F476006

General Info

Members Datasets Scaffolds Average Seq Length
699 344 660 334

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1000002|Ga0055536_1000002196
Length 350
Sequence VESFIFDQRQNSKKENLIMNIDVLEEINKKGFAEEEIDPTLDLFAEIERLKREKNAIILAHYYQEPDIQDIADYIGDSLGLSQEAAKTDADVIVFAGVHFMAETAKILSPDKKVLLPDVKAGCSLADSCPPHLFKKFKEKYPDHLVITYVNCTAELKALSDIVCTSTNAVQIVQSLPKDQKIIFGPDRNLGAYVAKKTGRDLVLWNGACMVHEIFSQEKITKLKERHPNAKFIAHPECEEVILKMADYVGSTTGLLKYTISNPATEFIVATESGIIHQMEKANPDKTFIPAPPNNSCACNDCPYMKRNTLEKLYLCIKNGYPEVTVPEHIIEQARKPIQRMLDISAELGL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
24 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
25 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
30 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
31 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
32 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
33 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
34 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
35 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
36 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
37 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
38 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
39 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
40 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
46 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
47 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
195 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
196 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
197 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
203 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
204 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
205 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
206 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
327 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
344 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.99
Metatranscriptomes 0.43
Isolates 5.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0.43
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1075644 2162886007 Bacteria 9333
2 SwRhRL2b_contig_255488 2162886007 Bacteria 22786
3 SwRhRL2b_contig_3484740 2162886007 Bacteria 2338
4 JGI24736J21556_1000770 3300001904 Bacteria 5872
5 JGI24740J21852_10004111 3300001979 Bacteria 6289
6 JGI24737J22298_10000017 3300001990 Bacteria 46988
7 JGI24737J22298_10005039 3300001990 Bacteria 4577
8 JGI24735J21928_10000024 3300002067 Bacteria 95227
9 JGI24735J21928_10013453 3300002067 Bacteria 2573
10 JGI25162J39368_1000056 3300002737 Bacteria 146755
11 JGI25162J39368_1000620 3300002737 Bacteria 25397
12 JGI25164J39214_1000942 3300002772 Bacteria 9436
13 JGI25152J39213_1000337 3300002773 Bacteria 29791
14 JGI25150J39212_1000006 3300002774 Bacteria 257228
15 JGI25151J46595_10000024 3300003187 Bacteria 217596
16 JGI25165J46597_1000916 3300003214 Bacteria 20448
17 JGI25153J46596_10000026 3300003215 Bacteria 217245
18 rootH1_10003552 3300003316 Bacteria 4241
19 rootH1_10026676 3300003316 Bacteria 7472
20 rootH2_10000579 3300003320 Bacteria 178428
21 rootH2_10042766 3300003320 Bacteria 27178
22 rootH2_10055718 3300003320 Bacteria 2133
23 rootH2_10244504 3300003320 Bacteria 1170
24 rootH1_10060032 3300003323 Bacteria 5010
25 rootH1_10066500 3300003323 Bacteria 9935
26 Ga0055536_1000002 3300003781 Bacteria 605605
27 Ga0055530_10011132 3300003791 Bacteria 3258
28 Ga0058863_11436476 3300004799 Bacteria 1953
29 Ga0065714_10004217 3300005288 Bacteria 14624
30 Ga0065714_10010214 3300005288 Bacteria 2794
31 Ga0065714_10064535 3300005288 Bacteria 40118
32 Ga0065714_10069686 3300005288 Bacteria 4116
33 Ga0065714_10100080 3300005288 Bacteria 1672
34 Ga0065714_10130465 3300005288 Bacteria 1255
35 Ga0065704_10000218 3300005289 Bacteria 76484
36 Ga0065704_10077907 3300005289 Bacteria 4586
37 Ga0065704_10142975 3300005289 Bacteria 1499
38 Ga0070658_10000032 3300005327 Bacteria 147726
39 Ga0070658_10094307 3300005327 Bacteria 2469
40 Ga0070676_10002072 3300005328 Bacteria 10201
41 Ga0070683_100067207 3300005329 Bacteria 3339
42 Ga0070690_100255051 3300005330 Bacteria 1242
43 Ga0068869_100008852 3300005334 Bacteria 6513
44 Ga0070666_10000030 3300005335 Bacteria 137543
45 Ga0070680_100006592 3300005336 Bacteria 8829
46 Ga0070680_100365554 3300005336 Bacteria 1227
47 Ga0068868_100035950 3300005338 Bacteria 3831
48 Ga0070660_100023968 3300005339 Bacteria 4526
49 Ga0070689_100002402 3300005340 Bacteria 12222
50 Ga0070689_100003633 3300005340 Bacteria 10289
51 Ga0070689_100023414 3300005340 Bacteria 4623
52 Ga0070689_100052373 3300005340 Bacteria 3157
53 Ga0070691_10139215 3300005341 Bacteria 1235
54 Ga0070687_100026314 3300005343 Bacteria 2800
55 Ga0070671_100001424 3300005355 Bacteria 17882
56 Ga0070673_100201153 3300005364 Bacteria 1716
57 Ga0070659_100000412 3300005366 Bacteria 32519
58 Ga0070667_100022732 3300005367 Bacteria 5200
59 Ga0070714_100007178 3300005435 Bacteria 8645
60 Ga0070701_10107227 3300005438 Bacteria 1556
61 Ga0070711_100005204 3300005439 Bacteria 7761
62 Ga0070694_100141549 3300005444 Bacteria 1748
63 Ga0070663_100139642 3300005455 Bacteria 1848
64 Ga0070678_100002739 3300005456 Bacteria 9728
65 Ga0070662_100001063 3300005457 Bacteria 16771
66 Ga0070681_10009105 3300005458 Bacteria 9757
67 Ga0070681_10033602 3300005458 Bacteria 5148
68 Ga0070681_10184017 3300005458 Bacteria 2010
69 Ga0068867_100000088 3300005459 Bacteria 58016
70 Ga0070679_100141543 3300005530 Bacteria 2384
71 Ga0070679_100322430 3300005530 Bacteria 1494
72 Ga0070684_100174832 3300005535 Bacteria 1951
73 Ga0070684_100388952 3300005535 Bacteria 1285
74 Ga0068853_100067797 3300005539 Bacteria 3101
75 Ga0068853_100413110 3300005539 Bacteria 1265
76 Ga0070672_100087877 3300005543 Bacteria 2502
77 Ga0070686_100026851 3300005544 Bacteria 3479
78 Ga0070665_100000017 3300005548 Bacteria 448013
79 Ga0070704_100012892 3300005549 Bacteria 5172
80 Ga0068855_100000160 3300005563 Bacteria 86118
81 Ga0068855_100000919 3300005563 Bacteria 36613
82 Ga0068855_100003038 3300005563 Bacteria 20548
83 Ga0068855_100029065 3300005563 Bacteria 6610
84 Ga0068855_100047909 3300005563 Bacteria 5046
85 Ga0068855_100074415 3300005563 Bacteria 3945
86 Ga0068855_100086508 3300005563 Bacteria 3625
87 Ga0068855_100378355 3300005563 Bacteria 1555
88 Ga0068855_100424675 3300005563 Bacteria 1453
89 Ga0068857_100004246 3300005577 Bacteria 12075
90 Ga0068857_100055113 3300005577 Bacteria 3528
91 Ga0068854_100009205 3300005578 Bacteria 6374
92 Ga0068856_100000067 3300005614 Bacteria 98357
93 Ga0068856_100000399 3300005614 Bacteria 47601
94 Ga0068856_100015211 3300005614 Bacteria 7435
95 Ga0068856_100033709 3300005614 Bacteria 5015
96 Ga0068856_100034580 3300005614 Bacteria 4949
97 Ga0068856_100052450 3300005614 Bacteria 4022
98 Ga0068856_100366229 3300005614 Bacteria 1460
99 Ga0068852_100000956 3300005616 Bacteria 19010
100 Ga0068852_100002647 3300005616 Bacteria 12375
101 Ga0068852_100016582 3300005616 Bacteria 5752
102 Ga0068852_100070533 3300005616 Bacteria 3066
103 Ga0068859_100000003 3300005617 Bacteria 479218
104 Ga0068859_100130718 3300005617 Bacteria 2582
105 Ga0068859_100259507 3300005617 Bacteria 1829
106 Ga0068864_100005897 3300005618 Bacteria 10041
107 Ga0068863_100243144 3300005841 Bacteria 1737
108 Ga0068863_100344341 3300005841 Bacteria 1450
109 Ga0068858_100012504 3300005842 Bacteria 8006
110 Ga0068860_100004265 3300005843 Bacteria 14642
111 Ga0075366_10003996 3300006195 Bacteria 7880
112 Ga0097621_100000017 3300006237 Bacteria 90529
113 Ga0097621_100054503 3300006237 Bacteria 3262
114 Ga0068871_100000053 3300006358 Bacteria 63957
115 Ga0068871_100168833 3300006358 Bacteria 1874
116 Ga0075431_100171401 3300006847 Bacteria 2229
117 Ga0075434_100136277 3300006871 Bacteria 2474
118 Ga0075434_100178372 3300006871 Bacteria 2144
119 Ga0075429_100044531 3300006880 Bacteria 3860
120 Ga0068865_100000213 3300006881 Bacteria 32484
121 Ga0097620_100000003 3300006931 Bacteria 479218
122 Ga0097620_100130717 3300006931 Bacteria 2582
123 Ga0097620_100259520 3300006931 Bacteria 1829
124 Ga0105244_10016121 3300009036 Bacteria 4264
125 Ga0105240_10000083 3300009093 Bacteria 192934
126 Ga0105240_10000872 3300009093 Bacteria 54351
127 Ga0105240_10013206 3300009093 Bacteria 11364
128 Ga0105240_10026212 3300009093 Bacteria 7648
129 Ga0105240_10045318 3300009093 Bacteria 5580
130 Ga0105240_10401965 3300009093 Bacteria 1543
