 |
| 506 | Ga0451576_0073698 | 3300045051 | Bacteria | 3553 |
| 507 | Ga0451576_0079289 | 3300045051 | Bacteria | 3417 |
| 508 | Ga0451576_0158335 | 3300045051 | Bacteria | 2363 |
| 509 | Ga0451576_0159041 | 3300045051 | Bacteria | 2357 |
| 510 | Ga0451576_0173520 | 3300045051 | Bacteria | 2251 |
| 511 | Ga0451576_0184209 | 3300045051 | Bacteria | 2180 |
| 512 | Ga0495627_006048 | 3300046453 | Bacteria | 4789 |
| 513 | Ga0495592_0001478 | 3300046454 | Bacteria | 16346 |
| 514 | Ga0495629_0177805 | 3300046459 | Bacteria | 1475 |
| 515 | Ga0495641_0041411 | 3300046461 | Bacteria | 2140 |
| 516 | Ga0495641_0086817 | 3300046461 | Bacteria | 1400 |
| 517 | Ga0495651_0064117 | 3300046462 | Bacteria | 2808 |
| 518 | Ga0495651_0138642 | 3300046462 | Bacteria | 1767 |
| 519 | Ga0495651_0193513 | 3300046462 | Bacteria | 1429 |
| 520 | Ga0495650_0000095 | 3300046471 | Bacteria | 218020 |
| 521 | Ga0495650_0042565 | 3300046471 | Bacteria | 1933 |
| 522 | Ga0495582_0005670 | 3300046473 | Bacteria | 6951 |
| 523 | Ga0495582_0046260 | 3300046473 | Bacteria | 2397 |
| 524 | Ga0495639_0011879 | 3300046475 | Bacteria | 3755 |
| 525 | Ga0495662_0014709 | 3300046476 | Bacteria | 3804 |
| 526 | Ga0495662_0034371 | 3300046476 | Bacteria | 2447 |
| 527 | Ga0495664_0020589 | 3300046477 | Bacteria | 3805 |
| 528 | Ga0495585_0000034 | 3300046492 | Bacteria | 143120 |
| 529 | Ga0495585_0000313 | 3300046492 | Bacteria | 48193 |
| 530 | Ga0495594_0135453 | 3300046499 | Bacteria | 1396 |
| 531 | Ga0495596_0008189 | 3300046500 | Bacteria | 4665 |
| 532 | Ga0495583_0012709 | 3300046506 | Bacteria | 4743 |
| 533 | Ga0495606_0000009 | 3300046507 | Bacteria | 306313 |
| 534 | Ga0495606_0003788 | 3300046507 | Bacteria | 15717 |
| 535 | Ga0495606_0005118 | 3300046507 | Bacteria | 12730 |
| 536 | Ga0495606_0053385 | 3300046507 | Bacteria | 2623 |
| 537 | Ga0495610_0000084 | 3300046512 | Bacteria | 112459 |
| 538 | Ga0495610_0000284 | 3300046512 | Bacteria | 52953 |
| 539 | Ga0495610_0010992 | 3300046512 | Bacteria | 5571 |
| 540 | Ga0495616_0007971 | 3300046513 | Bacteria | 6314 |
| 541 | Ga0495618_0003873 | 3300046514 | Bacteria | 9247 |
| 542 | Ga0495618_0005940 | 3300046514 | Bacteria | 7417 |
| 543 | Ga0495618_0136909 | 3300046514 | Bacteria | 1566 |
| 544 | Ga0495618_0174558 | 3300046514 | Bacteria | 1367 |
| 545 | Ga0495628_0000259 | 3300046516 | Bacteria | 47040 |
| 546 | Ga0495628_0139483 | 3300046516 | Bacteria | 1851 |
| 547 | Ga0495630_0000022 | 3300046517 | Bacteria | 172932 |
| 548 | Ga0495630_0003017 | 3300046517 | Bacteria | 11675 |
| 549 | Ga0495632_0068031 | 3300046519 | Bacteria | 1717 |
| 550 | Ga0495637_0008889 | 3300046520 | Bacteria | 4916 |
| 551 | Ga0495648_0028569 | 3300046524 | Bacteria | 3713 |
| 552 | Ga0495648_0041493 | 3300046524 | Bacteria | 2905 |
| 553 | Ga0495666_0006800 | 3300046526 | Bacteria | 5742 |
| 554 | Ga0495666_0027801 | 3300046526 | Bacteria | 2784 |
| 555 | Ga0495652_0060960 | 3300046529 | Bacteria | 3186 |
| 556 | Ga0495652_0210706 | 3300046529 | Bacteria | 1467 |
| 557 | Ga0495665_0084701 | 3300046531 | Bacteria | 1666 |
| 558 | Ga0495640_0038668 | 3300046533 | Bacteria | 3355 |
| 559 | Ga0495640_0139665 | 3300046533 | Bacteria | 1562 |
| 560 | Ga0495586_0000010 | 3300046535 | Bacteria | 143135 |
| 561 | Ga0495586_0002456 | 3300046535 | Bacteria | 10060 |
| 562 | Ga0495586_0003939 | 3300046535 | Bacteria | 7969 |
| 563 | Ga0495586_0010549 | 3300046535 | Bacteria | 4915 |
| 564 | Ga0495586_0117779 | 3300046535 | Bacteria | 1482 |
| 565 | Ga0495609_0004648 | 3300046538 | Bacteria | 7452 |
| 566 | Ga0495609_0034905 | 3300046538 | Bacteria | 2278 |
| 567 | Ga0495645_0009644 | 3300046543 | Bacteria | 6752 |
| 568 | Ga0495645_0094963 | 3300046543 | Bacteria | 2126 |
| 569 | Ga0495622_0060332 | 3300046557 | Bacteria | 1756 |
| 570 | Ga0495633_0000074 | 3300046558 | Bacteria | 130197 |
| 571 | Ga0495633_0002697 | 3300046558 | Bacteria | 12319 |
| 572 | Ga0495667_0087243 | 3300046559 | Bacteria | 2024 |
| 573 | Ga0495667_0126703 | 3300046559 | Bacteria | 1647 |
| 574 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 575 | Ga0495634_0012813 | 3300046642 | Bacteria | 6069 |
| 576 | Ga0495634_0019154 | 3300046642 | Bacteria | 4864 |
| 577 | Ga0495634_0033495 | 3300046642 | Bacteria | 3530 |
| 578 | Ga0495634_0256227 | 3300046642 | Bacteria | 1069 |
| 579 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 580 | Ga0495625_0000679 | 3300046660 | Bacteria | 48394 |
| 581 | Ga0495625_0006979 | 3300046660 | Bacteria | 9959 |
| 582 | Ga0495625_0016119 | 3300046660 | Bacteria | 5888 |
| 583 | Ga0495625_0063646 | 3300046660 | Bacteria | 2604 |
| 584 | Ga0495661_0002451 | 3300046665 | Bacteria | 14291 |
| 585 | Ga0495661_0026532 | 3300046665 | Bacteria | 3730 |
| 586 | Ga0495661_0034563 | 3300046665 | Bacteria | 3179 |
| 587 | Ga0495657_0104589 | 3300046675 | Bacteria | 1800 |
| 588 | Ga0495599_0009937 | 3300046678 | Bacteria | 5824 |
| 589 | Ga0495599_0031489 | 3300046678 | Bacteria | 3329 |
| 590 | Ga0495647_0032145 | 3300046681 | Bacteria | 1954 |
| 591 | Ga0495658_0002493 | 3300046683 | Bacteria | 9260 |
| 592 | Ga0495658_0086069 | 3300046683 | Bacteria | 1854 |
| 593 | Ga0495613_0001553 | 3300046689 | Bacteria | 17447 |
| 594 | Ga0495613_0026757 | 3300046689 | Bacteria | 4296 |
| 595 | Ga0495613_0086794 | 3300046689 | Bacteria | 2268 |
| 596 | Ga0495624_0015060 | 3300046690 | Bacteria | 5235 |
| 597 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 598 | Ga0495589_0058180 | 3300046794 | Bacteria | 1901 |
| 599 | Ga0495660_0003408 | 3300046810 | Bacteria | 9840 |
| 600 | Ga0495674_0002044 | 3300047319 | Bacteria | 19794 |
| 601 | Ga0495674_0043964 | 3300047319 | Bacteria | 3972 |
| 602 | Ga0495674_0112958 | 3300047319 | Bacteria | 2301 |
| 603 | Ga0495676_0002247 | 3300047321 | Bacteria | 17137 |
| 604 | Ga0495680_0007636 | 3300047322 | Bacteria | 9874 |
| 605 | Ga0495680_0103084 | 3300047322 | Bacteria | 2124 |
| 606 | Ga0495683_0038745 | 3300047323 | Bacteria | 2412 |
| 607 | Ga0495687_000713 | 3300047443 | Bacteria | 36805 |
| 608 | Ga0495687_000846 | 3300047443 | Bacteria | 32608 |
| 609 | Ga0495687_063602 | 3300047443 | Bacteria | 1510 |
| 610 | Ga0495677_0012175 | 3300047445 | Bacteria | 3139 |
| 611 | Ga0495679_018985 | 3300047446 | Bacteria | 2426 |
| 612 | Ga0495681_0024609 | 3300047470 | Bacteria | 3166 |
| 613 | Ga0495684_0083088 | 3300047471 | Bacteria | 2429 |
| 614 | Ga0495686_0000614 | 3300047472 | Bacteria | 49242 |
| 615 | Ga0495686_0001530 | 3300047472 | Bacteria | 24840 |
| 616 | Ga0495686_0011382 | 3300047472 | Bacteria | 6271 |
| 617 | Ga0495686_0017078 | 3300047472 | Bacteria | 4900 |
| 618 | Ga0495686_0046647 | 3300047472 | Bacteria | 2738 |
| 619 | Ga0495686_0101303 | 3300047472 | Bacteria | 1737 |
| 620 | Ga0495686_0122018 | 3300047472 | Bacteria | 1552 |
| 621 | Ga0495614_0014793 | 3300048089 | Bacteria | 3413 |
| 622 | Ga0496107_0118359 | 3300048910 | Bacteria | 1950 |
| 623 | Ga0496115_0017883 | 3300048918 | Bacteria | 5430 |
| 624 | Ga0496117_0000995 | 3300048920 | Bacteria | 43366 |
| 625 | Ga0496118_0012921 | 3300048921 | Bacteria | 7952 |
| 626 | Ga0496122_0000783 | 3300048925 | Bacteria | 61156 |
| 627 | Ga0496123_0002343 | 3300048926 | Bacteria | 23754 |
| 628 | Ga0496123_0016507 | 3300048926 | Bacteria | 5993 |
| 629 | Ga0495678_016616 | 3300049459 | Bacteria | 3360 |
| 630 | Ga0501031_0000004 | 3300049568 | Bacteria | 202781 |
| 631 | Ga0501031_0000943 | 3300049568 | Bacteria | 17580 |
| 632 | Ga0501032_0006393 | 3300049569 | Bacteria | 8672 |
| 633 | Ga0501033_0009792 | 3300049570 | Bacteria | 7360 |
| 634 | Ga0501033_0011702 | 3300049570 | Bacteria | 6709 |
| 635 | Ga0501033_0015555 | 3300049570 | Bacteria | 5770 |