131 Ga0105240_10423339 3300009093 Bacteria 1495
132 Ga0111539_10002005 3300009094 Bacteria 27177
133 Ga0111539_10090431 3300009094 Bacteria 3597
134 Ga0111539_10097277 3300009094 Bacteria 3457
135 Ga0111539_10115364 3300009094 Bacteria 3150
136 Ga0111539_10466816 3300009094 Bacteria 1470
137 Ga0105247_10005364 3300009101 Bacteria 8081
138 Ga0105243_10000046 3300009148 Bacteria 155277
139 Ga0105241_10000831 3300009174 Bacteria 23378
140 Ga0105241_10001226 3300009174 Bacteria 19619
141 Ga0105241_10004424 3300009174 Bacteria 10390
142 Ga0105241_10052099 3300009174 Bacteria 3124
143 Ga0105241_10229382 3300009174 Bacteria 1565
144 Ga0105241_10461328 3300009174 Bacteria 1126
145 Ga0105237_10000138 3300009545 Bacteria 102411
146 Ga0105237_10000311 3300009545 Bacteria 67880
147 Ga0105237_10000567 3300009545 Bacteria 51672
148 Ga0105237_10002767 3300009545 Bacteria 21321
149 Ga0105237_10003384 3300009545 Bacteria 18969
150 Ga0105237_10009180 3300009545 Bacteria 10619
151 Ga0105237_10023922 3300009545 Bacteria 6251
152 Ga0105237_10029333 3300009545 Bacteria 5594
153 Ga0105237_10109599 3300009545 Bacteria 2753
154 Ga0105237_10125294 3300009545 Bacteria 2563
155 Ga0105237_10400352 3300009545 Bacteria 1378
156 Ga0105238_10016483 3300009551 Bacteria 7480
157 Ga0105238_10034231 3300009551 Bacteria 5169
158 Ga0105238_10042318 3300009551 Bacteria 4613
159 Ga0105238_10052272 3300009551 Bacteria 4107
160 Ga0105249_10044120 3300009553 Bacteria 4055
161 Ga0105239_10000014 3300010375 Bacteria 325391
162 Ga0105239_10000069 3300010375 Bacteria 144493
163 Ga0105239_10000161 3300010375 Bacteria 97242
164 Ga0105239_10009374 3300010375 Bacteria 11044
165 Ga0105239_10072207 3300010375 Bacteria 3794
166 Ga0105239_10177209 3300010375 Bacteria 2384
167 Ga0105246_10036831 3300011119 Bacteria 3279
168 Ga0105246_10046001 3300011119 Bacteria 2975
169 Ga0157373_10000164 3300013100 Bacteria 53961
170 Ga0157373_10000167 3300013100 Bacteria 53611
171 Ga0157373_10001307 3300013100 Bacteria 19028
172 Ga0157373_10001611 3300013100 Bacteria 17236
173 Ga0157373_10003583 3300013100 Bacteria 11730
174 Ga0157373_10072595 3300013100 Bacteria 2429
175 Ga0157371_10000257 3300013102 Bacteria 73583
176 Ga0157371_10000367 3300013102 Bacteria 56890
177 Ga0157371_10000991 3300013102 Bacteria 31396
178 Ga0157371_10001608 3300013102 Bacteria 23170
179 Ga0157371_10002698 3300013102 Bacteria 16766
180 Ga0157371_10004054 3300013102 Bacteria 12956
181 Ga0157371_10007592 3300013102 Bacteria 8750
182 Ga0157371_10007977 3300013102 Bacteria 8494
183 Ga0157370_10002955 3300013104 Bacteria 20235
184 Ga0157370_10012066 3300013104 Bacteria 8994
185 Ga0157370_10018712 3300013104 Bacteria 6965
186 Ga0157370_10026402 3300013104 Bacteria 5735
187 Ga0157370_10080937 3300013104 Bacteria 3057
188 Ga0157370_10083095 3300013104 Bacteria 3011
189 Ga0157370_10092969 3300013104 Bacteria 2830
190 Ga0157370_10097216 3300013104 Bacteria 2762
191 Ga0157370_10108413 3300013104 Bacteria 2597
192 Ga0157370_10117370 3300013104 Bacteria 2486
193 Ga0157370_10122274 3300013104 Bacteria 2430
194 Ga0157369_10000158 3300013105 Bacteria 96395
195 Ga0157369_10003611 3300013105 Bacteria 18378
196 Ga0157369_10036533 3300013105 Bacteria 5381
197 Ga0157369_10038169 3300013105 Bacteria 5253
198 Ga0157369_10327060 3300013105 Bacteria 1593
199 Ga0157374_10000122 3300013296 Bacteria 70398
200 Ga0157374_10000431 3300013296 Bacteria 38001
201 Ga0157374_10001925 3300013296 Bacteria 17411
202 Ga0157374_10059920 3300013296 Bacteria 3561
203 Ga0157378_10038963 3300013297 Bacteria 4214
204 Ga0157378_10060087 3300013297 Bacteria 3392
205 Ga0157378_10109952 3300013297 Bacteria 2525
206 Ga0157378_10144062 3300013297 Bacteria 2215
207 Ga0163162_10000011 3300013306 Bacteria 299877
208 Ga0163162_10000071 3300013306 Bacteria 94831
209 Ga0163162_10000824 3300013306 Bacteria 28851
210 Ga0163162_10002735 3300013306 Bacteria 16742
211 Ga0157372_10000037 3300013307 Bacteria 172444
212 Ga0157372_10001036 3300013307 Bacteria 30412
213 Ga0157372_10003224 3300013307 Bacteria 17614
214 Ga0157372_10004621 3300013307 Bacteria 14638
215 Ga0157372_10023053 3300013307 Bacteria 6746
216 Ga0157372_10069770 3300013307 Bacteria 3953
217 Ga0157372_10127825 3300013307 Bacteria 2922
218 Ga0157375_10000111 3300013308 Bacteria 79589
219 Ga0157375_10007484 3300013308 Bacteria 9551
220 Ga0157375_10133363 3300013308 Bacteria 2605
221 Ga0157375_10371713 3300013308 Bacteria 1596
222 Ga0157375_10444414 3300013308 Bacteria 1462
223 Ga0163163_10000020 3300014325 Bacteria 196885
224 Ga0163163_10079855 3300014325 Bacteria 3270
225 Ga0163163_10102041 3300014325 Bacteria 2892
226 Ga0163163_10316019 3300014325 Bacteria 1615
227 Ga0182008_10000025 3300014497 Bacteria 191222
228 Ga0182008_10000046 3300014497 Bacteria 111777
229 Ga0182008_10000459 3300014497 Bacteria 31097
230 Ga0182008_10007004 3300014497 Bacteria 6250
231 Ga0157379_10303909 3300014968 Bacteria 1454
232 Ga0157376_10156441 3300014969 Bacteria 2061
233 Ga0182006_1000139 3300015261 Bacteria 77918
234 Ga0182006_1000289 3300015261 Bacteria 44305
235 Ga0182006_1001252 3300015261 Bacteria 15727
236 Ga0182006_1002192 3300015261 Bacteria 10824
237 Ga0182006_1002445 3300015261 Bacteria 10151
238 Ga0182007_10000008 3300015262 Bacteria 332953
239 Ga0182007_10004586 3300015262 Bacteria 6241
240 Ga0182007_10037757 3300015262 Bacteria 1621
241 Ga0183373_1002 3300015682 Bacteria 990153
242 Ga0163161_10000355 3300017792 Bacteria 38658
243 Ga0163161_10002183 3300017792 Bacteria 14111
244 Ga0163161_10003056 3300017792 Bacteria 11803
245 Ga0163161_10017615 3300017792 Bacteria 5002
246 Ga0163161_10033166 3300017792 Bacteria 3689
247 Ga0163161_10060112 3300017792 Bacteria 2765
248 Ga0206351_10526440 3300020077 Bacteria 1166
249 Ga0206350_10913138 3300020080 Bacteria 1887
250 Ga0213872_10007723 3300021361 Bacteria 5261
251 Ga0207427_100071 3300025231 Bacteria 159974
252 Ga0209437_100021 3300025233 Bacteria 646400
253 Ga0209437_100124 3300025233 Bacteria 199789
254 Ga0209258_107295 3300025242 Bacteria 1652
255 Ga0207425_1000003 3300025245 Bacteria 1145342
256 Ga0209026_1000250 3300025250 Bacteria 68451
257 Ga0209026_1006781 3300025250 Bacteria 2723
258 Ga0209026_1014556 3300025250 Bacteria 1310
259 Ga0209129_1000022 3300025258 Bacteria 440876
260 Ga0209129_1008338 3300025258 Bacteria 2900
261 Ga0209233_1000035 3300025261 Bacteria 568478
262 Ga0209233_1008227 3300025261 Bacteria 3241
263 Ga0209233_1020327 3300025261 Bacteria 1744
264 Ga0209455_1002522 3300025272 Bacteria 7020
265 Ga0209676_1000022 3300025292 Bacteria 605659
266 Ga0209025_1000007 3300025294 Bacteria 1145109
267 Ga0209758_1000012 3300025297 Bacteria 949866
268 Ga0209050_1000020 3300025298 Bacteria 605671
269 Ga0207655_1015992 3300025728 Bacteria 4133
270 Ga0207710_10002740 3300025900 Bacteria 8073
271 Ga0207680_10000014 3300025903 Bacteria 179035
272 Ga0207647_10000041 3300025904 Bacteria 92367
273 Ga0207647_10000146 3300025904 Bacteria 56177
274 Ga0207647_10032159 3300025904 Bacteria 3373
275 Ga0207647_10057312 3300025904 Bacteria 2388
276 Ga0207647_10134170 3300025904 Bacteria 1454
277 Ga0207645_10000360 3300025907 Bacteria 37759
278 Ga0207705_10000032 3300025909 Bacteria 224376
279 Ga0207705_10086874 3300025909 Bacteria 2286
280 Ga0207684_10340196 3300025910 Bacteria 1292
281 Ga0207654_10001427 3300025911 Bacteria 12688
282 Ga0207654_10002088 3300025911 Bacteria 10232
283 Ga0207707_10010673 3300025912 Bacteria 7981
284 Ga0207707_10014564 3300025912 Bacteria 6851
285 Ga0207707_10027491 3300025912 Bacteria 4974
286 Ga0207695_10000127 3300025913 Bacteria 227338
287 Ga0207695_10003909 3300025913 Bacteria 20614
288 Ga0207695_10020975 3300025913 Bacteria 7465
289 Ga0207695_10023389 3300025913 Bacteria 6982
290 Ga0207695_10079432 3300025913 Bacteria 3325
291 Ga0207671_10000635 3300025914 Bacteria 45980
292 Ga0207671_10000979 3300025914 Bacteria 35379
293 Ga0207671_10000991 3300025914 Bacteria 34985
294 Ga0207671_10001361 3300025914 Bacteria 28549
295 Ga0207671_10003727 3300025914 Bacteria 15021
296 Ga0207671_10006047 3300025914 Bacteria 10917
297 Ga0207671_10008901 3300025914 Bacteria 8452
298 Ga0207671_10014401 3300025914 Bacteria 6252
299 Ga0207671_10067636 3300025914 Bacteria 2661
300 Ga0207671_10177824 3300025914 Bacteria 1655
301 Ga0207663_10009269 3300025916 Bacteria 5193
302 Ga0207660_10374510 3300025917 Bacteria 1144
303 Ga0207657_10031472 3300025919 Bacteria 4805
304 Ga0207657_10099972 3300025919 Bacteria 2409
305 Ga0207652_10000187 3300025921 Bacteria 65282
306 Ga0207652_10021560 3300025921 Bacteria 5318
307 Ga0207652_10156639 3300025921 Bacteria 2041
308 Ga0207694_10018133 3300025924 Bacteria 5321
309 Ga0207694_10061523 3300025924 Bacteria 2922
310 Ga0207694_10087138 3300025924 Bacteria 2459
311 Ga0207664_10007731 3300025929 Bacteria 7461
312 Ga0207690_10000049 3300025932 Bacteria 113589
313 Ga0207690_10164759 3300025932 Bacteria 1656
314 Ga0207706_10000007 3300025933 Bacteria 211081
315 Ga0207709_10000020 3300025935 Bacteria 392366
316 Ga0207670_10001839 3300025936 Bacteria 11075
317 Ga0207704_10000272 3300025938 Bacteria 24862
318 Ga0207691_10093916 3300025940 Bacteria 2685
319 Ga0207689_10022150 3300025942 Bacteria 5343
320 Ga0207661_10202003 3300025944 Bacteria 1748
321 Ga0207667_10000033 3300025949 Bacteria 314353
322 Ga0207667_10000492 3300025949 Bacteria 52207
323 Ga0207667_10002743 3300025949 Bacteria 21770
324 Ga0207667_10019365 3300025949 Bacteria 7600
325 Ga0207667_10052288 3300025949 Bacteria 4303
326 Ga0207667_10100335 3300025949 Bacteria 2986
327 Ga0207667_10127560 3300025949 Bacteria 2621
328 Ga0207667_10130250 3300025949 Bacteria 2591
329 Ga0207667_10171493 3300025949 Bacteria 2230
330 Ga0207651_10530990 3300025960 Bacteria 1021
331 Ga0207651_10561718 3300025960 Bacteria 993
332 Ga0207712_10019558 3300025961 Bacteria 4425
333 Ga0207640_10006613 3300025981 Bacteria 6368
334 Ga0207703_10009595 3300026035 Bacteria 7601
335 Ga0207639_10108333 3300026041 Bacteria 2259
336 Ga0207678_10078492 3300026067 Bacteria 2828
337 Ga0207702_10001092 3300026078 Bacteria 27756
338 Ga0207702_10006759 3300026078 Bacteria 9842
339 Ga0207702_10022981 3300026078 Bacteria 5173
340 Ga0207702_10027834 3300026078 Bacteria 4696
341 Ga0207702_10045049 3300026078 Bacteria 3711
342 Ga0207702_10157724 3300026078 Bacteria 2070
343 Ga0207702_10186541 3300026078 Bacteria 1913
344 Ga0207702_10214260 3300026078 Bacteria 1792
345 Ga0207702_10279072 3300026078 Bacteria 1579
346 Ga0207641_10000015 3300026088 Bacteria 321332
347 Ga0207641_10104832 3300026088 Bacteria 2497
348 Ga0207641_10347349 3300026088 Bacteria 1413
349 Ga0207648_10000075 3300026089 Bacteria 93756
350 Ga0207676_10034064 3300026095 Bacteria 3853
351 Ga0207674_10003864 3300026116 Bacteria 18258
352 Ga0207674_10035173 3300026116 Bacteria 5229
353 Ga0207683_10002554 3300026121 Bacteria 15884
354 Ga0207698_10002370 3300026142 Bacteria 11175
355 Ga0207698_10011897 3300026142 Bacteria 5666
356 Ga0207428_10092014 3300027907 Bacteria 2354
357 Ga0268266_10000195 3300028379 Bacteria 105788
358 Ga0268264_10006198 3300028381 Bacteria 10098
359 Ga0265337_1001468 3300028556 Bacteria 11548
360 Ga0265337_1004220 3300028556 Bacteria 6016
361 Ga0265337_1018602 3300028556 Bacteria 2204
362 Ga0265337_1029255 3300028556 Bacteria 1648
363 Ga0265319_1012654 3300028563 Bacteria 3398
364 Ga0265334_10012854 3300028573 Bacteria 3510
365 Ga0265334_10054499 3300028573 Bacteria 1525
366 Ga0265323_10012987 3300028653 Bacteria 3330
367 Ga0265323_10025579 3300028653 Bacteria 2232
368 Ga0265336_10005438 3300028666 Bacteria 4694
369 Ga0265336_10044228 3300028666 Bacteria 1355
370 Ga0307517_10000335 3300028786 Bacteria 81908
371 Ga0307515_10000528 3300028794 Bacteria 90438
372 Ga0307515_10003943 3300028794 Bacteria 30968
373 Ga0307515_10109008 3300028794 Bacteria 3257
374 Ga0307515_10123215 3300028794 Bacteria 2918
375 Ga0265338_10000016 3300028800 Bacteria 347424
376 Ga0265338_10000111 3300028800 Bacteria 151469
377 Ga0265338_10000382 3300028800 Bacteria 79298
378 Ga0265338_10000510 3300028800 Bacteria 68748
379 Ga0265338_10003109 3300028800 Bacteria 23752
380 Ga0265338_10003369 3300028800 Bacteria 22563
381 Ga0265338_10003690 3300028800 Bacteria 21328
382 Ga0265338_10005161 3300028800 Bacteria 17170
383 Ga0265338_10007043 3300028800 Bacteria 14104
384 Ga0265338_10018926 3300028800 Bacteria 7342
385 Ga0265338_10037030 3300028800 Bacteria 4653
386 Ga0265338_10038589 3300028800 Bacteria 4521
387 Ga0265338_10040143 3300028800 Bacteria 4400
388 Ga0265338_10050076 3300028800 Bacteria 3779
389 Ga0265338_10124118 3300028800 Bacteria 2052
390 Ga0265338_10140858 3300028800 Bacteria 1889
391 Ga0265338_10153931 3300028800 Bacteria 1783
392 Ga0265338_10305366 3300028800 Bacteria 1155
393 Ga0265324_10001661 3300029957 Bacteria 12308
394 Ga0265324_10001805 3300029957 Bacteria 11634
395 Ga0265324_10002570 3300029957 Bacteria 9162
396 Ga0265324_10005257 3300029957 Bacteria 5628
397 Ga0265324_10043394 3300029957 Bacteria 1552
398 Ga0316177_1191726 3300030731 Bacteria 13692
399 Ga0316176_1138145 3300030732 Bacteria 6542
400 Ga0316183_1037277 3300030742 Bacteria 60977
401 Ga0316181_1123353 3300030744 Bacteria 27179
402 Ga0265320_10000572 3300031240 Bacteria 28290
403 Ga0265320_10001941 3300031240 Bacteria 14613
404 Ga0265320_10056739 3300031240 Bacteria 1881
405 Ga0265320_10089068 3300031240 Bacteria 1431
406 Ga0265325_10002864 3300031241 Bacteria 11500
407 Ga0265325_10047547 3300031241 Bacteria 2220
408 Ga0265329_10051913 3300031242 Bacteria 1305
409 Ga0265340_10006048 3300031247 Bacteria 6672
410 Ga0265340_10006637 3300031247 Bacteria 6347
411 Ga0265339_10021164 3300031249 Bacteria 3789
412 Ga0265331_10023224 3300031250 Bacteria 3154
413 Ga0265327_10000709 3300031251 Bacteria 52606
414 Ga0265327_10003147 3300031251 Bacteria 16190
415 Ga0265316_10006780 3300031344 Bacteria 10900
416 Ga0265316_10008622 3300031344 Bacteria 9443
417 Ga0265316_10033857 3300031344 Bacteria 4156
418 Ga0265316_10055751 3300031344 Bacteria 3090
419 Ga0265316_10137515 3300031344 Bacteria 1837
420 Ga0265316_10138974 3300031344 Bacteria 1826
421 Ga0307509_10033314 3300031507 Bacteria 5672
422 Ga0307408_100000164 3300031548 Bacteria 73855
423 Ga0307408_100001486 3300031548 Bacteria 17405
424 Ga0265313_10000385 3300031595 Bacteria 47503
425 Ga0265313_10000877 3300031595 Bacteria 30400
426 Ga0265314_10000088 3300031711 Bacteria 138315
427 Ga0265314_10006238 3300031711 Bacteria 10586
428 Ga0265314_10056731 3300031711 Bacteria 2694
429 Ga0265342_10072777 3300031712 Bacteria 2000
430 Ga0307405_10000045 3300031731 Bacteria 71537
431 Ga0307405_10104337 3300031731 Bacteria 1907
432 Ga0307407_10000002 3300031903 Bacteria 323084
433 Ga0307412_10000001 3300031911 Bacteria 822691
434 Ga0307412_10000697 3300031911 Bacteria 19377
435 Ga0307412_10065524 3300031911 Bacteria 2459
436 Ga0307412_10074025 3300031911 Bacteria 2333
437 Ga0307412_10083239 3300031911 Bacteria 2217
438 Ga0307409_100004241 3300031995 Bacteria 8003
439 Ga0307409_100280770 3300031995 Bacteria 1539
440 Ga0307416_100000005 3300032002 Bacteria 477728
441 Ga0307414_10000952 3300032004 Bacteria 14793
442 Ga0307414_10017292 3300032004 Bacteria 4408
443 Ga0307414_10023579 3300032004 Bacteria 3906
444 Ga0307414_10028685 3300032004 Bacteria 3613
445 Ga0307414_10029693 3300032004 Bacteria 3562
446 Ga0307414_10031226 3300032004 Bacteria 3492
447 Ga0307414_10083648 3300032004 Bacteria 2344
448 Ga0307414_10151972 3300032004 Bacteria 1827
449 Ga0307507_10001000 3300033179 Bacteria 62890
450 Ga0307510_10002118 3300033180 Bacteria 22455
451 Ga0373950_0015370 3300034818 Bacteria 1297
452 Ga0373928_0000099 3300035084 Bacteria 15539
453 Ga0373929_0000255 3300035085 Bacteria 9860
454 Ga0373944_0000221 3300035089 Bacteria 12292
455 Ga0373951_0010052 3300035091 Bacteria 2123
456 Ga0373952_0021056 3300035092 Bacteria 1373
457 Ga0373932_0000001 3300035112 Bacteria 1459067
458 Ga0373954_0070522 3300035118 Bacteria 1660
459 Ga0373962_0000025 3300035242 Bacteria 39712
460 Ga0373924_0097339 3300035410 Bacteria 1264
461 Ga0373931_0000004 3300035691 Bacteria 535140
462 Ga0373935_0190246 3300035692 Bacteria 1413
463 Ga0373927_0025476 3300035695 Bacteria 3868
464 Ga0373947_0169275 3300035725 Bacteria 1417
465 Ga0373937_0045011 3300036401 Bacteria 4032
466 Ga0373937_0223162 3300036401 Bacteria 1774
467 Ga0373925_0002234 3300037068 Bacteria 15717
468 Ga0373925_0003683 3300037068 Bacteria 11784
469 Ga0373925_0017992 3300037068 Bacteria 5132
470 Ga0373925_0072241 3300037068 Bacteria 2611
471 Ga0373925_0146157 3300037068 Bacteria 1854
472 Ga0395899_0000017 3300037312 Bacteria 440179
473 Ga0395899_0000152 3300037312 Bacteria 105233
474 Ga0395899_0023158 3300037312 Bacteria 4707
475 Ga0395899_0153716 3300037312 Bacteria 1629
476 Ga0395900_0000288 3300037418 Bacteria 75715
477 Ga0395900_0003963 3300037418 Bacteria 15800