| 636 | Ga0501033_0046578 | 3300049570 | Bacteria | 3224 |
| 637 | Ga0501223_001133 | 3300049663 | Bacteria | 6275 |
| 638 | Ga0501249_013449 | 3300049679 | Bacteria | 1739 |
| 639 | Ga0501083_0091383 | 3300049744 | Bacteria | 2010 |
| 640 | Ga0501044_0000129 | 3300049823 | Bacteria | 92557 |
| 641 | Ga0501044_0001072 | 3300049823 | Bacteria | 32802 |
| 642 | nmdc:mga0k408_3924_c1 | 3300050493 | Bacteria | 7887 |
| 643 | nmdc:mga0k408_397_c1 | 3300050493 | Bacteria | 23845 |
| 644 | nmdc:mga07m45_104785_c1 | 3300050496 | Bacteria | 1626 |
| 645 | nmdc:mga06r32_186339_c1 | 3300050510 | Bacteria | 2062 |
| 646 | nmdc:mga06r32_285072_c1 | 3300050510 | Bacteria | 1638 |
| 647 | nmdc:mga08y16_195371_c1 | 3300050511 | Bacteria | 2097 |
| 648 | nmdc:mga08y16_2114_c1 | 3300050511 | Bacteria | 20363 |
| 649 | nmdc:mga0n895_122730_c1 | 3300050512 | Bacteria | 2619 |
| 650 | nmdc:mga0n895_155341_c1 | 3300050512 | Bacteria | 2318 |
| 651 | Ga0500635_0006761 | 3300053080 | Bacteria | 3077 |
| 652 | Ga0500651_0000951 | 3300053093 | Bacteria | 14237 |
| 653 | Ga0500650_0000633 | 3300053098 | Bacteria | 9230 |
| 654 | Ga0500608_000220 | 3300053122 | Bacteria | 22523 |
| 655 | Ga0500608_002387 | 3300053122 | Bacteria | 6825 |
| 656 | Ga0500614_009600 | 3300053123 | Bacteria | 2065 |
| 657 | Ga0500618_000011 | 3300053125 | Bacteria | 198091 |
| 658 | Ga0500642_0012313 | 3300053130 | Bacteria | 3097 |
| 659 | Ga0500622_0003794 | 3300053156 | Bacteria | 9841 |
| 660 | Ga0500624_000183 | 3300053157 | Bacteria | 24891 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025960 | Ga0207651_10561718 | Ga0207651_105617181 | 292 |
| 2 | 3300002067 | JGI24735J21928_10013453 | JGI24735J21928_100134531 | 303 |
| 3 | 3300044712 | Ga0453684_0000666 | Ga0453684_0000666_33175_34098 | 307 |
| 4 | 3300035410 | Ga0373924_0097339 | Ga0373924_0097339_192_1151 | 311 |
| 5 | 3300013308 | Ga0157375_10000111 | Ga0157375_100001113 | 312 |
| 6 | 3300028556 | Ga0265337_1029255 | Ga0265337_10292552 | 312 |
| 7 | 3300029957 | Ga0265324_10001805 | Ga0265324_100018052 | 312 |
| 8 | 3300031344 | Ga0265316_10138974 | Ga0265316_101389742 | 312 |
| 9 | 3300036401 | Ga0373937_0223162 | Ga0373937_0223162_235_1197 | 312 |
| 10 | 3300037068 | Ga0373925_0146157 | Ga0373925_0146157_720_1682 | 312 |
| 11 | 3300044712 | Ga0453684_0614054 | Ga0453684_0614054_214_1152 | 312 |
| 12 | 3300045051 | Ga0451576_0173520 | Ga0451576_0173520_1244_2218 | 312 |
| 13 | 3300046462 | Ga0495651_0064117 | Ga0495651_0064117_201_1163 | 312 |
| 14 | 3300046475 | Ga0495639_0011879 | Ga0495639_0011879_12_986 | 312 |
| 15 | 3300028800 | Ga0265338_10000510 | Ga0265338_1000051016 | 313 |
| 16 | 3300028800 | Ga0265338_10140858 | Ga0265338_101408581 | 313 |
| 17 | 3300031247 | Ga0265340_10006637 | Ga0265340_100066371 | 313 |
| 18 | 3300046543 | Ga0495645_0094963 | Ga0495645_0094963_52_1017 | 313 |
| 19 | 3300046689 | Ga0495613_0086794 | Ga0495613_0086794_1260_2225 | 313 |
| 20 | 3300005563 | Ga0068855_100378355 | Ga0068855_1003783552 | 314 |
| 21 | 3300025949 | Ga0207667_10100335 | Ga0207667_101003353 | 314 |
| 22 | 3300028556 | Ga0265337_1004220 | Ga0265337_10042201 | 314 |
| 23 | 3300028573 | Ga0265334_10012854 | Ga0265334_100128541 | 314 |
| 24 | 3300028666 | Ga0265336_10044228 | Ga0265336_100442282 | 314 |
| 25 | 3300028800 | Ga0265338_10000111 | Ga0265338_1000011140 | 314 |
| 26 | 3300028800 | Ga0265338_10124118 | Ga0265338_101241182 | 314 |
| 27 | 3300029957 | Ga0265324_10001661 | Ga0265324_100016617 | 314 |
| 28 | 3300053098 | Ga0500650_0000633 | Ga0500650_0000633_5376_6356 | 314 |
| 29 | 3300045051 | Ga0451576_0159041 | Ga0451576_0159041_1355_2338 | 315 |
| 30 | 3300025909 | Ga0207705_10086874 | Ga0207705_100868743 | 318 |
| 31 | 3300044656 | Ga0466969_0159152 | Ga0466969_0159152_26_982 | 318 |
| 32 | 3300045051 | Ga0451576_0184209 | Ga0451576_0184209_151_1155 | 318 |
| 33 | 3300046665 | Ga0495661_0026532 | Ga0495661_0026532_2759_3715 | 318 |
| 34 | 3300005616 | Ga0068852_100016582 | Ga0068852_1000165826 | 319 |
| 35 | 3300014325 | Ga0163163_10000020 | Ga0163163_10000020125 | 319 |
| 36 | 3300005340 | Ga0070689_100052373 | Ga0070689_1000523733 | 320 |
| 37 | 3300042876 | Ga0451577_0022119 | Ga0451577_0022119_713_1699 | 320 |
| 38 | 3300044673 | Ga0453683_0070290 | Ga0453683_0070290_728_1690 | 320 |
| 39 | 3300044712 | Ga0453684_0002068 | Ga0453684_0002068_43191_44177 | 320 |
| 40 | 3300046642 | Ga0495634_0256227 | Ga0495634_0256227_40_1056 | 320 |
| 41 | 3300031251 | Ga0265327_10003147 | Ga0265327_1000314712 | 321 |
| 42 | 3300042876 | Ga0451577_0110484 | Ga0451577_0110484_1243_2274 | 321 |
| 43 | 3300044712 | Ga0453684_0247057 | Ga0453684_0247057_478_1509 | 321 |
| 44 | 3300046462 | Ga0495651_0138642 | Ga0495651_0138642_473_1477 | 321 |
| 45 | 3300048910 | Ga0496107_0118359 | Ga0496107_0118359_265_1269 | 321 |
| 46 | 3300028573 | Ga0265334_10054499 | Ga0265334_100544991 | 322 |
| 47 | 3300031712 | Ga0265342_10072777 | Ga0265342_100727772 | 322 |
| 48 | 3300032004 | Ga0307414_10023579 | Ga0307414_100235791 | 322 |
| 49 | 3300005340 | Ga0070689_100002402 | Ga0070689_1000024026 | 323 |
| 50 | 3300005343 | Ga0070687_100026314 | Ga0070687_1000263142 | 323 |
| 51 | 3300005438 | Ga0070701_10107227 | Ga0070701_101072272 | 323 |
| 52 | 3300005444 | Ga0070694_100141549 | Ga0070694_1001415492 | 323 |
| 53 | 3300005458 | Ga0070681_10184017 | Ga0070681_101840172 | 323 |
| 54 | 3300005539 | Ga0068853_100067797 | Ga0068853_1000677972 | 323 |
| 55 | 3300005549 | Ga0070704_100012892 | Ga0070704_1000128923 | 323 |
| 56 | 3300005563 | Ga0068855_100074415 | Ga0068855_1000744153 | 323 |
| 57 | 3300005617 | Ga0068859_100130718 | Ga0068859_1001307181 | 323 |
| 58 | 3300006880 | Ga0075429_100044531 | Ga0075429_1000445313 | 323 |
| 59 | 3300006931 | Ga0097620_100130717 | Ga0097620_1001307171 | 323 |
| 60 | 3300009094 | Ga0111539_10115364 | Ga0111539_101153644 | 323 |
| 61 | 3300009551 | Ga0105238_10042318 | Ga0105238_100423185 | 323 |
| 62 | 3300013104 | Ga0157370_10080937 | Ga0157370_100809373 | 323 |
| 63 | 3300014968 | Ga0157379_10303909 | Ga0157379_103039091 | 323 |
| 64 | 3300025910 | Ga0207684_10340196 | Ga0207684_103401961 | 323 |
| 65 | 3300025912 | Ga0207707_10010673 | Ga0207707_100106732 | 323 |
| 66 | 3300025924 | Ga0207694_10087138 | Ga0207694_100871383 | 323 |
| 67 | 3300025949 | Ga0207667_10171493 | Ga0207667_101714932 | 323 |
| 68 | 3300025960 | Ga0207651_10530990 | Ga0207651_105309901 | 323 |
| 69 | 3300026078 | Ga0207702_10027834 | Ga0207702_100278342 | 323 |
| 70 | 3300037068 | Ga0373925_0003683 | Ga0373925_0003683_4371_5390 | 323 |
| 71 | 3300049568 | Ga0501031_0000943 | Ga0501031_0000943_12085_13110 | 323 |
| 72 | 3300049570 | Ga0501033_0011702 | Ga0501033_0011702_669_1694 | 323 |
| 73 | 3300049744 | Ga0501083_0091383 | Ga0501083_0091383_891_1889 | 323 |
| 74 | 3300049823 | Ga0501044_0000129 | Ga0501044_0000129_54882_55907 | 323 |
| 75 | 3300005544 | Ga0070686_100026851 | Ga0070686_1000268512 | 324 |
| 76 | 3300005577 | Ga0068857_100004246 | Ga0068857_1000042465 | 324 |
| 77 | 3300006847 | Ga0075431_100171401 | Ga0075431_1001714012 | 324 |
| 78 | 3300009093 | Ga0105240_10000872 | Ga0105240_1000087219 | 324 |
| 79 | 3300009093 | Ga0105240_10423339 | Ga0105240_104233391 | 324 |
| 80 | 3300009094 | Ga0111539_10002005 | Ga0111539_1000200518 | 324 |
| 81 | 3300009094 | Ga0111539_10090431 | Ga0111539_100904312 | 324 |
| 82 | 3300009094 | Ga0111539_10466816 | Ga0111539_104668162 | 324 |
| 83 | 3300009545 | Ga0105237_10400352 | Ga0105237_104003521 | 324 |
| 84 | 3300013104 | Ga0157370_10108413 | Ga0157370_101084132 | 324 |
| 85 | 3300013307 | Ga0157372_10069770 | Ga0157372_100697704 | 324 |