478 Ga0395900_0009792 3300037418 Bacteria 9821
479 Ga0395900_0023483 3300037418 Bacteria 6311
480 Ga0395900_0027143 3300037418 Bacteria 5862
481 Ga0395900_0099655 3300037418 Bacteria 2984
482 Ga0395898_0003999 3300037466 Bacteria 16224
483 Ga0395898_0045114 3300037466 Bacteria 4334
484 Ga0395898_0150420 3300037466 Bacteria 2228
485 Ga0395905_0000001 3300037471 Bacteria 2037079
486 Ga0395905_0000411 3300037471 Bacteria 60254
487 Ga0395905_0029207 3300037471 Bacteria 5196
488 Ga0395905_0157834 3300037471 Bacteria 2133
489 Ga0395901_0158625 3300038443 Bacteria 2376
490 Ga0436361_1111083 3300039447 Bacteria 43355
491 Ga0439448_0004770 3300042005 Bacteria 3838
492 Ga0451577_0022119 3300042876 Bacteria 5808
493 Ga0451577_0110484 3300042876 Bacteria 2459
494 Ga0466969_0159152 3300044656 Bacteria 1038
495 Ga0453683_0070290 3300044673 Bacteria 2189
496 Ga0466966_0062890 3300044684 Bacteria 2339
497 Ga0453684_0000666 3300044712 Bacteria 122914
498 Ga0453684_0002068 3300044712 Bacteria 51026
499 Ga0453684_0006469 3300044712 Bacteria 22230
500 Ga0453684_0247057 3300044712 Bacteria 2051
501 Ga0453684_0287358 3300044712 Bacteria 1874
502 Ga0453684_0614054 3300044712 Bacteria 1190
503 Ga0466970_0207038 3300044765 Bacteria 1092
504 Ga0466959_0000904 3300045049 Bacteria 17527
505 Ga0466959_0109921 3300045049 Bacteria 1968
506 Ga0451576_0073698 3300045051 Bacteria 3553
507 Ga0451576_0079289 3300045051 Bacteria 3417
508 Ga0451576_0158335 3300045051 Bacteria 2363
509 Ga0451576_0159041 3300045051 Bacteria 2357
510 Ga0451576_0173520 3300045051 Bacteria 2251
511 Ga0451576_0184209 3300045051 Bacteria 2180
512 Ga0495627_006048 3300046453 Bacteria 4789
513 Ga0495592_0001478 3300046454 Bacteria 16346
514 Ga0495629_0177805 3300046459 Bacteria 1475
515 Ga0495641_0041411 3300046461 Bacteria 2140
516 Ga0495641_0086817 3300046461 Bacteria 1400
517 Ga0495651_0064117 3300046462 Bacteria 2808
518 Ga0495651_0138642 3300046462 Bacteria 1767
519 Ga0495651_0193513 3300046462 Bacteria 1429
520 Ga0495650_0000095 3300046471 Bacteria 218020
521 Ga0495650_0042565 3300046471 Bacteria 1933
522 Ga0495582_0005670 3300046473 Bacteria 6951
523 Ga0495582_0046260 3300046473 Bacteria 2397
524 Ga0495639_0011879 3300046475 Bacteria 3755
525 Ga0495662_0014709 3300046476 Bacteria 3804
526 Ga0495662_0034371 3300046476 Bacteria 2447
527 Ga0495664_0020589 3300046477 Bacteria 3805
528 Ga0495585_0000034 3300046492 Bacteria 143120
529 Ga0495585_0000313 3300046492 Bacteria 48193
530 Ga0495594_0135453 3300046499 Bacteria 1396
531 Ga0495596_0008189 3300046500 Bacteria 4665
532 Ga0495583_0012709 3300046506 Bacteria 4743
533 Ga0495606_0000009 3300046507 Bacteria 306313
534 Ga0495606_0003788 3300046507 Bacteria 15717
535 Ga0495606_0005118 3300046507 Bacteria 12730
536 Ga0495606_0053385 3300046507 Bacteria 2623
537 Ga0495610_0000084 3300046512 Bacteria 112459
538 Ga0495610_0000284 3300046512 Bacteria 52953
539 Ga0495610_0010992 3300046512 Bacteria 5571
540 Ga0495616_0007971 3300046513 Bacteria 6314
541 Ga0495618_0003873 3300046514 Bacteria 9247
542 Ga0495618_0005940 3300046514 Bacteria 7417
543 Ga0495618_0136909 3300046514 Bacteria 1566
544 Ga0495618_0174558 3300046514 Bacteria 1367
545 Ga0495628_0000259 3300046516 Bacteria 47040
546 Ga0495628_0139483 3300046516 Bacteria 1851
547 Ga0495630_0000022 3300046517 Bacteria 172932
548 Ga0495630_0003017 3300046517 Bacteria 11675
549 Ga0495632_0068031 3300046519 Bacteria 1717
550 Ga0495637_0008889 3300046520 Bacteria 4916
551 Ga0495648_0028569 3300046524 Bacteria 3713
552 Ga0495648_0041493 3300046524 Bacteria 2905
553 Ga0495666_0006800 3300046526 Bacteria 5742
554 Ga0495666_0027801 3300046526 Bacteria 2784
555 Ga0495652_0060960 3300046529 Bacteria 3186
556 Ga0495652_0210706 3300046529 Bacteria 1467
557 Ga0495665_0084701 3300046531 Bacteria 1666
558 Ga0495640_0038668 3300046533 Bacteria 3355
559 Ga0495640_0139665 3300046533 Bacteria 1562
560 Ga0495586_0000010 3300046535 Bacteria 143135
561 Ga0495586_0002456 3300046535 Bacteria 10060
562 Ga0495586_0003939 3300046535 Bacteria 7969
563 Ga0495586_0010549 3300046535 Bacteria 4915
564 Ga0495586_0117779 3300046535 Bacteria 1482
565 Ga0495609_0004648 3300046538 Bacteria 7452
566 Ga0495609_0034905 3300046538 Bacteria 2278
567 Ga0495645_0009644 3300046543 Bacteria 6752
568 Ga0495645_0094963 3300046543 Bacteria 2126
569 Ga0495622_0060332 3300046557 Bacteria 1756
570 Ga0495633_0000074 3300046558 Bacteria 130197
571 Ga0495633_0002697 3300046558 Bacteria 12319
572 Ga0495667_0087243 3300046559 Bacteria 2024
573 Ga0495667_0126703 3300046559 Bacteria 1647
574 Ga0495668_0000017 3300046616 Bacteria 434025
575 Ga0495634_0012813 3300046642 Bacteria 6069
576 Ga0495634_0019154 3300046642 Bacteria 4864
577 Ga0495634_0033495 3300046642 Bacteria 3530
578 Ga0495634_0256227 3300046642 Bacteria 1069
579 Ga0495625_0000007 3300046660 Bacteria 565749
580 Ga0495625_0000679 3300046660 Bacteria 48394
581 Ga0495625_0006979 3300046660 Bacteria 9959
582 Ga0495625_0016119 3300046660 Bacteria 5888
583 Ga0495625_0063646 3300046660 Bacteria 2604
584 Ga0495661_0002451 3300046665 Bacteria 14291
585 Ga0495661_0026532 3300046665 Bacteria 3730
586 Ga0495661_0034563 3300046665 Bacteria 3179
587 Ga0495657_0104589 3300046675 Bacteria 1800
588 Ga0495599_0009937 3300046678 Bacteria 5824
589 Ga0495599_0031489 3300046678 Bacteria 3329
590 Ga0495647_0032145 3300046681 Bacteria 1954
591 Ga0495658_0002493 3300046683 Bacteria 9260
592 Ga0495658_0086069 3300046683 Bacteria 1854
593 Ga0495613_0001553 3300046689 Bacteria 17447
594 Ga0495613_0026757 3300046689 Bacteria 4296
595 Ga0495613_0086794 3300046689 Bacteria 2268
596 Ga0495624_0015060 3300046690 Bacteria 5235
597 Ga0495649_0000007 3300046694 Bacteria 518037
598 Ga0495589_0058180 3300046794 Bacteria 1901
599 Ga0495660_0003408 3300046810 Bacteria 9840
600 Ga0495674_0002044 3300047319 Bacteria 19794
601 Ga0495674_0043964 3300047319 Bacteria 3972
602 Ga0495674_0112958 3300047319 Bacteria 2301
603 Ga0495676_0002247 3300047321 Bacteria 17137
604 Ga0495680_0007636 3300047322 Bacteria 9874
605 Ga0495680_0103084 3300047322 Bacteria 2124
606 Ga0495683_0038745 3300047323 Bacteria 2412
607 Ga0495687_000713 3300047443 Bacteria 36805
608 Ga0495687_000846 3300047443 Bacteria 32608
609 Ga0495687_063602 3300047443 Bacteria 1510
610 Ga0495677_0012175 3300047445 Bacteria 3139
611 Ga0495679_018985 3300047446 Bacteria 2426
612 Ga0495681_0024609 3300047470 Bacteria 3166
613 Ga0495684_0083088 3300047471 Bacteria 2429
614 Ga0495686_0000614 3300047472 Bacteria 49242
615 Ga0495686_0001530 3300047472 Bacteria 24840
616 Ga0495686_0011382 3300047472 Bacteria 6271
617 Ga0495686_0017078 3300047472 Bacteria 4900
618 Ga0495686_0046647 3300047472 Bacteria 2738
619 Ga0495686_0101303 3300047472 Bacteria 1737
620 Ga0495686_0122018 3300047472 Bacteria 1552
621 Ga0495614_0014793 3300048089 Bacteria 3413
622 Ga0496107_0118359 3300048910 Bacteria 1950
623 Ga0496115_0017883 3300048918 Bacteria 5430
624 Ga0496117_0000995 3300048920 Bacteria 43366
625 Ga0496118_0012921 3300048921 Bacteria 7952
626 Ga0496122_0000783 3300048925 Bacteria 61156
627 Ga0496123_0002343 3300048926 Bacteria 23754
628 Ga0496123_0016507 3300048926 Bacteria 5993
629 Ga0495678_016616 3300049459 Bacteria 3360
630 Ga0501031_0000004 3300049568 Bacteria 202781
631 Ga0501031_0000943 3300049568 Bacteria 17580
632 Ga0501032_0006393 3300049569 Bacteria 8672
633 Ga0501033_0009792 3300049570 Bacteria 7360
634 Ga0501033_0011702 3300049570 Bacteria 6709
635 Ga0501033_0015555 3300049570 Bacteria 5770
636 Ga0501033_0046578 3300049570 Bacteria 3224
637 Ga0501223_001133 3300049663 Bacteria 6275
638 Ga0501249_013449 3300049679 Bacteria 1739
639 Ga0501083_0091383 3300049744 Bacteria 2010
640 Ga0501044_0000129 3300049823 Bacteria 92557
641 Ga0501044_0001072 3300049823 Bacteria 32802
642 nmdc:mga0k408_3924_c1 3300050493 Bacteria 7887
643 nmdc:mga0k408_397_c1 3300050493 Bacteria 23845
644 nmdc:mga07m45_104785_c1 3300050496 Bacteria 1626
645 nmdc:mga06r32_186339_c1 3300050510 Bacteria 2062
646 nmdc:mga06r32_285072_c1 3300050510 Bacteria 1638
647 nmdc:mga08y16_195371_c1 3300050511 Bacteria 2097
648 nmdc:mga08y16_2114_c1 3300050511 Bacteria 20363
649 nmdc:mga0n895_122730_c1 3300050512 Bacteria 2619
650 nmdc:mga0n895_155341_c1 3300050512 Bacteria 2318
651 Ga0500635_0006761 3300053080 Bacteria 3077
652 Ga0500651_0000951 3300053093 Bacteria 14237
653 Ga0500650_0000633 3300053098 Bacteria 9230
654 Ga0500608_000220 3300053122 Bacteria 22523
655 Ga0500608_002387 3300053122 Bacteria 6825
656 Ga0500614_009600 3300053123 Bacteria 2065
657 Ga0500618_000011 3300053125 Bacteria 198091
658 Ga0500642_0012313 3300053130 Bacteria 3097
659 Ga0500622_0003794 3300053156 Bacteria 9841
660 Ga0500624_000183 3300053157 Bacteria 24891

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025960 Ga0207651_10561718 Ga0207651_105617181 292
2 3300002067 JGI24735J21928_10013453 JGI24735J21928_100134531 303
3 3300044712 Ga0453684_0000666 Ga0453684_0000666_33175_34098 307
4 3300035410 Ga0373924_0097339 Ga0373924_0097339_192_1151 311
5 3300013308 Ga0157375_10000111 Ga0157375_100001113 312
6 3300028556 Ga0265337_1029255 Ga0265337_10292552 312
7 3300029957 Ga0265324_10001805 Ga0265324_100018052 312
8 3300031344 Ga0265316_10138974 Ga0265316_101389742 312
9 3300036401 Ga0373937_0223162 Ga0373937_0223162_235_1197 312
10 3300037068 Ga0373925_0146157 Ga0373925_0146157_720_1682 312
11 3300044712 Ga0453684_0614054 Ga0453684_0614054_214_1152 312
12 3300045051 Ga0451576_0173520 Ga0451576_0173520_1244_2218 312
13 3300046462 Ga0495651_0064117 Ga0495651_0064117_201_1163 312
14 3300046475 Ga0495639_0011879 Ga0495639_0011879_12_986 312
15 3300028800 Ga0265338_10000510 Ga0265338_1000051016 313
16 3300028800 Ga0265338_10140858 Ga0265338_101408581 313
17 3300031247 Ga0265340_10006637 Ga0265340_100066371 313
18 3300046543 Ga0495645_0094963 Ga0495645_0094963_52_1017 313
19 3300046689 Ga0495613_0086794 Ga0495613_0086794_1260_2225 313
20 3300005563 Ga0068855_100378355 Ga0068855_1003783552 314
21 3300025949 Ga0207667_10100335 Ga0207667_101003353 314
22 3300028556 Ga0265337_1004220 Ga0265337_10042201 314
23 3300028573 Ga0265334_10012854 Ga0265334_100128541 314
24 3300028666 Ga0265336_10044228 Ga0265336_100442282 314
25 3300028800 Ga0265338_10000111 Ga0265338_1000011140 314
26 3300028800 Ga0265338_10124118 Ga0265338_101241182 314
27 3300029957 Ga0265324_10001661 Ga0265324_100016617 314
28 3300053098 Ga0500650_0000633 Ga0500650_0000633_5376_6356 314
29 3300045051 Ga0451576_0159041 Ga0451576_0159041_1355_2338 315
30 3300025909 Ga0207705_10086874 Ga0207705_100868743 318
31 3300044656 Ga0466969_0159152 Ga0466969_0159152_26_982 318
32 3300045051 Ga0451576_0184209 Ga0451576_0184209_151_1155 318
33 3300046665 Ga0495661_0026532 Ga0495661_0026532_2759_3715 318
34 3300005616 Ga0068852_100016582 Ga0068852_1000165826 319
35 3300014325 Ga0163163_10000020 Ga0163163_10000020125 319
36 3300005340 Ga0070689_100052373 Ga0070689_1000523733 320
37 3300042876 Ga0451577_0022119 Ga0451577_0022119_713_1699 320
38 3300044673 Ga0453683_0070290 Ga0453683_0070290_728_1690 320
39 3300044712 Ga0453684_0002068 Ga0453684_0002068_43191_44177 320
40 3300046642 Ga0495634_0256227 Ga0495634_0256227_40_1056 320
41 3300031251 Ga0265327_10003147 Ga0265327_1000314712 321
42 3300042876 Ga0451577_0110484 Ga0451577_0110484_1243_2274 321
43 3300044712 Ga0453684_0247057 Ga0453684_0247057_478_1509 321
44 3300046462 Ga0495651_0138642 Ga0495651_0138642_473_1477 321
45 3300048910 Ga0496107_0118359 Ga0496107_0118359_265_1269 321
46 3300028573 Ga0265334_10054499 Ga0265334_100544991 322
47 3300031712 Ga0265342_10072777 Ga0265342_100727772 322
48 3300032004 Ga0307414_10023579 Ga0307414_100235791 322
49 3300005340 Ga0070689_100002402 Ga0070689_1000024026 323
50 3300005343 Ga0070687_100026314 Ga0070687_1000263142 323
51 3300005438 Ga0070701_10107227 Ga0070701_101072272 323
52 3300005444 Ga0070694_100141549 Ga0070694_1001415492 323
53 3300005458 Ga0070681_10184017 Ga0070681_101840172 323
54 3300005539 Ga0068853_100067797 Ga0068853_1000677972 323
55 3300005549 Ga0070704_100012892 Ga0070704_1000128923 323
56 3300005563 Ga0068855_100074415 Ga0068855_1000744153 323
57 3300005617 Ga0068859_100130718 Ga0068859_1001307181 323
58 3300006880 Ga0075429_100044531 Ga0075429_1000445313 323
59 3300006931 Ga0097620_100130717 Ga0097620_1001307171 323
60 3300009094 Ga0111539_10115364 Ga0111539_101153644 323
61 3300009551 Ga0105238_10042318 Ga0105238_100423185 323
62 3300013104 Ga0157370_10080937 Ga0157370_100809373 323
63 3300014968 Ga0157379_10303909 Ga0157379_103039091 323
64 3300025910 Ga0207684_10340196 Ga0207684_103401961 323
65 3300025912 Ga0207707_10010673 Ga0207707_100106732 323
66 3300025924 Ga0207694_10087138 Ga0207694_100871383 323
67 3300025949 Ga0207667_10171493 Ga0207667_101714932 323
68 3300025960 Ga0207651_10530990 Ga0207651_105309901 323
69 3300026078 Ga0207702_10027834 Ga0207702_100278342 323
70 3300037068 Ga0373925_0003683 Ga0373925_0003683_4371_5390 323
71 3300049568 Ga0501031_0000943 Ga0501031_0000943_12085_13110 323
72 3300049570 Ga0501033_0011702 Ga0501033_0011702_669_1694 323
73 3300049744 Ga0501083_0091383 Ga0501083_0091383_891_1889 323
74 3300049823 Ga0501044_0000129 Ga0501044_0000129_54882_55907 323
75 3300005544 Ga0070686_100026851 Ga0070686_1000268512 324
76 3300005577 Ga0068857_100004246 Ga0068857_1000042465 324
77 3300006847 Ga0075431_100171401 Ga0075431_1001714012 324
78 3300009093 Ga0105240_10000872 Ga0105240_1000087219 324
79 3300009093 Ga0105240_10423339 Ga0105240_104233391 324
80 3300009094 Ga0111539_10002005 Ga0111539_1000200518 324
81 3300009094 Ga0111539_10090431 Ga0111539_100904312 324
82 3300009094 Ga0111539_10466816 Ga0111539_104668162 324
83 3300009545 Ga0105237_10400352 Ga0105237_104003521 324
84 3300013104 Ga0157370_10108413 Ga0157370_101084132 324
85 3300013307 Ga0157372_10069770 Ga0157372_100697704 324
86 3300014325 Ga0163163_10102041 Ga0163163_101020413 324
87 3300014325 Ga0163163_10316019 Ga0163163_103160192 324
88 3300025913 Ga0207695_10020975 Ga0207695_100209754 324
89 3300025944 Ga0207661_10202003 Ga0207661_102020031 324
90 3300026116 Ga0207674_10003864 Ga0207674_100038646 324
91 3300027907 Ga0207428_10092014 Ga0207428_100920143 324
92 3300028653 Ga0265323_10012987 Ga0265323_100129873 324
93 3300028800 Ga0265338_10000016 Ga0265338_10000016217 324
94 3300028800 Ga0265338_10007043 Ga0265338_1000704312 324
95 3300028800 Ga0265338_10038589 Ga0265338_100385892 324
96 3300028800 Ga0265338_10050076 Ga0265338_100500762 324
97 3300029957 Ga0265324_10002570 Ga0265324_100025708 324
98 3300031344 Ga0265316_10055751 Ga0265316_100557511 324
99 3300031711 Ga0265314_10000088 Ga0265314_1000008857 324
100 3300031911 Ga0307412_10074025 Ga0307412_100740252 324
101 3300044712 Ga0453684_0006469 Ga0453684_0006469_20325_21347 324
102 3300045051 Ga0451576_0158335 Ga0451576_0158335_366_1388 324
103 3300046461 Ga0495641_0086817 Ga0495641_0086817_25_1047 324
104 3300046462 Ga0495651_0193513 Ga0495651_0193513_249_1271 324
105 3300046473 Ga0495582_0005670 Ga0495582_0005670_2761_3783 324
106 3300046476 Ga0495662_0014709 Ga0495662_0014709_1296_2318 324
107 3300046499 Ga0495594_0135453 Ga0495594_0135453_16_1038 324
108 3300046514 Ga0495618_0136909 Ga0495618_0136909_27_1049 324
109 3300046516 Ga0495628_0139483 Ga0495628_0139483_800_1798 324
110 3300046517 Ga0495630_0000022 Ga0495630_0000022_104791_105813 324
111 3300046526 Ga0495666_0006800 Ga0495666_0006800_4344_5366 324
112 3300046529 Ga0495652_0210706 Ga0495652_0210706_162_1184 324
113 3300046531 Ga0495665_0084701 Ga0495665_0084701_448_1470 324
114 3300046535 Ga0495586_0000010 Ga0495586_0000010_66392_67414 324
115 3300046642 Ga0495634_0012813 Ga0495634_0012813_3393_4415 324
116 3300046642 Ga0495634_0033495 Ga0495634_0033495_1414_2436 324
117 3300046678 Ga0495599_0031489 Ga0495599_0031489_1536_2558 324
118 3300046681 Ga0495647_0032145 Ga0495647_0032145_843_1865 324
119 3300046689 Ga0495613_0026757 Ga0495613_0026757_1198_2220 324
120 3300047319 Ga0495674_0002044 Ga0495674_0002044_842_1864 324
121 3300047319 Ga0495674_0043964 Ga0495674_0043964_2097_3119 324
122 3300047321 Ga0495676_0002247 Ga0495676_0002247_1615_2637 324
123 3300050510 nmdc:mga06r32_285072_c1 nmdc:mga06r32_285072_c1_215_1216 324
124 3300050511 nmdc:mga08y16_195371_c1 nmdc:mga08y16_195371_c1_992_1993 324
125 3300050511 nmdc:mga08y16_2114_c1 nmdc:mga08y16_2114_c1_7282_8283 324
126 3300003320 rootH2_10055718 rootH2_100557181 325
127 3300003323 rootH1_10066500 rootH1_100665007 325
128 3300005327 Ga0070658_10094307 Ga0070658_100943071 325
129 3300005340 Ga0070689_100023414 Ga0070689_1000234142 325
130 3300005435 Ga0070714_100007178 Ga0070714_1000071787 325
131 3300005458 Ga0070681_10033602 Ga0070681_100336024 325
132 3300005563 Ga0068855_100029065 Ga0068855_1000290655 325
133 3300005841 Ga0068863_100243144 Ga0068863_1002431443 325