| 86 | 3300014325 | Ga0163163_10102041 | Ga0163163_101020413 | 324 |
| 87 | 3300014325 | Ga0163163_10316019 | Ga0163163_103160192 | 324 |
| 88 | 3300025913 | Ga0207695_10020975 | Ga0207695_100209754 | 324 |
| 89 | 3300025944 | Ga0207661_10202003 | Ga0207661_102020031 | 324 |
| 90 | 3300026116 | Ga0207674_10003864 | Ga0207674_100038646 | 324 |
| 91 | 3300027907 | Ga0207428_10092014 | Ga0207428_100920143 | 324 |
| 92 | 3300028653 | Ga0265323_10012987 | Ga0265323_100129873 | 324 |
| 93 | 3300028800 | Ga0265338_10000016 | Ga0265338_10000016217 | 324 |
| 94 | 3300028800 | Ga0265338_10007043 | Ga0265338_1000704312 | 324 |
| 95 | 3300028800 | Ga0265338_10038589 | Ga0265338_100385892 | 324 |
| 96 | 3300028800 | Ga0265338_10050076 | Ga0265338_100500762 | 324 |
| 97 | 3300029957 | Ga0265324_10002570 | Ga0265324_100025708 | 324 |
| 98 | 3300031344 | Ga0265316_10055751 | Ga0265316_100557511 | 324 |
| 99 | 3300031711 | Ga0265314_10000088 | Ga0265314_1000008857 | 324 |
| 100 | 3300031911 | Ga0307412_10074025 | Ga0307412_100740252 | 324 |
| 101 | 3300044712 | Ga0453684_0006469 | Ga0453684_0006469_20325_21347 | 324 |
| 102 | 3300045051 | Ga0451576_0158335 | Ga0451576_0158335_366_1388 | 324 |
| 103 | 3300046461 | Ga0495641_0086817 | Ga0495641_0086817_25_1047 | 324 |
| 104 | 3300046462 | Ga0495651_0193513 | Ga0495651_0193513_249_1271 | 324 |
| 105 | 3300046473 | Ga0495582_0005670 | Ga0495582_0005670_2761_3783 | 324 |
| 106 | 3300046476 | Ga0495662_0014709 | Ga0495662_0014709_1296_2318 | 324 |
| 107 | 3300046499 | Ga0495594_0135453 | Ga0495594_0135453_16_1038 | 324 |
| 108 | 3300046514 | Ga0495618_0136909 | Ga0495618_0136909_27_1049 | 324 |
| 109 | 3300046516 | Ga0495628_0139483 | Ga0495628_0139483_800_1798 | 324 |
| 110 | 3300046517 | Ga0495630_0000022 | Ga0495630_0000022_104791_105813 | 324 |
| 111 | 3300046526 | Ga0495666_0006800 | Ga0495666_0006800_4344_5366 | 324 |
| 112 | 3300046529 | Ga0495652_0210706 | Ga0495652_0210706_162_1184 | 324 |
| 113 | 3300046531 | Ga0495665_0084701 | Ga0495665_0084701_448_1470 | 324 |
| 114 | 3300046535 | Ga0495586_0000010 | Ga0495586_0000010_66392_67414 | 324 |
| 115 | 3300046642 | Ga0495634_0012813 | Ga0495634_0012813_3393_4415 | 324 |
| 116 | 3300046642 | Ga0495634_0033495 | Ga0495634_0033495_1414_2436 | 324 |
| 117 | 3300046678 | Ga0495599_0031489 | Ga0495599_0031489_1536_2558 | 324 |
| 118 | 3300046681 | Ga0495647_0032145 | Ga0495647_0032145_843_1865 | 324 |
| 119 | 3300046689 | Ga0495613_0026757 | Ga0495613_0026757_1198_2220 | 324 |
| 120 | 3300047319 | Ga0495674_0002044 | Ga0495674_0002044_842_1864 | 324 |
| 121 | 3300047319 | Ga0495674_0043964 | Ga0495674_0043964_2097_3119 | 324 |
| 122 | 3300047321 | Ga0495676_0002247 | Ga0495676_0002247_1615_2637 | 324 |
| 123 | 3300050510 | nmdc:mga06r32_285072_c1 | nmdc:mga06r32_285072_c1_215_1216 | 324 |
| 124 | 3300050511 | nmdc:mga08y16_195371_c1 | nmdc:mga08y16_195371_c1_992_1993 | 324 |
| 125 | 3300050511 | nmdc:mga08y16_2114_c1 | nmdc:mga08y16_2114_c1_7282_8283 | 324 |
| 126 | 3300003320 | rootH2_10055718 | rootH2_100557181 | 325 |
| 127 | 3300003323 | rootH1_10066500 | rootH1_100665007 | 325 |
| 128 | 3300005327 | Ga0070658_10094307 | Ga0070658_100943071 | 325 |
| 129 | 3300005340 | Ga0070689_100023414 | Ga0070689_1000234142 | 325 |
| 130 | 3300005435 | Ga0070714_100007178 | Ga0070714_1000071787 | 325 |
| 131 | 3300005458 | Ga0070681_10033602 | Ga0070681_100336024 | 325 |
| 132 | 3300005563 | Ga0068855_100029065 | Ga0068855_1000290655 | 325 |
| 133 | 3300005841 | Ga0068863_100243144 | Ga0068863_1002431443 | 325 |
| 134 | 3300006237 | Ga0097621_100054503 | Ga0097621_1000545034 | 325 |
| 135 | 3300006358 | Ga0068871_100168833 | Ga0068871_1001688332 | 325 |
| 136 | 3300006871 | Ga0075434_100178372 | Ga0075434_1001783723 | 325 |
| 137 | 3300009093 | Ga0105240_10026212 | Ga0105240_100262125 | 325 |
| 138 | 3300009174 | Ga0105241_10229382 | Ga0105241_102293822 | 325 |
| 139 | 3300009545 | Ga0105237_10009180 | Ga0105237_100091809 | 325 |
| 140 | 3300013104 | Ga0157370_10122274 | Ga0157370_101222742 | 325 |
| 141 | 3300013307 | Ga0157372_10003224 | Ga0157372_100032249 | 325 |
| 142 | 3300013308 | Ga0157375_10371713 | Ga0157375_103717131 | 325 |
| 143 | 3300025904 | Ga0207647_10032159 | Ga0207647_100321593 | 325 |
| 144 | 3300025912 | Ga0207707_10027491 | Ga0207707_100274912 | 325 |
| 145 | 3300025913 | Ga0207695_10079432 | Ga0207695_100794323 | 325 |
| 146 | 3300025914 | Ga0207671_10008901 | Ga0207671_100089013 | 325 |
| 147 | 3300025919 | Ga0207657_10099972 | Ga0207657_100999722 | 325 |
| 148 | 3300025921 | Ga0207652_10000187 | Ga0207652_1000018764 | 325 |
| 149 | 3300025929 | Ga0207664_10007731 | Ga0207664_100077315 | 325 |
| 150 | 3300025949 | Ga0207667_10000492 | Ga0207667_1000049233 | 325 |
| 151 | 3300026088 | Ga0207641_10347349 | Ga0207641_103473491 | 325 |
| 152 | 3300028556 | Ga0265337_1018602 | Ga0265337_10186021 | 325 |
| 153 | 3300028666 | Ga0265336_10005438 | Ga0265336_100054382 | 325 |
| 154 | 3300028800 | Ga0265338_10003109 | Ga0265338_100031098 | 325 |
| 155 | 3300028800 | Ga0265338_10005161 | Ga0265338_100051614 | 325 |
| 156 | 3300028800 | Ga0265338_10037030 | Ga0265338_100370303 | 325 |
| 157 | 3300031240 | Ga0265320_10056739 | Ga0265320_100567392 | 325 |
| 158 | 3300031344 | Ga0265316_10008622 | Ga0265316_100086229 | 325 |
| 159 | 3300031344 | Ga0265316_10033857 | Ga0265316_100338573 | 325 |
| 160 | 3300035725 | Ga0373947_0169275 | Ga0373947_0169275_193_1227 | 325 |
| 161 | 3300037068 | Ga0373925_0072241 | Ga0373925_0072241_1042_2067 | 325 |
| 162 | 3300037418 | Ga0395900_0027143 | Ga0395900_0027143_2788_3798 | 325 |
| 163 | 3300037418 | Ga0395900_0099655 | Ga0395900_0099655_1162_2172 | 325 |
| 164 | 3300037466 | Ga0395898_0003999 | Ga0395898_0003999_9786_10796 | 325 |
| 165 | 3300044712 | Ga0453684_0287358 | Ga0453684_0287358_292_1320 | 325 |
| 166 | 3300045051 | Ga0451576_0073698 | Ga0451576_0073698_115_1143 | 325 |
| 167 | 3300045051 | Ga0451576_0079289 | Ga0451576_0079289_2282_3307 | 325 |
| 168 | 3300046461 | Ga0495641_0041411 | Ga0495641_0041411_315_1340 | 325 |
| 169 | 3300046473 | Ga0495582_0046260 | Ga0495582_0046260_446_1471 | 325 |
| 170 | 3300046535 | Ga0495586_0002456 | Ga0495586_0002456_3913_4938 | 325 |
| 171 | 3300046683 | Ga0495658_0002493 | Ga0495658_0002493_3494_4519 | 325 |
| 172 | 3300047471 | Ga0495684_0083088 | Ga0495684_0083088_1393_2418 | 325 |
| 173 | 3300049570 | Ga0501033_0015555 | Ga0501033_0015555_245_1270 | 325 |
| 174 | 3300050512 | nmdc:mga0n895_122730_c1 | nmdc:mga0n895_122730_c1_414_1439 | 325 |
| 175 | 3300053125 | Ga0500618_000011 | Ga0500618_000011_80124_81116 | 325 |
| 176 | 3300005330 | Ga0070690_100255051 | Ga0070690_1002550511 | 326 |
| 177 | 3300005340 | Ga0070689_100003633 | Ga0070689_1000036332 | 326 |
| 178 | 3300005439 | Ga0070711_100005204 | Ga0070711_1000052045 | 326 |
| 179 | 3300005563 | Ga0068855_100424675 | Ga0068855_1004246751 | 326 |
| 180 | 3300005614 | Ga0068856_100000067 | Ga0068856_10000006739 | 326 |
| 181 | 3300005614 | Ga0068856_100015211 | Ga0068856_1000152115 | 326 |
| 182 | 3300005614 | Ga0068856_100366229 | Ga0068856_1003662292 | 326 |
| 183 | 3300005617 | Ga0068859_100259507 | Ga0068859_1002595072 | 326 |
| 184 | 3300005841 | Ga0068863_100344341 | Ga0068863_1003443412 | 326 |
| 185 | 3300006871 | Ga0075434_100136277 | Ga0075434_1001362772 | 326 |
| 186 | 3300006931 | Ga0097620_100259520 | Ga0097620_1002595202 | 326 |
| 187 | 3300009094 | Ga0111539_10097277 | Ga0111539_100972776 | 326 |
| 188 | 3300009551 | Ga0105238_10034231 | Ga0105238_100342313 | 326 |
| 189 | 3300009551 | Ga0105238_10052272 | Ga0105238_100522722 | 326 |
| 190 | 3300025916 | Ga0207663_10009269 | Ga0207663_100092694 | 326 |
| 191 | 3300025924 | Ga0207694_10018133 | Ga0207694_100181333 | 326 |