134 3300006237 Ga0097621_100054503 Ga0097621_1000545034 325
135 3300006358 Ga0068871_100168833 Ga0068871_1001688332 325
136 3300006871 Ga0075434_100178372 Ga0075434_1001783723 325
137 3300009093 Ga0105240_10026212 Ga0105240_100262125 325
138 3300009174 Ga0105241_10229382 Ga0105241_102293822 325
139 3300009545 Ga0105237_10009180 Ga0105237_100091809 325
140 3300013104 Ga0157370_10122274 Ga0157370_101222742 325
141 3300013307 Ga0157372_10003224 Ga0157372_100032249 325
142 3300013308 Ga0157375_10371713 Ga0157375_103717131 325
143 3300025904 Ga0207647_10032159 Ga0207647_100321593 325
144 3300025912 Ga0207707_10027491 Ga0207707_100274912 325
145 3300025913 Ga0207695_10079432 Ga0207695_100794323 325
146 3300025914 Ga0207671_10008901 Ga0207671_100089013 325
147 3300025919 Ga0207657_10099972 Ga0207657_100999722 325
148 3300025921 Ga0207652_10000187 Ga0207652_1000018764 325
149 3300025929 Ga0207664_10007731 Ga0207664_100077315 325
150 3300025949 Ga0207667_10000492 Ga0207667_1000049233 325
151 3300026088 Ga0207641_10347349 Ga0207641_103473491 325
152 3300028556 Ga0265337_1018602 Ga0265337_10186021 325
153 3300028666 Ga0265336_10005438 Ga0265336_100054382 325
154 3300028800 Ga0265338_10003109 Ga0265338_100031098 325
155 3300028800 Ga0265338_10005161 Ga0265338_100051614 325
156 3300028800 Ga0265338_10037030 Ga0265338_100370303 325
157 3300031240 Ga0265320_10056739 Ga0265320_100567392 325
158 3300031344 Ga0265316_10008622 Ga0265316_100086229 325
159 3300031344 Ga0265316_10033857 Ga0265316_100338573 325
160 3300035725 Ga0373947_0169275 Ga0373947_0169275_193_1227 325
161 3300037068 Ga0373925_0072241 Ga0373925_0072241_1042_2067 325
162 3300037418 Ga0395900_0027143 Ga0395900_0027143_2788_3798 325
163 3300037418 Ga0395900_0099655 Ga0395900_0099655_1162_2172 325
164 3300037466 Ga0395898_0003999 Ga0395898_0003999_9786_10796 325
165 3300044712 Ga0453684_0287358 Ga0453684_0287358_292_1320 325
166 3300045051 Ga0451576_0073698 Ga0451576_0073698_115_1143 325
167 3300045051 Ga0451576_0079289 Ga0451576_0079289_2282_3307 325
168 3300046461 Ga0495641_0041411 Ga0495641_0041411_315_1340 325
169 3300046473 Ga0495582_0046260 Ga0495582_0046260_446_1471 325
170 3300046535 Ga0495586_0002456 Ga0495586_0002456_3913_4938 325
171 3300046683 Ga0495658_0002493 Ga0495658_0002493_3494_4519 325
172 3300047471 Ga0495684_0083088 Ga0495684_0083088_1393_2418 325
173 3300049570 Ga0501033_0015555 Ga0501033_0015555_245_1270 325
174 3300050512 nmdc:mga0n895_122730_c1 nmdc:mga0n895_122730_c1_414_1439 325
175 3300053125 Ga0500618_000011 Ga0500618_000011_80124_81116 325
176 3300005330 Ga0070690_100255051 Ga0070690_1002550511 326
177 3300005340 Ga0070689_100003633 Ga0070689_1000036332 326
178 3300005439 Ga0070711_100005204 Ga0070711_1000052045 326
179 3300005563 Ga0068855_100424675 Ga0068855_1004246751 326
180 3300005614 Ga0068856_100000067 Ga0068856_10000006739 326
181 3300005614 Ga0068856_100015211 Ga0068856_1000152115 326
182 3300005614 Ga0068856_100366229 Ga0068856_1003662292 326
183 3300005617 Ga0068859_100259507 Ga0068859_1002595072 326
184 3300005841 Ga0068863_100344341 Ga0068863_1003443412 326
185 3300006871 Ga0075434_100136277 Ga0075434_1001362772 326
186 3300006931 Ga0097620_100259520 Ga0097620_1002595202 326
187 3300009094 Ga0111539_10097277 Ga0111539_100972776 326
188 3300009551 Ga0105238_10034231 Ga0105238_100342313 326
189 3300009551 Ga0105238_10052272 Ga0105238_100522722 326
190 3300025916 Ga0207663_10009269 Ga0207663_100092694 326
191 3300025924 Ga0207694_10018133 Ga0207694_100181333 326
192 3300025936 Ga0207670_10001839 Ga0207670_100018392 326
193 3300026078 Ga0207702_10001092 Ga0207702_100010926 326
194 3300026078 Ga0207702_10045049 Ga0207702_100450495 326
195 3300026088 Ga0207641_10104832 Ga0207641_101048322 326
196 3300028556 Ga0265337_1001468 Ga0265337_10014682 326
197 3300028563 Ga0265319_1012654 Ga0265319_10126544 326
198 3300028653 Ga0265323_10025579 Ga0265323_100255792 326
199 3300028800 Ga0265338_10000382 Ga0265338_1000038230 326
200 3300028800 Ga0265338_10003369 Ga0265338_100033692 326
201 3300028800 Ga0265338_10003690 Ga0265338_100036902 326
202 3300028800 Ga0265338_10018926 Ga0265338_100189266 326
203 3300028800 Ga0265338_10040143 Ga0265338_100401433 326
204 3300028800 Ga0265338_10153931 Ga0265338_101539311 326
205 3300029957 Ga0265324_10005257 Ga0265324_100052574 326
206 3300029957 Ga0265324_10043394 Ga0265324_100433942 326
207 3300031240 Ga0265320_10000572 Ga0265320_100005722 326
208 3300031240 Ga0265320_10001941 Ga0265320_1000194112 326
209 3300031240 Ga0265320_10089068 Ga0265320_100890682 326
210 3300031241 Ga0265325_10002864 Ga0265325_100028644 326
211 3300031241 Ga0265325_10047547 Ga0265325_100475472 326
212 3300031242 Ga0265329_10051913 Ga0265329_100519132 326
213 3300031247 Ga0265340_10006048 Ga0265340_100060488 326
214 3300031249 Ga0265339_10021164 Ga0265339_100211642 326
215 3300031250 Ga0265331_10023224 Ga0265331_100232242 326
216 3300031251 Ga0265327_10000709 Ga0265327_100007093 326
217 3300031344 Ga0265316_10006780 Ga0265316_100067806 326
218 3300031344 Ga0265316_10137515 Ga0265316_101375152 326
219 3300031595 Ga0265313_10000385 Ga0265313_1000038510 326
220 3300031595 Ga0265313_10000877 Ga0265313_1000087725 326
221 3300031711 Ga0265314_10006238 Ga0265314_100062386 326
222 3300031711 Ga0265314_10056731 Ga0265314_100567312 326
223 3300034818 Ga0373950_0015370 Ga0373950_0015370_159_1175 326
224 3300035084 Ga0373928_0000099 Ga0373928_0000099_5760_6776 326
225 3300035085 Ga0373929_0000255 Ga0373929_0000255_4214_5230 326
226 3300035089 Ga0373944_0000221 Ga0373944_0000221_272_1288 326
227 3300035091 Ga0373951_0010052 Ga0373951_0010052_470_1486 326
228 3300035092 Ga0373952_0021056 Ga0373952_0021056_224_1240 326
229 3300035112 Ga0373932_0000001 Ga0373932_0000001_201881_202897 326
230 3300035118 Ga0373954_0070522 Ga0373954_0070522_74_1114 326
231 3300035242 Ga0373962_0000025 Ga0373962_0000025_33634_34650 326
232 3300035691 Ga0373931_0000004 Ga0373931_0000004_201890_202906 326
233 3300035692 Ga0373935_0190246 Ga0373935_0190246_179_1195 326
234 3300035695 Ga0373927_0025476 Ga0373927_0025476_90_1106 326
235 3300036401 Ga0373937_0045011 Ga0373937_0045011_74_1114 326
236 3300037068 Ga0373925_0002234 Ga0373925_0002234_10531_11547 326
237 3300037068 Ga0373925_0017992 Ga0373925_0017992_1533_2549 326
238 3300046454 Ga0495592_0001478 Ga0495592_0001478_13701_14741 326
239 3300046459 Ga0495629_0177805 Ga0495629_0177805_135_1175 326
240 3300046476 Ga0495662_0034371 Ga0495662_0034371_750_1790 326
241 3300046477 Ga0495664_0020589 Ga0495664_0020589_694_1734 326
242 3300046514 Ga0495618_0003873 Ga0495618_0003873_2240_3280 326
243 3300046514 Ga0495618_0005940 Ga0495618_0005940_6175_7215 326
244 3300046516 Ga0495628_0000259 Ga0495628_0000259_29809_30849 326
245 3300046517 Ga0495630_0003017 Ga0495630_0003017_8501_9541 326
246 3300046526 Ga0495666_0027801 Ga0495666_0027801_103_1143 326
247 3300046529 Ga0495652_0060960 Ga0495652_0060960_501_1541 326
248 3300046533 Ga0495640_0038668 Ga0495640_0038668_376_1416 326
249 3300046533 Ga0495640_0139665 Ga0495640_0139665_134_1174 326
250 3300046535 Ga0495586_0003939 Ga0495586_0003939_2921_3961 326
251 3300046535 Ga0495586_0010549 Ga0495586_0010549_1971_3011 326
252 3300046535 Ga0495586_0117779 Ga0495586_0117779_80_1096 326
253 3300046543 Ga0495645_0009644 Ga0495645_0009644_5678_6718 326
254 3300046557 Ga0495622_0060332 Ga0495622_0060332_220_1236 326
255 3300046559 Ga0495667_0087243 Ga0495667_0087243_309_1349 326
256 3300046559 Ga0495667_0126703 Ga0495667_0126703_189_1205 326
257 3300046642 Ga0495634_0019154 Ga0495634_0019154_1929_2969 326
258 3300046675 Ga0495657_0104589 Ga0495657_0104589_711_1751 326
259 3300046678 Ga0495599_0009937 Ga0495599_0009937_154_1194 326
260 3300046683 Ga0495658_0086069 Ga0495658_0086069_411_1451 326
261 3300046689 Ga0495613_0001553 Ga0495613_0001553_6038_7078 326
262 3300046690 Ga0495624_0015060 Ga0495624_0015060_3679_4719 326
263 3300047319 Ga0495674_0112958 Ga0495674_0112958_377_1417 326
264 3300047322 Ga0495680_0007636 Ga0495680_0007636_5938_6978 326
265 3300047322 Ga0495680_0103084 Ga0495680_0103084_570_1586 326
266 3300049568 Ga0501031_0000004 Ga0501031_0000004_146454_147470 326
267 3300049569 Ga0501032_0006393 Ga0501032_0006393_7075_8091 326
268 3300049570 Ga0501033_0009792 Ga0501033_0009792_4026_5042 326
269 3300049570 Ga0501033_0046578 Ga0501033_0046578_2103_3119 326
270 3300049823 Ga0501044_0001072 Ga0501044_0001072_12591_13607 326