| 192 | 3300025936 | Ga0207670_10001839 | Ga0207670_100018392 | 326 |
| 193 | 3300026078 | Ga0207702_10001092 | Ga0207702_100010926 | 326 |
| 194 | 3300026078 | Ga0207702_10045049 | Ga0207702_100450495 | 326 |
| 195 | 3300026088 | Ga0207641_10104832 | Ga0207641_101048322 | 326 |
| 196 | 3300028556 | Ga0265337_1001468 | Ga0265337_10014682 | 326 |
| 197 | 3300028563 | Ga0265319_1012654 | Ga0265319_10126544 | 326 |
| 198 | 3300028653 | Ga0265323_10025579 | Ga0265323_100255792 | 326 |
| 199 | 3300028800 | Ga0265338_10000382 | Ga0265338_1000038230 | 326 |
| 200 | 3300028800 | Ga0265338_10003369 | Ga0265338_100033692 | 326 |
| 201 | 3300028800 | Ga0265338_10003690 | Ga0265338_100036902 | 326 |
| 202 | 3300028800 | Ga0265338_10018926 | Ga0265338_100189266 | 326 |
| 203 | 3300028800 | Ga0265338_10040143 | Ga0265338_100401433 | 326 |
| 204 | 3300028800 | Ga0265338_10153931 | Ga0265338_101539311 | 326 |
| 205 | 3300029957 | Ga0265324_10005257 | Ga0265324_100052574 | 326 |
| 206 | 3300029957 | Ga0265324_10043394 | Ga0265324_100433942 | 326 |
| 207 | 3300031240 | Ga0265320_10000572 | Ga0265320_100005722 | 326 |
| 208 | 3300031240 | Ga0265320_10001941 | Ga0265320_1000194112 | 326 |
| 209 | 3300031240 | Ga0265320_10089068 | Ga0265320_100890682 | 326 |
| 210 | 3300031241 | Ga0265325_10002864 | Ga0265325_100028644 | 326 |
| 211 | 3300031241 | Ga0265325_10047547 | Ga0265325_100475472 | 326 |
| 212 | 3300031242 | Ga0265329_10051913 | Ga0265329_100519132 | 326 |
| 213 | 3300031247 | Ga0265340_10006048 | Ga0265340_100060488 | 326 |
| 214 | 3300031249 | Ga0265339_10021164 | Ga0265339_100211642 | 326 |
| 215 | 3300031250 | Ga0265331_10023224 | Ga0265331_100232242 | 326 |
| 216 | 3300031251 | Ga0265327_10000709 | Ga0265327_100007093 | 326 |
| 217 | 3300031344 | Ga0265316_10006780 | Ga0265316_100067806 | 326 |
| 218 | 3300031344 | Ga0265316_10137515 | Ga0265316_101375152 | 326 |
| 219 | 3300031595 | Ga0265313_10000385 | Ga0265313_1000038510 | 326 |
| 220 | 3300031595 | Ga0265313_10000877 | Ga0265313_1000087725 | 326 |
| 221 | 3300031711 | Ga0265314_10006238 | Ga0265314_100062386 | 326 |
| 222 | 3300031711 | Ga0265314_10056731 | Ga0265314_100567312 | 326 |
| 223 | 3300034818 | Ga0373950_0015370 | Ga0373950_0015370_159_1175 | 326 |
| 224 | 3300035084 | Ga0373928_0000099 | Ga0373928_0000099_5760_6776 | 326 |
| 225 | 3300035085 | Ga0373929_0000255 | Ga0373929_0000255_4214_5230 | 326 |
| 226 | 3300035089 | Ga0373944_0000221 | Ga0373944_0000221_272_1288 | 326 |
| 227 | 3300035091 | Ga0373951_0010052 | Ga0373951_0010052_470_1486 | 326 |
| 228 | 3300035092 | Ga0373952_0021056 | Ga0373952_0021056_224_1240 | 326 |
| 229 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_201881_202897 | 326 |
| 230 | 3300035118 | Ga0373954_0070522 | Ga0373954_0070522_74_1114 | 326 |
| 231 | 3300035242 | Ga0373962_0000025 | Ga0373962_0000025_33634_34650 | 326 |
| 232 | 3300035691 | Ga0373931_0000004 | Ga0373931_0000004_201890_202906 | 326 |
| 233 | 3300035692 | Ga0373935_0190246 | Ga0373935_0190246_179_1195 | 326 |
| 234 | 3300035695 | Ga0373927_0025476 | Ga0373927_0025476_90_1106 | 326 |
| 235 | 3300036401 | Ga0373937_0045011 | Ga0373937_0045011_74_1114 | 326 |
| 236 | 3300037068 | Ga0373925_0002234 | Ga0373925_0002234_10531_11547 | 326 |
| 237 | 3300037068 | Ga0373925_0017992 | Ga0373925_0017992_1533_2549 | 326 |
| 238 | 3300046454 | Ga0495592_0001478 | Ga0495592_0001478_13701_14741 | 326 |
| 239 | 3300046459 | Ga0495629_0177805 | Ga0495629_0177805_135_1175 | 326 |
| 240 | 3300046476 | Ga0495662_0034371 | Ga0495662_0034371_750_1790 | 326 |
| 241 | 3300046477 | Ga0495664_0020589 | Ga0495664_0020589_694_1734 | 326 |
| 242 | 3300046514 | Ga0495618_0003873 | Ga0495618_0003873_2240_3280 | 326 |
| 243 | 3300046514 | Ga0495618_0005940 | Ga0495618_0005940_6175_7215 | 326 |
| 244 | 3300046516 | Ga0495628_0000259 | Ga0495628_0000259_29809_30849 | 326 |
| 245 | 3300046517 | Ga0495630_0003017 | Ga0495630_0003017_8501_9541 | 326 |
| 246 | 3300046526 | Ga0495666_0027801 | Ga0495666_0027801_103_1143 | 326 |
| 247 | 3300046529 | Ga0495652_0060960 | Ga0495652_0060960_501_1541 | 326 |
| 248 | 3300046533 | Ga0495640_0038668 | Ga0495640_0038668_376_1416 | 326 |
| 249 | 3300046533 | Ga0495640_0139665 | Ga0495640_0139665_134_1174 | 326 |
| 250 | 3300046535 | Ga0495586_0003939 | Ga0495586_0003939_2921_3961 | 326 |
| 251 | 3300046535 | Ga0495586_0010549 | Ga0495586_0010549_1971_3011 | 326 |
| 252 | 3300046535 | Ga0495586_0117779 | Ga0495586_0117779_80_1096 | 326 |
| 253 | 3300046543 | Ga0495645_0009644 | Ga0495645_0009644_5678_6718 | 326 |
| 254 | 3300046557 | Ga0495622_0060332 | Ga0495622_0060332_220_1236 | 326 |
| 255 | 3300046559 | Ga0495667_0087243 | Ga0495667_0087243_309_1349 | 326 |
| 256 | 3300046559 | Ga0495667_0126703 | Ga0495667_0126703_189_1205 | 326 |
| 257 | 3300046642 | Ga0495634_0019154 | Ga0495634_0019154_1929_2969 | 326 |
| 258 | 3300046675 | Ga0495657_0104589 | Ga0495657_0104589_711_1751 | 326 |
| 259 | 3300046678 | Ga0495599_0009937 | Ga0495599_0009937_154_1194 | 326 |
| 260 | 3300046683 | Ga0495658_0086069 | Ga0495658_0086069_411_1451 | 326 |
| 261 | 3300046689 | Ga0495613_0001553 | Ga0495613_0001553_6038_7078 | 326 |
| 262 | 3300046690 | Ga0495624_0015060 | Ga0495624_0015060_3679_4719 | 326 |
| 263 | 3300047319 | Ga0495674_0112958 | Ga0495674_0112958_377_1417 | 326 |
| 264 | 3300047322 | Ga0495680_0007636 | Ga0495680_0007636_5938_6978 | 326 |
| 265 | 3300047322 | Ga0495680_0103084 | Ga0495680_0103084_570_1586 | 326 |
| 266 | 3300049568 | Ga0501031_0000004 | Ga0501031_0000004_146454_147470 | 326 |
| 267 | 3300049569 | Ga0501032_0006393 | Ga0501032_0006393_7075_8091 | 326 |
| 268 | 3300049570 | Ga0501033_0009792 | Ga0501033_0009792_4026_5042 | 326 |
| 269 | 3300049570 | Ga0501033_0046578 | Ga0501033_0046578_2103_3119 | 326 |
| 270 | 3300049823 | Ga0501044_0001072 | Ga0501044_0001072_12591_13607 | 326 |
| 271 | 3300050510 | nmdc:mga06r32_186339_c1 | nmdc:mga06r32_186339_c1_242_1282 | 326 |
| 272 | 3300050512 | nmdc:mga0n895_155341_c1 | nmdc:mga0n895_155341_c1_956_1996 | 326 |
| 273 | iso_pu_bacteria | 2599185184 | 2599480804 | 326 |
| 274 | iso_pu_bacteria | 2738541284 | 2738761554 | 326 |
| 275 | iso_pu_bacteria | 2738543023 | 2739302926 | 326 |
| 276 | iso_pu_bacteria | 2775506987 | 2776615810 | 326 |
| 277 | iso_pu_bacteria | 2852623160 | 2852626562 | 326 |
| 278 | iso_pu_bacteria | 2884933994 | 2884934990 | 326 |
| 279 | iso_pu_bacteria | 2902048731 | 2902050563 | 326 |
| 280 | iso_pu_bacteria | 2919437846 | 2919439702 | 326 |
| 281 | iso_pu_bacteria | 2928078545 | 2928081700 | 326 |
| 282 | iso_pu_bacteria | 2928147474 | 2928150271 | 326 |
| 283 | iso_pu_bacteria | 2932082852 | 2932085098 | 326 |
| 284 | iso_pu_bacteria | 2977232053 | 2977234825 | 326 |
| 285 | iso_pu_bacteria | 2842903701 | 2842905093 | 327 |
| 286 | 3300013102 | Ga0157371_10007977 | Ga0157371_100079778 | 328 |
| 287 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_1484503_1485492 | 328 |
| 288 | iso_pu_bacteria | 2585427687 | 2586207171 | 328 |
| 289 | iso_pu_bacteria | 2738541283 | 2738755780 | 328 |
| 290 | iso_pu_bacteria | 2738541302 | 2738852754 | 328 |
| 291 | iso_pu_bacteria | 2739367651 | 2739586679 | 328 |
| 292 | iso_pu_bacteria | 2739367663 | 2739645860 | 328 |
| 293 | iso_pu_bacteria | 2842722452 | 2842727135 | 328 |
| 294 | iso_pu_bacteria | 2842909656 | 2842910863 | 328 |
| 295 | iso_pu_bacteria | 2849281842 | 2849284074 | 328 |
| 296 | iso_pu_bacteria | 2852627209 | 2852628017 | 328 |
| 297 | iso_pu_bacteria | 2857627736 | 2857628048 | 328 |
| 298 | iso_pu_bacteria | 2890737413 | 2890738736 | 328 |
| 299 | iso_pu_bacteria | 2896317667 | 2896320307 | 328 |