271 3300050510 nmdc:mga06r32_186339_c1 nmdc:mga06r32_186339_c1_242_1282 326
272 3300050512 nmdc:mga0n895_155341_c1 nmdc:mga0n895_155341_c1_956_1996 326
273 iso_pu_bacteria 2599185184 2599480804 326
274 iso_pu_bacteria 2738541284 2738761554 326
275 iso_pu_bacteria 2738543023 2739302926 326
276 iso_pu_bacteria 2775506987 2776615810 326
277 iso_pu_bacteria 2852623160 2852626562 326
278 iso_pu_bacteria 2884933994 2884934990 326
279 iso_pu_bacteria 2902048731 2902050563 326
280 iso_pu_bacteria 2919437846 2919439702 326
281 iso_pu_bacteria 2928078545 2928081700 326
282 iso_pu_bacteria 2928147474 2928150271 326
283 iso_pu_bacteria 2932082852 2932085098 326
284 iso_pu_bacteria 2977232053 2977234825 326
285 iso_pu_bacteria 2842903701 2842905093 327
286 3300013102 Ga0157371_10007977 Ga0157371_100079778 328
287 3300037471 Ga0395905_0000001 Ga0395905_0000001_1484503_1485492 328
288 iso_pu_bacteria 2585427687 2586207171 328
289 iso_pu_bacteria 2738541283 2738755780 328
290 iso_pu_bacteria 2738541302 2738852754 328
291 iso_pu_bacteria 2739367651 2739586679 328
292 iso_pu_bacteria 2739367663 2739645860 328
293 iso_pu_bacteria 2842722452 2842727135 328
294 iso_pu_bacteria 2842909656 2842910863 328
295 iso_pu_bacteria 2849281842 2849284074 328
296 iso_pu_bacteria 2852627209 2852628017 328
297 iso_pu_bacteria 2857627736 2857628048 328
298 iso_pu_bacteria 2890737413 2890738736 328
299 iso_pu_bacteria 2896317667 2896320307 328
300 iso_pu_bacteria 2896344016 2896344839 328
301 iso_pu_bacteria 2898713307 2898714666 328
302 iso_pu_bacteria 2904445276 2904449734 328
303 iso_pu_bacteria 2919186247 2919188375 328
304 iso_pu_bacteria 2939664404 2939667540 328
305 iso_pu_bacteria 2945997725 2945998034 328
306 iso_pu_bacteria 2954016120 2954020495 328
307 iso_pu_bacteria 3003233435 3003236240 328
308 3300009148 Ga0105243_10000046 Ga0105243_1000004678 329
309 3300025935 Ga0207709_10000020 Ga0207709_10000020264 329
310 3300030731 Ga0316177_1191726 Ga0316177_11917266 329
311 3300030732 Ga0316176_1138145 Ga0316176_11381451 329
312 3300030742 Ga0316183_1037277 Ga0316183_103727712 329
313 3300030744 Ga0316181_1123353 Ga0316181_11233538 329
314 3300048920 Ga0496117_0000995 Ga0496117_0000995_36317_37312 329
315 3300048921 Ga0496118_0012921 Ga0496118_0012921_1955_2950 329
316 3300048926 Ga0496123_0016507 Ga0496123_0016507_1904_2899 329
317 iso_pu_bacteria 2721755487 2722731254 329
318 iso_pu_bacteria 2904780799 2904782330 329
319 iso_pu_bacteria 2919177583 2919178472 329
320 iso_pu_bacteria 8055588893 8055591461 329
321 2162886007 SwRhRL2b_contig_1075644 SwRhRL2b_0285.00004780 330
322 2162886007 SwRhRL2b_contig_255488 SwRhRL2b_0836.00007540 330
323 2162886007 SwRhRL2b_contig_3484740 SwRhRL2b_0376.00007820 330
324 3300001904 JGI24736J21556_1000770 JGI24736J21556_10007702 330
325 3300001979 JGI24740J21852_10004111 JGI24740J21852_100041118 330
326 3300001990 JGI24737J22298_10000017 JGI24737J22298_1000001715 330
327 3300001990 JGI24737J22298_10005039 JGI24737J22298_100050393 330
328 3300002067 JGI24735J21928_10000024 JGI24735J21928_1000002468 330
329 3300002737 JGI25162J39368_1000056 JGI25162J39368_1000056122 330
330 3300002737 JGI25162J39368_1000620 JGI25162J39368_100062020 330
331 3300002772 JGI25164J39214_1000942 JGI25164J39214_10009422 330
332 3300002773 JGI25152J39213_1000337 JGI25152J39213_10003373 330
333 3300002774 JGI25150J39212_1000006 JGI25150J39212_1000006101 330
334 3300003187 JGI25151J46595_10000024 JGI25151J46595_1000002490 330
335 3300003214 JGI25165J46597_1000916 JGI25165J46597_10009164 330
336 3300003215 JGI25153J46596_10000026 JGI25153J46596_10000026102 330
337 3300003316 rootH1_10003552 rootH1_100035522 330
338 3300003316 rootH1_10026676 rootH1_100266766 330
339 3300003320 rootH2_10000579 rootH2_10000579117 330
340 3300003320 rootH2_10042766 rootH2_100427665 330
341 3300003320 rootH2_10244504 rootH2_102445041 330
342 3300003323 rootH1_10060032 rootH1_100600325 330
343 3300003781 Ga0055536_1000002 Ga0055536_1000002196 330
344 3300003791 Ga0055530_10011132 Ga0055530_100111322 330
345 3300004799 Ga0058863_11436476 Ga0058863_114364763 330
346 3300005288 Ga0065714_10004217 Ga0065714_100042171 330
347 3300005288 Ga0065714_10010214 Ga0065714_100102143 330
348 3300005288 Ga0065714_10064535 Ga0065714_1006453530 330
349 3300005288 Ga0065714_10069686 Ga0065714_100696862 330
350 3300005288 Ga0065714_10100080 Ga0065714_101000802 330
351 3300005288 Ga0065714_10130465 Ga0065714_101304651 330
352 3300005289 Ga0065704_10000218 Ga0065704_1000021860 330
353 3300005289 Ga0065704_10077907 Ga0065704_100779073 330
354 3300005289 Ga0065704_10142975 Ga0065704_101429751 330
355 3300005327 Ga0070658_10000032 Ga0070658_10000032115 330
356 3300005328 Ga0070676_10002072 Ga0070676_100020727 330
357 3300005329 Ga0070683_100067207 Ga0070683_1000672073 330
358 3300005334 Ga0068869_100008852 Ga0068869_1000088526 330
359 3300005335 Ga0070666_10000030 Ga0070666_1000003071 330
360 3300005336 Ga0070680_100006592 Ga0070680_1000065925 330
361 3300005336 Ga0070680_100365554 Ga0070680_1003655541 330
362 3300005338 Ga0068868_100035950 Ga0068868_1000359503 330
363 3300005339 Ga0070660_100023968 Ga0070660_1000239684 330
364 3300005341 Ga0070691_10139215 Ga0070691_101392152 330
365 3300005355 Ga0070671_100001424 Ga0070671_1000014248 330
366 3300005364 Ga0070673_100201153 Ga0070673_1002011532 330
367 3300005366 Ga0070659_100000412 Ga0070659_10000041225 330
368 3300005367 Ga0070667_100022732 Ga0070667_1000227324 330
369 3300005455 Ga0070663_100139642 Ga0070663_1001396423 330
370 3300005456 Ga0070678_100002739 Ga0070678_1000027393 330
371 3300005457 Ga0070662_100001063 Ga0070662_1000010634 330
372 3300005458 Ga0070681_10009105 Ga0070681_100091058 330
373 3300005459 Ga0068867_100000088 Ga0068867_10000008845 330
374 3300005530 Ga0070679_100141543 Ga0070679_1001415432 330
375 3300005530 Ga0070679_100322430 Ga0070679_1003224301 330
376 3300005535 Ga0070684_100174832 Ga0070684_1001748321 330
377 3300005535 Ga0070684_100388952 Ga0070684_1003889521 330
378 3300005539 Ga0068853_100413110 Ga0068853_1004131102 330
379 3300005543 Ga0070672_100087877 Ga0070672_1000878772 330
380 3300005548 Ga0070665_100000017 Ga0070665_100000017380 330
381 3300005563 Ga0068855_100000160 Ga0068855_10000016058 330
382 3300005563 Ga0068855_100000919 Ga0068855_10000091915 330
383 3300005563 Ga0068855_100003038 Ga0068855_10000303819 330
384 3300005563 Ga0068855_100047909 Ga0068855_1000479092 330
385 3300005563 Ga0068855_100086508 Ga0068855_1000865081 330
386 3300005577 Ga0068857_100055113 Ga0068857_1000551133 330
387 3300005578 Ga0068854_100009205 Ga0068854_1000092052 330
388 3300005614 Ga0068856_100000399 Ga0068856_10000039912 330
389 3300005614 Ga0068856_100033709 Ga0068856_1000337091 330
390 3300005614 Ga0068856_100034580 Ga0068856_1000345806 330
391 3300005614 Ga0068856_100052450 Ga0068856_1000524502 330
392 3300005616 Ga0068852_100000956 Ga0068852_10000095620 330
393 3300005616 Ga0068852_100002647 Ga0068852_1000026473 330
394 3300005616 Ga0068852_100070533 Ga0068852_1000705332 330
395 3300005617 Ga0068859_100000003 Ga0068859_100000003410 330
396 3300005618 Ga0068864_100005897 Ga0068864_10000589711 330
397 3300005842 Ga0068858_100012504 Ga0068858_1000125042 330
398 3300005843 Ga0068860_100004265 Ga0068860_1000042659 330
399 3300006195 Ga0075366_10003996 Ga0075366_100039966 330
400 3300006237 Ga0097621_100000017 Ga0097621_1000000177 330
401 3300006358 Ga0068871_100000053 Ga0068871_1000000538 330
402 3300006881 Ga0068865_100000213 Ga0068865_10000021317 330
403 3300006931 Ga0097620_100000003 Ga0097620_100000003410 330
404 3300009036 Ga0105244_10016121 Ga0105244_100161213 330
405 3300009093 Ga0105240_10000083 Ga0105240_1000008367 330
406 3300009093 Ga0105240_10013206 Ga0105240_100132062 330
407 3300009093 Ga0105240_10045318 Ga0105240_100453182 330
408 3300009093 Ga0105240_10401965 Ga0105240_104019651 330
409 3300009101 Ga0105247_10005364 Ga0105247_100053648 330
410 3300009174 Ga0105241_10000831 Ga0105241_1000083111 330
411 3300009174 Ga0105241_10001226 Ga0105241_100012264 330
412 3300009174 Ga0105241_10004424 Ga0105241_100044244 330
413 3300009174 Ga0105241_10052099 Ga0105241_100520992 330
414 3300009174 Ga0105241_10461328 Ga0105241_104613281 330
415 3300009545 Ga0105237_10000138 Ga0105237_1000013855 330
416 3300009545 Ga0105237_10000311 Ga0105237_1000031123 330
417 3300009545 Ga0105237_10000567 Ga0105237_100005674 330