| 300 | iso_pu_bacteria | 2896344016 | 2896344839 | 328 |
| 301 | iso_pu_bacteria | 2898713307 | 2898714666 | 328 |
| 302 | iso_pu_bacteria | 2904445276 | 2904449734 | 328 |
| 303 | iso_pu_bacteria | 2919186247 | 2919188375 | 328 |
| 304 | iso_pu_bacteria | 2939664404 | 2939667540 | 328 |
| 305 | iso_pu_bacteria | 2945997725 | 2945998034 | 328 |
| 306 | iso_pu_bacteria | 2954016120 | 2954020495 | 328 |
| 307 | iso_pu_bacteria | 3003233435 | 3003236240 | 328 |
| 308 | 3300009148 | Ga0105243_10000046 | Ga0105243_1000004678 | 329 |
| 309 | 3300025935 | Ga0207709_10000020 | Ga0207709_10000020264 | 329 |
| 310 | 3300030731 | Ga0316177_1191726 | Ga0316177_11917266 | 329 |
| 311 | 3300030732 | Ga0316176_1138145 | Ga0316176_11381451 | 329 |
| 312 | 3300030742 | Ga0316183_1037277 | Ga0316183_103727712 | 329 |
| 313 | 3300030744 | Ga0316181_1123353 | Ga0316181_11233538 | 329 |
| 314 | 3300048920 | Ga0496117_0000995 | Ga0496117_0000995_36317_37312 | 329 |
| 315 | 3300048921 | Ga0496118_0012921 | Ga0496118_0012921_1955_2950 | 329 |
| 316 | 3300048926 | Ga0496123_0016507 | Ga0496123_0016507_1904_2899 | 329 |
| 317 | iso_pu_bacteria | 2721755487 | 2722731254 | 329 |
| 318 | iso_pu_bacteria | 2904780799 | 2904782330 | 329 |
| 319 | iso_pu_bacteria | 2919177583 | 2919178472 | 329 |
| 320 | iso_pu_bacteria | 8055588893 | 8055591461 | 329 |
| 321 | 2162886007 | SwRhRL2b_contig_1075644 | SwRhRL2b_0285.00004780 | 330 |
| 322 | 2162886007 | SwRhRL2b_contig_255488 | SwRhRL2b_0836.00007540 | 330 |
| 323 | 2162886007 | SwRhRL2b_contig_3484740 | SwRhRL2b_0376.00007820 | 330 |
| 324 | 3300001904 | JGI24736J21556_1000770 | JGI24736J21556_10007702 | 330 |
| 325 | 3300001979 | JGI24740J21852_10004111 | JGI24740J21852_100041118 | 330 |
| 326 | 3300001990 | JGI24737J22298_10000017 | JGI24737J22298_1000001715 | 330 |
| 327 | 3300001990 | JGI24737J22298_10005039 | JGI24737J22298_100050393 | 330 |
| 328 | 3300002067 | JGI24735J21928_10000024 | JGI24735J21928_1000002468 | 330 |
| 329 | 3300002737 | JGI25162J39368_1000056 | JGI25162J39368_1000056122 | 330 |
| 330 | 3300002737 | JGI25162J39368_1000620 | JGI25162J39368_100062020 | 330 |
| 331 | 3300002772 | JGI25164J39214_1000942 | JGI25164J39214_10009422 | 330 |
| 332 | 3300002773 | JGI25152J39213_1000337 | JGI25152J39213_10003373 | 330 |
| 333 | 3300002774 | JGI25150J39212_1000006 | JGI25150J39212_1000006101 | 330 |
| 334 | 3300003187 | JGI25151J46595_10000024 | JGI25151J46595_1000002490 | 330 |
| 335 | 3300003214 | JGI25165J46597_1000916 | JGI25165J46597_10009164 | 330 |
| 336 | 3300003215 | JGI25153J46596_10000026 | JGI25153J46596_10000026102 | 330 |
| 337 | 3300003316 | rootH1_10003552 | rootH1_100035522 | 330 |
| 338 | 3300003316 | rootH1_10026676 | rootH1_100266766 | 330 |
| 339 | 3300003320 | rootH2_10000579 | rootH2_10000579117 | 330 |
| 340 | 3300003320 | rootH2_10042766 | rootH2_100427665 | 330 |
| 341 | 3300003320 | rootH2_10244504 | rootH2_102445041 | 330 |
| 342 | 3300003323 | rootH1_10060032 | rootH1_100600325 | 330 |
| 343 | 3300003781 | Ga0055536_1000002 | Ga0055536_1000002196 | 330 |
| 344 | 3300003791 | Ga0055530_10011132 | Ga0055530_100111322 | 330 |
| 345 | 3300004799 | Ga0058863_11436476 | Ga0058863_114364763 | 330 |
| 346 | 3300005288 | Ga0065714_10004217 | Ga0065714_100042171 | 330 |
| 347 | 3300005288 | Ga0065714_10010214 | Ga0065714_100102143 | 330 |
| 348 | 3300005288 | Ga0065714_10064535 | Ga0065714_1006453530 | 330 |
| 349 | 3300005288 | Ga0065714_10069686 | Ga0065714_100696862 | 330 |
| 350 | 3300005288 | Ga0065714_10100080 | Ga0065714_101000802 | 330 |
| 351 | 3300005288 | Ga0065714_10130465 | Ga0065714_101304651 | 330 |
| 352 | 3300005289 | Ga0065704_10000218 | Ga0065704_1000021860 | 330 |
| 353 | 3300005289 | Ga0065704_10077907 | Ga0065704_100779073 | 330 |
| 354 | 3300005289 | Ga0065704_10142975 | Ga0065704_101429751 | 330 |
| 355 | 3300005327 | Ga0070658_10000032 | Ga0070658_10000032115 | 330 |
| 356 | 3300005328 | Ga0070676_10002072 | Ga0070676_100020727 | 330 |
| 357 | 3300005329 | Ga0070683_100067207 | Ga0070683_1000672073 | 330 |
| 358 | 3300005334 | Ga0068869_100008852 | Ga0068869_1000088526 | 330 |
| 359 | 3300005335 | Ga0070666_10000030 | Ga0070666_1000003071 | 330 |
| 360 | 3300005336 | Ga0070680_100006592 | Ga0070680_1000065925 | 330 |
| 361 | 3300005336 | Ga0070680_100365554 | Ga0070680_1003655541 | 330 |
| 362 | 3300005338 | Ga0068868_100035950 | Ga0068868_1000359503 | 330 |
| 363 | 3300005339 | Ga0070660_100023968 | Ga0070660_1000239684 | 330 |
| 364 | 3300005341 | Ga0070691_10139215 | Ga0070691_101392152 | 330 |
| 365 | 3300005355 | Ga0070671_100001424 | Ga0070671_1000014248 | 330 |
| 366 | 3300005364 | Ga0070673_100201153 | Ga0070673_1002011532 | 330 |
| 367 | 3300005366 | Ga0070659_100000412 | Ga0070659_10000041225 | 330 |
| 368 | 3300005367 | Ga0070667_100022732 | Ga0070667_1000227324 | 330 |
| 369 | 3300005455 | Ga0070663_100139642 | Ga0070663_1001396423 | 330 |
| 370 | 3300005456 | Ga0070678_100002739 | Ga0070678_1000027393 | 330 |
| 371 | 3300005457 | Ga0070662_100001063 | Ga0070662_1000010634 | 330 |
| 372 | 3300005458 | Ga0070681_10009105 | Ga0070681_100091058 | 330 |
| 373 | 3300005459 | Ga0068867_100000088 | Ga0068867_10000008845 | 330 |
| 374 | 3300005530 | Ga0070679_100141543 | Ga0070679_1001415432 | 330 |
| 375 | 3300005530 | Ga0070679_100322430 | Ga0070679_1003224301 | 330 |
| 376 | 3300005535 | Ga0070684_100174832 | Ga0070684_1001748321 | 330 |
| 377 | 3300005535 | Ga0070684_100388952 | Ga0070684_1003889521 | 330 |
| 378 | 3300005539 | Ga0068853_100413110 | Ga0068853_1004131102 | 330 |
| 379 | 3300005543 | Ga0070672_100087877 | Ga0070672_1000878772 | 330 |
| 380 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017380 | 330 |
| 381 | 3300005563 | Ga0068855_100000160 | Ga0068855_10000016058 | 330 |
| 382 | 3300005563 | Ga0068855_100000919 | Ga0068855_10000091915 | 330 |
| 383 | 3300005563 | Ga0068855_100003038 | Ga0068855_10000303819 | 330 |
| 384 | 3300005563 | Ga0068855_100047909 | Ga0068855_1000479092 | 330 |
| 385 | 3300005563 | Ga0068855_100086508 | Ga0068855_1000865081 | 330 |
| 386 | 3300005577 | Ga0068857_100055113 | Ga0068857_1000551133 | 330 |
| 387 | 3300005578 | Ga0068854_100009205 | Ga0068854_1000092052 | 330 |
| 388 | 3300005614 | Ga0068856_100000399 | Ga0068856_10000039912 | 330 |
| 389 | 3300005614 | Ga0068856_100033709 | Ga0068856_1000337091 | 330 |
| 390 | 3300005614 | Ga0068856_100034580 | Ga0068856_1000345806 | 330 |
| 391 | 3300005614 | Ga0068856_100052450 | Ga0068856_1000524502 | 330 |
| 392 | 3300005616 | Ga0068852_100000956 | Ga0068852_10000095620 | 330 |
| 393 | 3300005616 | Ga0068852_100002647 | Ga0068852_1000026473 | 330 |
| 394 | 3300005616 | Ga0068852_100070533 | Ga0068852_1000705332 | 330 |
| 395 | 3300005617 | Ga0068859_100000003 | Ga0068859_100000003410 | 330 |
| 396 | 3300005618 | Ga0068864_100005897 | Ga0068864_10000589711 | 330 |
| 397 | 3300005842 | Ga0068858_100012504 | Ga0068858_1000125042 | 330 |
| 398 | 3300005843 | Ga0068860_100004265 | Ga0068860_1000042659 | 330 |
| 399 | 3300006195 | Ga0075366_10003996 | Ga0075366_100039966 | 330 |
| 400 | 3300006237 | Ga0097621_100000017 | Ga0097621_1000000177 | 330 |
| 401 | 3300006358 | Ga0068871_100000053 | Ga0068871_1000000538 | 330 |
| 402 | 3300006881 | Ga0068865_100000213 | Ga0068865_10000021317 | 330 |
| 403 | 3300006931 | Ga0097620_100000003 | Ga0097620_100000003410 | 330 |
| 404 | 3300009036 | Ga0105244_10016121 | Ga0105244_100161213 | 330 |
| 405 | 3300009093 | Ga0105240_10000083 | Ga0105240_1000008367 | 330 |
| 406 | 3300009093 | Ga0105240_10013206 | Ga0105240_100132062 | 330 |
| 407 | 3300009093 | Ga0105240_10045318 | Ga0105240_100453182 | 330 |
| 408 | 3300009093 | Ga0105240_10401965 | Ga0105240_104019651 | 330 |
| 409 | 3300009101 | Ga0105247_10005364 | Ga0105247_100053648 | 330 |
| 410 | 3300009174 | Ga0105241_10000831 | Ga0105241_1000083111 | 330 |
| 411 | 3300009174 | Ga0105241_10001226 | Ga0105241_100012264 | 330 |
| 412 | 3300009174 | Ga0105241_10004424 | Ga0105241_100044244 | 330 |
| 413 | 3300009174 | Ga0105241_10052099 | Ga0105241_100520992 | 330 |
| 414 | 3300009174 | Ga0105241_10461328 | Ga0105241_104613281 | 330 |
| 415 | 3300009545 | Ga0105237_10000138 | Ga0105237_1000013855 | 330 |
| 416 | 3300009545 | Ga0105237_10000311 | Ga0105237_1000031123 | 330 |
| 417 | 3300009545 | Ga0105237_10000567 | Ga0105237_100005674 | 330 |
| 418 | 3300009545 | Ga0105237_10002767 | Ga0105237_100027678 | 330 |
| 419 | 3300009545 | Ga0105237_10003384 | Ga0105237_100033843 | 330 |
| 420 | 3300009545 | Ga0105237_10023922 | Ga0105237_100239221 | 330 |
| 421 | 3300009545 | Ga0105237_10029333 | Ga0105237_100293336 | 330 |
| 422 | 3300009545 | Ga0105237_10109599 | Ga0105237_101095992 | 330 |
| 423 | 3300009545 | Ga0105237_10125294 | Ga0105237_101252942 | 330 |
| 424 | 3300009551 | Ga0105238_10016483 | Ga0105238_100164832 | 330 |
| 425 | 3300009553 | Ga0105249_10044120 | Ga0105249_100441201 | 330 |
| 426 | 3300010375 | Ga0105239_10000014 | Ga0105239_10000014224 | 330 |
| 427 | 3300010375 | Ga0105239_10000069 | Ga0105239_1000006920 | 330 |
| 428 | 3300010375 | Ga0105239_10000161 | Ga0105239_1000016139 | 330 |
| 429 | 3300010375 | Ga0105239_10009374 | Ga0105239_100093747 | 330 |
| 430 | 3300010375 | Ga0105239_10072207 | Ga0105239_100722072 | 330 |
| 431 | 3300010375 | Ga0105239_10177209 | Ga0105239_101772092 | 330 |
| 432 | 3300011119 | Ga0105246_10036831 | Ga0105246_100368311 | 330 |
| 433 | 3300011119 | Ga0105246_10046001 | Ga0105246_100460012 | 330 |
| 434 | 3300013100 | Ga0157373_10000164 | Ga0157373_1000016455 | 330 |
| 435 | 3300013100 | Ga0157373_10000167 | Ga0157373_1000016752 | 330 |
| 436 | 3300013100 | Ga0157373_10001307 | Ga0157373_100013079 | 330 |
| 437 | 3300013100 | Ga0157373_10001611 | Ga0157373_100016116 | 330 |
| 438 | 3300013100 | Ga0157373_10003583 | Ga0157373_100035835 | 330 |
| 439 | 3300013100 | Ga0157373_10072595 | Ga0157373_100725951 | 330 |
| 440 | 3300013102 | Ga0157371_10000257 | Ga0157371_1000025712 | 330 |
| 441 | 3300013102 | Ga0157371_10000367 | Ga0157371_1000036724 | 330 |
| 442 | 3300013102 | Ga0157371_10000991 | Ga0157371_1000099113 | 330 |
| 443 | 3300013102 | Ga0157371_10001608 | Ga0157371_1000160815 | 330 |
| 444 | 3300013102 | Ga0157371_10002698 | Ga0157371_100026987 | 330 |
| 445 | 3300013102 | Ga0157371_10004054 | Ga0157371_100040544 | 330 |
| 446 | 3300013102 | Ga0157371_10007592 | Ga0157371_100075926 | 330 |
| 447 | 3300013104 | Ga0157370_10002955 | Ga0157370_100029558 | 330 |
| 448 | 3300013104 | Ga0157370_10012066 | Ga0157370_100120664 | 330 |
| 449 | 3300013104 | Ga0157370_10018712 | Ga0157370_100187122 | 330 |
| 450 | 3300013104 | Ga0157370_10026402 | Ga0157370_100264024 | 330 |
| 451 | 3300013104 | Ga0157370_10083095 | Ga0157370_100830953 | 330 |
| 452 | 3300013104 | Ga0157370_10092969 | Ga0157370_100929692 | 330 |
| 453 | 3300013104 | Ga0157370_10097216 | Ga0157370_100972162 | 330 |
| 454 | 3300013104 | Ga0157370_10117370 | Ga0157370_101173701 | 330 |
| 455 | 3300013105 | Ga0157369_10000158 | Ga0157369_100001581 | 330 |
| 456 | 3300013105 | Ga0157369_10003611 | Ga0157369_100036117 | 330 |
| 457 | 3300013105 | Ga0157369_10036533 | Ga0157369_100365333 | 330 |
| 458 | 3300013105 | Ga0157369_10038169 | Ga0157369_100381692 | 330 |
| 459 | 3300013105 | Ga0157369_10327060 | Ga0157369_103270602 | 330 |
| 460 | 3300013296 | Ga0157374_10000122 | Ga0157374_1000012251 | 330 |
| 461 | 3300013296 | Ga0157374_10000431 | Ga0157374_1000043137 | 330 |
| 462 | 3300013296 | Ga0157374_10001925 | Ga0157374_1000192518 | 330 |
| 463 | 3300013296 | Ga0157374_10059920 | Ga0157374_100599202 | 330 |
| 464 | 3300013297 | Ga0157378_10038963 | Ga0157378_100389632 | 330 |
| 465 | 3300013297 | Ga0157378_10060087 | Ga0157378_100600872 | 330 |
| 466 | 3300013297 | Ga0157378_10109952 | Ga0157378_101099522 | 330 |
| 467 | 3300013297 | Ga0157378_10144062 | Ga0157378_101440622 | 330 |
| 468 | 3300013306 | Ga0163162_10000011 | Ga0163162_10000011112 | 330 |
| 469 | 3300013306 | Ga0163162_10000071 | Ga0163162_1000007127 | 330 |
| 470 | 3300013306 | Ga0163162_10000824 | Ga0163162_1000082422 | 330 |
| 471 | 3300013306 | Ga0163162_10002735 | Ga0163162_100027355 | 330 |
| 472 | 3300013307 | Ga0157372_10000037 | Ga0157372_100000376 | 330 |
| 473 | 3300013307 | Ga0157372_10001036 | Ga0157372_1000103624 | 330 |
| 474 | 3300013307 | Ga0157372_10004621 | Ga0157372_100046213 | 330 |
| 475 | 3300013307 | Ga0157372_10023053 | Ga0157372_100230531 | 330 |
| 476 | 3300013307 | Ga0157372_10127825 | Ga0157372_101278252 | 330 |
| 477 | 3300013308 | Ga0157375_10007484 | Ga0157375_100074843 | 330 |
| 478 | 3300013308 | Ga0157375_10133363 | Ga0157375_101333632 | 330 |
| 479 | 3300013308 | Ga0157375_10444414 | Ga0157375_104444141 | 330 |
| 480 | 3300014325 | Ga0163163_10079855 | Ga0163163_100798552 | 330 |
| 481 | 3300014497 | Ga0182008_10000025 | Ga0182008_1000002533 | 330 |
| 482 | 3300014497 | Ga0182008_10000046 | Ga0182008_1000004611 | 330 |
| 483 | 3300014497 | Ga0182008_10000459 | Ga0182008_1000045912 | 330 |
| 484 | 3300014497 | Ga0182008_10007004 | Ga0182008_100070041 | 330 |
| 485 | 3300014969 | Ga0157376_10156441 | Ga0157376_101564412 | 330 |
| 486 | 3300015261 | Ga0182006_1000139 | Ga0182006_100013924 | 330 |
| 487 | 3300015261 | Ga0182006_1000289 | Ga0182006_100028918 | 330 |
| 488 | 3300015261 | Ga0182006_1001252 | Ga0182006_100125212 | 330 |
| 489 | 3300015261 | Ga0182006_1002192 | Ga0182006_10021924 | 330 |
| 490 | 3300015261 | Ga0182006_1002445 | Ga0182006_10024459 | 330 |
| 491 | 3300015262 | Ga0182007_10000008 | Ga0182007_1000000889 | 330 |
| 492 | 3300015262 | Ga0182007_10004586 | Ga0182007_100045861 | 330 |
| 493 | 3300015262 | Ga0182007_10037757 | Ga0182007_100377571 | 330 |
| 494 | 3300015682 | Ga0183373_1002 | Ga0183373_1002358 | 330 |
| 495 | 3300017792 | Ga0163161_10000355 | Ga0163161_1000035520 | 330 |
| 496 | 3300017792 | Ga0163161_10002183 | Ga0163161_100021833 | 330 |
| 497 | 3300017792 | Ga0163161_10003056 | Ga0163161_100030561 | 330 |
| 498 | 3300017792 | Ga0163161_10017615 | Ga0163161_100176154 | 330 |
| 499 | 3300017792 | Ga0163161_10033166 | Ga0163161_100331662 | 330 |
| 500 | 3300017792 | Ga0163161_10060112 | Ga0163161_100601122 | 330 |
| 501 | 3300020077 | Ga0206351_10526440 | Ga0206351_105264401 | 330 |
| 502 | 3300020080 | Ga0206350_10913138 | Ga0206350_109131381 | 330 |
| 503 | 3300021361 | Ga0213872_10007723 | Ga0213872_100077234 | 330 |
| 504 | 3300025231 | Ga0207427_100071 | Ga0207427_100071117 | 330 |
| 505 | 3300025233 | Ga0209437_100021 | Ga0209437_100021142 | 330 |
| 506 | 3300025233 | Ga0209437_100124 | Ga0209437_100124122 | 330 |
| 507 | 3300025242 | Ga0209258_107295 | Ga0209258_1072952 | 330 |
| 508 | 3300025245 | Ga0207425_1000003 | Ga0207425_100000399 | 330 |
| 509 | 3300025250 | Ga0209026_1000250 | Ga0209026_100025051 | 330 |
| 510 | 3300025250 | Ga0209026_1006781 | Ga0209026_10067812 | 330 |
| 511 | 3300025250 | Ga0209026_1014556 | Ga0209026_10145561 | 330 |
| 512 | 3300025258 | Ga0209129_1000022 | Ga0209129_100002299 | 330 |
| 513 | 3300025258 | Ga0209129_1008338 | Ga0209129_10083382 | 330 |
| 514 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035495 | 330 |
| 515 | 3300025261 | Ga0209233_1008227 | Ga0209233_10082272 | 330 |
| 516 | 3300025261 | Ga0209233_1020327 | Ga0209233_10203271 | 330 |
| 517 | 3300025272 | Ga0209455_1002522 | Ga0209455_10025223 | 330 |
| 518 | 3300025292 | Ga0209676_1000022 | Ga0209676_1000022344 | 330 |