418 3300009545 Ga0105237_10002767 Ga0105237_100027678 330
419 3300009545 Ga0105237_10003384 Ga0105237_100033843 330
420 3300009545 Ga0105237_10023922 Ga0105237_100239221 330
421 3300009545 Ga0105237_10029333 Ga0105237_100293336 330
422 3300009545 Ga0105237_10109599 Ga0105237_101095992 330
423 3300009545 Ga0105237_10125294 Ga0105237_101252942 330
424 3300009551 Ga0105238_10016483 Ga0105238_100164832 330
425 3300009553 Ga0105249_10044120 Ga0105249_100441201 330
426 3300010375 Ga0105239_10000014 Ga0105239_10000014224 330
427 3300010375 Ga0105239_10000069 Ga0105239_1000006920 330
428 3300010375 Ga0105239_10000161 Ga0105239_1000016139 330
429 3300010375 Ga0105239_10009374 Ga0105239_100093747 330
430 3300010375 Ga0105239_10072207 Ga0105239_100722072 330
431 3300010375 Ga0105239_10177209 Ga0105239_101772092 330
432 3300011119 Ga0105246_10036831 Ga0105246_100368311 330
433 3300011119 Ga0105246_10046001 Ga0105246_100460012 330
434 3300013100 Ga0157373_10000164 Ga0157373_1000016455 330
435 3300013100 Ga0157373_10000167 Ga0157373_1000016752 330
436 3300013100 Ga0157373_10001307 Ga0157373_100013079 330
437 3300013100 Ga0157373_10001611 Ga0157373_100016116 330
438 3300013100 Ga0157373_10003583 Ga0157373_100035835 330
439 3300013100 Ga0157373_10072595 Ga0157373_100725951 330
440 3300013102 Ga0157371_10000257 Ga0157371_1000025712 330
441 3300013102 Ga0157371_10000367 Ga0157371_1000036724 330
442 3300013102 Ga0157371_10000991 Ga0157371_1000099113 330
443 3300013102 Ga0157371_10001608 Ga0157371_1000160815 330
444 3300013102 Ga0157371_10002698 Ga0157371_100026987 330
445 3300013102 Ga0157371_10004054 Ga0157371_100040544 330
446 3300013102 Ga0157371_10007592 Ga0157371_100075926 330
447 3300013104 Ga0157370_10002955 Ga0157370_100029558 330
448 3300013104 Ga0157370_10012066 Ga0157370_100120664 330
449 3300013104 Ga0157370_10018712 Ga0157370_100187122 330
450 3300013104 Ga0157370_10026402 Ga0157370_100264024 330
451 3300013104 Ga0157370_10083095 Ga0157370_100830953 330
452 3300013104 Ga0157370_10092969 Ga0157370_100929692 330
453 3300013104 Ga0157370_10097216 Ga0157370_100972162 330
454 3300013104 Ga0157370_10117370 Ga0157370_101173701 330
455 3300013105 Ga0157369_10000158 Ga0157369_100001581 330
456 3300013105 Ga0157369_10003611 Ga0157369_100036117 330
457 3300013105 Ga0157369_10036533 Ga0157369_100365333 330
458 3300013105 Ga0157369_10038169 Ga0157369_100381692 330
459 3300013105 Ga0157369_10327060 Ga0157369_103270602 330
460 3300013296 Ga0157374_10000122 Ga0157374_1000012251 330
461 3300013296 Ga0157374_10000431 Ga0157374_1000043137 330
462 3300013296 Ga0157374_10001925 Ga0157374_1000192518 330
463 3300013296 Ga0157374_10059920 Ga0157374_100599202 330
464 3300013297 Ga0157378_10038963 Ga0157378_100389632 330
465 3300013297 Ga0157378_10060087 Ga0157378_100600872 330
466 3300013297 Ga0157378_10109952 Ga0157378_101099522 330
467 3300013297 Ga0157378_10144062 Ga0157378_101440622 330
468 3300013306 Ga0163162_10000011 Ga0163162_10000011112 330
469 3300013306 Ga0163162_10000071 Ga0163162_1000007127 330
470 3300013306 Ga0163162_10000824 Ga0163162_1000082422 330
471 3300013306 Ga0163162_10002735 Ga0163162_100027355 330
472 3300013307 Ga0157372_10000037 Ga0157372_100000376 330
473 3300013307 Ga0157372_10001036 Ga0157372_1000103624 330
474 3300013307 Ga0157372_10004621 Ga0157372_100046213 330
475 3300013307 Ga0157372_10023053 Ga0157372_100230531 330
476 3300013307 Ga0157372_10127825 Ga0157372_101278252 330
477 3300013308 Ga0157375_10007484 Ga0157375_100074843 330
478 3300013308 Ga0157375_10133363 Ga0157375_101333632 330
479 3300013308 Ga0157375_10444414 Ga0157375_104444141 330
480 3300014325 Ga0163163_10079855 Ga0163163_100798552 330
481 3300014497 Ga0182008_10000025 Ga0182008_1000002533 330
482 3300014497 Ga0182008_10000046 Ga0182008_1000004611 330
483 3300014497 Ga0182008_10000459 Ga0182008_1000045912 330
484 3300014497 Ga0182008_10007004 Ga0182008_100070041 330
485 3300014969 Ga0157376_10156441 Ga0157376_101564412 330
486 3300015261 Ga0182006_1000139 Ga0182006_100013924 330
487 3300015261 Ga0182006_1000289 Ga0182006_100028918 330
488 3300015261 Ga0182006_1001252 Ga0182006_100125212 330
489 3300015261 Ga0182006_1002192 Ga0182006_10021924 330
490 3300015261 Ga0182006_1002445 Ga0182006_10024459 330
491 3300015262 Ga0182007_10000008 Ga0182007_1000000889 330
492 3300015262 Ga0182007_10004586 Ga0182007_100045861 330
493 3300015262 Ga0182007_10037757 Ga0182007_100377571 330
494 3300015682 Ga0183373_1002 Ga0183373_1002358 330
495 3300017792 Ga0163161_10000355 Ga0163161_1000035520 330
496 3300017792 Ga0163161_10002183 Ga0163161_100021833 330
497 3300017792 Ga0163161_10003056 Ga0163161_100030561 330
498 3300017792 Ga0163161_10017615 Ga0163161_100176154 330
499 3300017792 Ga0163161_10033166 Ga0163161_100331662 330
500 3300017792 Ga0163161_10060112 Ga0163161_100601122 330
501 3300020077 Ga0206351_10526440 Ga0206351_105264401 330
502 3300020080 Ga0206350_10913138 Ga0206350_109131381 330
503 3300021361 Ga0213872_10007723 Ga0213872_100077234 330
504 3300025231 Ga0207427_100071 Ga0207427_100071117 330
505 3300025233 Ga0209437_100021 Ga0209437_100021142 330
506 3300025233 Ga0209437_100124 Ga0209437_100124122 330
507 3300025242 Ga0209258_107295 Ga0209258_1072952 330
508 3300025245 Ga0207425_1000003 Ga0207425_100000399 330
509 3300025250 Ga0209026_1000250 Ga0209026_100025051 330
510 3300025250 Ga0209026_1006781 Ga0209026_10067812 330
511 3300025250 Ga0209026_1014556 Ga0209026_10145561 330
512 3300025258 Ga0209129_1000022 Ga0209129_100002299 330
513 3300025258 Ga0209129_1008338 Ga0209129_10083382 330
514 3300025261 Ga0209233_1000035 Ga0209233_1000035495 330
515 3300025261 Ga0209233_1008227 Ga0209233_10082272 330
516 3300025261 Ga0209233_1020327 Ga0209233_10203271 330
517 3300025272 Ga0209455_1002522 Ga0209455_10025223 330
518 3300025292 Ga0209676_1000022 Ga0209676_1000022344 330
519 3300025294 Ga0209025_1000007 Ga0209025_100000798 330
520 3300025297 Ga0209758_1000012 Ga0209758_100001299 330
521 3300025298 Ga0209050_1000020 Ga0209050_1000020195 330
522 3300025728 Ga0207655_1015992 Ga0207655_10159923 330
523 3300025900 Ga0207710_10002740 Ga0207710_100027402 330
524 3300025903 Ga0207680_10000014 Ga0207680_1000001435 330
525 3300025904 Ga0207647_10000041 Ga0207647_1000004110 330
526 3300025904 Ga0207647_10000146 Ga0207647_1000014619 330
527 3300025904 Ga0207647_10057312 Ga0207647_100573122 330
528 3300025904 Ga0207647_10134170 Ga0207647_101341701 330
529 3300025907 Ga0207645_10000360 Ga0207645_100003604 330
530 3300025909 Ga0207705_10000032 Ga0207705_10000032106 330
531 3300025911 Ga0207654_10001427 Ga0207654_1000142712 330
532 3300025911 Ga0207654_10002088 Ga0207654_100020883 330
533 3300025912 Ga0207707_10014564 Ga0207707_100145646 330
534 3300025913 Ga0207695_10000127 Ga0207695_1000012766 330
535 3300025913 Ga0207695_10003909 Ga0207695_1000390913 330
536 3300025913 Ga0207695_10023389 Ga0207695_100233899 330
537 3300025914 Ga0207671_10000635 Ga0207671_1000063527 330
538 3300025914 Ga0207671_10000979 Ga0207671_100009798 330
539 3300025914 Ga0207671_10000991 Ga0207671_1000099110 330
540 3300025914 Ga0207671_10001361 Ga0207671_100013618 330
541 3300025914 Ga0207671_10003727 Ga0207671_1000372713 330
542 3300025914 Ga0207671_10006047 Ga0207671_100060476 330
543 3300025914 Ga0207671_10014401 Ga0207671_100144016 330
544 3300025914 Ga0207671_10067636 Ga0207671_100676362 330
545 3300025914 Ga0207671_10177824 Ga0207671_101778241 330
546 3300025917 Ga0207660_10374510 Ga0207660_103745101 330
547 3300025919 Ga0207657_10031472 Ga0207657_100314724 330
548 3300025921 Ga0207652_10021560 Ga0207652_100215604 330
549 3300025921 Ga0207652_10156639 Ga0207652_101566391 330
550 3300025924 Ga0207694_10061523 Ga0207694_100615231 330
551 3300025932 Ga0207690_10000049 Ga0207690_1000004980 330
552 3300025932 Ga0207690_10164759 Ga0207690_101647591 330
553 3300025933 Ga0207706_10000007 Ga0207706_1000000768 330
554 3300025938 Ga0207704_10000272 Ga0207704_1000027221 330
555 3300025940 Ga0207691_10093916 Ga0207691_100939162 330
556 3300025942 Ga0207689_10022150 Ga0207689_100221504 330
557 3300025949 Ga0207667_10000033 Ga0207667_10000033147 330
558 3300025949 Ga0207667_10002743 Ga0207667_100027436 330
559 3300025949 Ga0207667_10019365 Ga0207667_100193655 330
560 3300025949 Ga0207667_10052288 Ga0207667_100522885 330
561 3300025949 Ga0207667_10127560 Ga0207667_101275602 330
562 3300025949 Ga0207667_10130250 Ga0207667_101302502 330
563 