| 519 | 3300025294 | Ga0209025_1000007 | Ga0209025_100000798 | 330 |
| 520 | 3300025297 | Ga0209758_1000012 | Ga0209758_100001299 | 330 |
| 521 | 3300025298 | Ga0209050_1000020 | Ga0209050_1000020195 | 330 |
| 522 | 3300025728 | Ga0207655_1015992 | Ga0207655_10159923 | 330 |
| 523 | 3300025900 | Ga0207710_10002740 | Ga0207710_100027402 | 330 |
| 524 | 3300025903 | Ga0207680_10000014 | Ga0207680_1000001435 | 330 |
| 525 | 3300025904 | Ga0207647_10000041 | Ga0207647_1000004110 | 330 |
| 526 | 3300025904 | Ga0207647_10000146 | Ga0207647_1000014619 | 330 |
| 527 | 3300025904 | Ga0207647_10057312 | Ga0207647_100573122 | 330 |
| 528 | 3300025904 | Ga0207647_10134170 | Ga0207647_101341701 | 330 |
| 529 | 3300025907 | Ga0207645_10000360 | Ga0207645_100003604 | 330 |
| 530 | 3300025909 | Ga0207705_10000032 | Ga0207705_10000032106 | 330 |
| 531 | 3300025911 | Ga0207654_10001427 | Ga0207654_1000142712 | 330 |
| 532 | 3300025911 | Ga0207654_10002088 | Ga0207654_100020883 | 330 |
| 533 | 3300025912 | Ga0207707_10014564 | Ga0207707_100145646 | 330 |
| 534 | 3300025913 | Ga0207695_10000127 | Ga0207695_1000012766 | 330 |
| 535 | 3300025913 | Ga0207695_10003909 | Ga0207695_1000390913 | 330 |
| 536 | 3300025913 | Ga0207695_10023389 | Ga0207695_100233899 | 330 |
| 537 | 3300025914 | Ga0207671_10000635 | Ga0207671_1000063527 | 330 |
| 538 | 3300025914 | Ga0207671_10000979 | Ga0207671_100009798 | 330 |
| 539 | 3300025914 | Ga0207671_10000991 | Ga0207671_1000099110 | 330 |
| 540 | 3300025914 | Ga0207671_10001361 | Ga0207671_100013618 | 330 |
| 541 | 3300025914 | Ga0207671_10003727 | Ga0207671_1000372713 | 330 |
| 542 | 3300025914 | Ga0207671_10006047 | Ga0207671_100060476 | 330 |
| 543 | 3300025914 | Ga0207671_10014401 | Ga0207671_100144016 | 330 |
| 544 | 3300025914 | Ga0207671_10067636 | Ga0207671_100676362 | 330 |
| 545 | 3300025914 | Ga0207671_10177824 | Ga0207671_101778241 | 330 |
| 546 | 3300025917 | Ga0207660_10374510 | Ga0207660_103745101 | 330 |
| 547 | 3300025919 | Ga0207657_10031472 | Ga0207657_100314724 | 330 |
| 548 | 3300025921 | Ga0207652_10021560 | Ga0207652_100215604 | 330 |
| 549 | 3300025921 | Ga0207652_10156639 | Ga0207652_101566391 | 330 |
| 550 | 3300025924 | Ga0207694_10061523 | Ga0207694_100615231 | 330 |
| 551 | 3300025932 | Ga0207690_10000049 | Ga0207690_1000004980 | 330 |
| 552 | 3300025932 | Ga0207690_10164759 | Ga0207690_101647591 | 330 |
| 553 | 3300025933 | Ga0207706_10000007 | Ga0207706_1000000768 | 330 |
| 554 | 3300025938 | Ga0207704_10000272 | Ga0207704_1000027221 | 330 |
| 555 | 3300025940 | Ga0207691_10093916 | Ga0207691_100939162 | 330 |
| 556 | 3300025942 | Ga0207689_10022150 | Ga0207689_100221504 | 330 |
| 557 | 3300025949 | Ga0207667_10000033 | Ga0207667_10000033147 | 330 |
| 558 | 3300025949 | Ga0207667_10002743 | Ga0207667_100027436 | 330 |
| 559 | 3300025949 | Ga0207667_10019365 | Ga0207667_100193655 | 330 |
| 560 | 3300025949 | Ga0207667_10052288 | Ga0207667_100522885 | 330 |
| 561 | 3300025949 | Ga0207667_10127560 | Ga0207667_101275602 | 330 |
| 562 | 3300025949 | Ga0207667_10130250 | Ga0207667_101302502 | 330 |
| 563 | 3300025961 | Ga0207712_10019558 | Ga0207712_100195582 | 330 |
| 564 | 3300025981 | Ga0207640_10006613 | Ga0207640_100066132 | 330 |
| 565 | 3300026035 | Ga0207703_10009595 | Ga0207703_100095956 | 330 |
| 566 | 3300026041 | Ga0207639_10108333 | Ga0207639_101083332 | 330 |
| 567 | 3300026067 | Ga0207678_10078492 | Ga0207678_100784922 | 330 |
| 568 | 3300026078 | Ga0207702_10006759 | Ga0207702_100067598 | 330 |
| 569 | 3300026078 | Ga0207702_10022981 | Ga0207702_100229811 | 330 |
| 570 | 3300026078 | Ga0207702_10157724 | Ga0207702_101577242 | 330 |
| 571 | 3300026078 | Ga0207702_10186541 | Ga0207702_101865412 | 330 |
| 572 | 3300026078 | Ga0207702_10214260 | Ga0207702_102142601 | 330 |
| 573 | 3300026078 | Ga0207702_10279072 | Ga0207702_102790721 | 330 |
| 574 | 3300026088 | Ga0207641_10000015 | Ga0207641_10000015127 | 330 |
| 575 | 3300026089 | Ga0207648_10000075 | Ga0207648_1000007561 | 330 |
| 576 | 3300026095 | Ga0207676_10034064 | Ga0207676_100340642 | 330 |
| 577 | 3300026116 | Ga0207674_10035173 | Ga0207674_100351732 | 330 |
| 578 | 3300026121 | Ga0207683_10002554 | Ga0207683_1000255410 | 330 |
| 579 | 3300026142 | Ga0207698_10002370 | Ga0207698_1000237011 | 330 |
| 580 | 3300026142 | Ga0207698_10011897 | Ga0207698_100118973 | 330 |
| 581 | 3300028379 | Ga0268266_10000195 | Ga0268266_1000019537 | 330 |
| 582 | 3300028381 | Ga0268264_10006198 | Ga0268264_100061982 | 330 |
| 583 | 3300028786 | Ga0307517_10000335 | Ga0307517_1000033540 | 330 |
| 584 | 3300028794 | Ga0307515_10000528 | Ga0307515_100005281 | 330 |
| 585 | 3300028794 | Ga0307515_10003943 | Ga0307515_1000394329 | 330 |
| 586 | 3300028794 | Ga0307515_10109008 | Ga0307515_101090081 | 330 |
| 587 | 3300028794 | Ga0307515_10123215 | Ga0307515_101232152 | 330 |
| 588 | 3300028800 | Ga0265338_10305366 | Ga0265338_103053661 | 330 |
| 589 | 3300031507 | Ga0307509_10033314 | Ga0307509_100333143 | 330 |
| 590 | 3300031548 | Ga0307408_100000164 | Ga0307408_10000016451 | 330 |
| 591 | 3300031548 | Ga0307408_100001486 | Ga0307408_1000014868 | 330 |
| 592 | 3300031731 | Ga0307405_10000045 | Ga0307405_100000459 | 330 |
| 593 | 3300031731 | Ga0307405_10104337 | Ga0307405_101043372 | 330 |
| 594 | 3300031903 | Ga0307407_10000002 | Ga0307407_10000002161 | 330 |
| 595 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001539 | 330 |
| 596 | 3300031911 | Ga0307412_10000697 | Ga0307412_1000069710 | 330 |
| 597 | 3300031911 | Ga0307412_10065524 | Ga0307412_100655242 | 330 |
| 598 | 3300031911 | Ga0307412_10083239 | Ga0307412_100832392 | 330 |
| 599 | 3300031995 | Ga0307409_100004241 | Ga0307409_1000042415 | 330 |
| 600 | 3300031995 | Ga0307409_100280770 | Ga0307409_1002807702 | 330 |
| 601 | 3300032002 | Ga0307416_100000005 | Ga0307416_100000005163 | 330 |
| 602 | 3300032004 | Ga0307414_10000952 | Ga0307414_1000095212 | 330 |
| 603 | 3300032004 | Ga0307414_10017292 | Ga0307414_100172923 | 330 |
| 604 | 3300032004 | Ga0307414_10028685 | Ga0307414_100286852 | 330 |
| 605 | 3300032004 | Ga0307414_10029693 | Ga0307414_100296931 | 330 |
| 606 | 3300032004 | Ga0307414_10031226 | Ga0307414_100312262 | 330 |
| 607 | 3300032004 | Ga0307414_10083648 | Ga0307414_100836482 | 330 |
| 608 | 3300032004 | Ga0307414_10151972 | Ga0307414_101519722 | 330 |
| 609 | 3300033179 | Ga0307507_10001000 | Ga0307507_1000100014 | 330 |
| 610 | 3300033180 | Ga0307510_10002118 | Ga0307510_1000211819 | 330 |
| 611 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_281343_282335 | 330 |
| 612 | 3300037312 | Ga0395899_0000152 | Ga0395899_0000152_63965_64957 | 330 |
| 613 | 3300037312 | Ga0395899_0023158 | Ga0395899_0023158_1581_2573 | 330 |
| 614 | 3300037312 | Ga0395899_0153716 | Ga0395899_0153716_283_1293 | 330 |
| 615 | 3300037418 | Ga0395900_0000288 | Ga0395900_0000288_29710_30702 | 330 |
| 616 | 3300037418 | Ga0395900_0003963 | Ga0395900_0003963_14164_15174 | 330 |
| 617 | 3300037418 | Ga0395900_0009792 | Ga0395900_0009792_2488_3480 | 330 |
| 618 | 3300037418 | Ga0395900_0023483 | Ga0395900_0023483_4293_5285 | 330 |
| 619 | 3300037466 | Ga0395898_0045114 | Ga0395898_0045114_3177_4169 | 330 |
| 620 | 3300037466 | Ga0395898_0150420 | Ga0395898_0150420_146_1156 | 330 |
| 621 | 3300037471 | Ga0395905_0000411 | Ga0395905_0000411_8485_9477 | 330 |
| 622 | 3300037471 | Ga0395905_0029207 | Ga0395905_0029207_3389_4381 | 330 |
| 623 | 3300037471 | Ga0395905_0157834 | Ga0395905_0157834_571_1581 | 330 |
| 624 | 3300038443 | Ga0395901_0158625 | Ga0395901_0158625_1293_2285 | 330 |
| 625 | 3300039447 | Ga0436361_1111083 | Ga0436361_1111083_3142_4134 | 330 |
| 626 | 3300042005 | Ga0439448_0004770 | Ga0439448_0004770_2572_3564 | 330 |
| 627 | 3300044684 | Ga0466966_0062890 | Ga0466966_0062890_995_1987 | 330 |
| 628 | 3300044765 | Ga0466970_0207038 | Ga0466970_0207038_35_1045 | 330 |
| 629 | 3300045049 | Ga0466959_0000904 | Ga0466959_0000904_15242_16252 | 330 |
| 630 | 3300045049 | Ga0466959_0109921 | Ga0466959_0109921_233_1225 | 330 |
| 631 | 3300046453 | Ga0495627_006048 | Ga0495627_006048_775_1773 | 330 |
| 632 | 3300046471 | Ga0495650_0000095 | Ga0495650_0000095_184634_185626 | 330 |
| 633 | 3300046471 | Ga0495650_0042565 | Ga0495650_0042565_188_1180 | 330 |
| 634 | 3300046492 | Ga0495585_0000034 | Ga0495585_0000034_31368_32360 | 330 |
| 635 | 3300046492 | Ga0495585_0000313 | Ga0495585_0000313_31637_32629 | 330 |
| 636 | 3300046500 | Ga0495596_0008189 | Ga0495596_0008189_1814_2806 | 330 |
| 637 | 3300046506 | Ga0495583_0012709 | Ga0495583_0012709_2666_3658 | 330 |
| 638 | 3300046507 | Ga0495606_0000009 | Ga0495606_0000009_65101_66093 | 330 |
| 639 | 3300046507 | Ga0495606_0003788 | Ga0495606_0003788_12922_13914 | 330 |
| 640 | 3300046507 | Ga0495606_0005118 | Ga0495606_0005118_5471_6463 | 330 |
| 641 | 3300046507 | Ga0495606_0053385 | Ga0495606_0053385_1108_2106 | 330 |
| 642 | 3300046512 | Ga0495610_0000084 | Ga0495610_0000084_85612_86664 | 330 |
| 643 | 3300046512 | Ga0495610_0000284 | Ga0495610_0000284_3969_4967 | 330 |
| 644 | 3300046512 | Ga0495610_0010992 | Ga0495610_0010992_1362_2354 | 330 |
| 645 | 3300046513 | Ga0495616_0007971 | Ga0495616_0007971_3498_4490 | 330 |
| 646 | 3300046514 | Ga0495618_0174558 | Ga0495618_0174558_319_1311 | 330 |
| 647 | 3300046519 | Ga0495632_0068031 | Ga0495632_0068031_206_1204 | 330 |
| 648 | 3300046520 | Ga0495637_0008889 | Ga0495637_0008889_374_1372 | 330 |
| 649 | 3300046524 | Ga0495648_0028569 | Ga0495648_0028569_1058_2050 | 330 |
| 650 | 3300046524 | Ga0495648_0041493 | Ga0495648_0041493_802_1794 | 330 |
| 651 | 3300046538 | Ga0495609_0004648 | Ga0495609_0004648_645_1637 | 330 |
| 652 | 3300046538 | Ga0495609_0034905 | Ga0495609_0034905_419_1411 | 330 |
| 653 | 3300046558 | Ga0495633_0000074 | Ga0495633_0000074_2137_3129 | 330 |
| 654 | 3300046558 | Ga0495633_0002697 | Ga0495633_0002697_6120_7112 | 330 |
| 655 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_333486_334478 | 330 |
| 656 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_266845_267837 | 330 |
| 657 | 3300046660 | Ga0495625_0000679 | Ga0495625_0000679_16309_17301 | 330 |
| 658 | 3300046660 | Ga0495625_0006979 | Ga0495625_0006979_8464_9456 | 330 |
| 659 | 3300046660 | Ga0495625_0016119 | Ga0495625_0016119_3387_4379 | 330 |
| 660 | 3300046660 | Ga0495625_0063646 | Ga0495625_0063646_741_1733 | 330 |
| 661 | 3300046665 | Ga0495661_0002451 | Ga0495661_0002451_11448_12440 | 330 |
| 662 | 3300046665 | Ga0495661_0034563 | Ga0495661_0034563_2033_3025 | 330 |
| 663 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_184517_185509 | 330 |
| 664 | 3300046794 | Ga0495589_0058180 | Ga0495589_0058180_215_1207 | 330 |
| 665 | 3300046810 | Ga0495660_0003408 | Ga0495660_0003408_991_1983 | 330 |
| 666 | 3300047323 | Ga0495683_0038745 | Ga0495683_0038745_791_1783 | 330 |
| 667 | 3300047443 | Ga0495687_000713 | Ga0495687_000713_29508_30500 | 330 |
| 668 | 3300047443 | Ga0495687_000846 | Ga0495687_000846_25126_26118 | 330 |
| 669 | 3300047443 | Ga0495687_063602 | Ga0495687_063602_420_1412 | 330 |
| 670 | 3300047445 | Ga0495677_0012175 | Ga0495677_0012175_174_1166 | 330 |
| 671 | 3300047446 | Ga0495679_018985 | Ga0495679_018985_872_1864 | 330 |
| 672 | 3300047470 | Ga0495681_0024609 | Ga0495681_0024609_1684_2682 | 330 |
| 673 | 3300047472 | Ga0495686_0000614 | Ga0495686_0000614_13047_14039 | 330 |
| 674 | 3300047472 | Ga0495686_0001530 | Ga0495686_0001530_14547_15539 | 330 |
| 675 | 3300047472 | Ga0495686_0011382 | Ga0495686_0011382_2468_3460 | 330 |
| 676 | 3300047472 | Ga0495686_0017078 | Ga0495686_0017078_2232_3224 | 330 |
| 677 | 3300047472 | Ga0495686_0046647 | Ga0495686_0046647_1706_2698 | 330 |
| 678 | 3300047472 | Ga0495686_0101303 | Ga0495686_0101303_573_1565 | 330 |
| 679 | 3300047472 | Ga0495686_0122018 | Ga0495686_0122018_225_1217 | 330 |
| 680 | 3300048089 | Ga0495614_0014793 | Ga0495614_0014793_158_1150 | 330 |
| 681 | 3300048918 | Ga0496115_0017883 | Ga0496115_0017883_4013_5011 | 330 |
| 682 | 3300048925 | Ga0496122_0000783 | Ga0496122_0000783_23224_24222 | 330 |
| 683 | 3300048926 | Ga0496123_0002343 | Ga0496123_0002343_3090_4088 | 330 |
| 684 | 3300049459 | Ga0495678_016616 | Ga0495678_016616_73_1065 | 330 |
| 685 | 3300049663 | Ga0501223_001133 | Ga0501223_001133_561_1553 | 330 |
| 686 | 3300049679 | Ga0501249_013449 | Ga0501249_013449_183_1181 | 330 |
| 687 | 3300050493 | nmdc:mga0k408_3924_c1 | nmdc:mga0k408_3924_c1_4903_5895 | 330 |
| 688 | 3300050493 | nmdc:mga0k408_397_c1 | nmdc:mga0k408_397_c1_196_1188 | 330 |
| 689 | 3300050496 | nmdc:mga07m45_104785_c1 | nmdc:mga07m45_104785_c1_32_1024 | 330 |
| 690 | 3300053080 | Ga0500635_0006761 | Ga0500635_0006761_1423_2415 | 330 |
| 691 | 3300053093 | Ga0500651_0000951 | Ga0500651_0000951_3698_4690 | 330 |
| 692 | 3300053122 | Ga0500608_000220 | Ga0500608_000220_2258_3250 | 330 |
| 693 | 3300053122 | Ga0500608_002387 | Ga0500608_002387_364_1356 | 330 |
| 694 | 3300053123 | Ga0500614_009600 | Ga0500614_009600_739_1731 | 330 |
| 695 | 3300053130 | Ga0500642_0012313 | Ga0500642_0012313_1492_2484 | 330 |
| 696 | 3300053156 | Ga0500622_0003794 | Ga0500622_0003794_4333_5325 | 330 |
| 697 | 3300053157 | Ga0500624_000183 | Ga0500624_000183_20647_21639 | 330 |
| 698 | iso_pu_bacteria | 2739367656 | 2739615017 | 330 |
| 699 | iso_pu_bacteria | 2818991437 | 2819547116 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ora-assembly2.cif.gz_B | an unexpected intermediate in the reaction catalyzed by quinolinate synthase | 0.9597 | 22 | 325 |
| 7p4p-assembly1.cif.gz_A | structure of the quinolinate synthase a84l variant complexed with citrate | 0.9594 | 23 | 324 |
| 5lqm-assembly1.cif.gz_A | structure of quinolinate synthase y21f mutant in complex with citrate | 0.9578 | 23 | 324 |
| 6ora-assembly2.cif.gz_B | an unexpected intermediate in the reaction catalyzed by quinolinate synthase | 0.9565 | 22 | 325 |
| 5kts-assembly1.cif.gz_A | crystal structure of pyrococcus horikoshii quinolinate synthase (nada) with bound citraconate and fe4s4 cluster | 0.9506 | 20 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57850_5_79_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 1.004 | 24 | 97 | 3.40.50.10800 |
| af_P11458_25_111_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9799 | 24 | 101 | 3.40.50.10800 |
| af_Q57850_5_79_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9773 | 24 | 97 | 3.40.50.10800 |
| 5ktnA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9763 | 20 | 97 | 3.40.50.10800 |
| af_P9WJK1_121_190_3.40.50.10800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like | 0.9659 | 110 | 179 | 3.40.50.10800 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3PJX2-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 1.002 | 79 | 238 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A4Q6DYH0-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9995 | 41 | 330 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A3M1EYU8-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9979 | 8 | 264 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A519SQS6-F1-model_v4 | Quinolinate synthase (EC 2.5.1.72) | 0.9977 | 98 | 330 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
| AF-A0A2X2J232-F1-model_v4 | quinolinate synthase (EC 2.5.1.72) | 0.9975 | 82 | 201 |
GO:0005829
GO:0008987 GO:0034628 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar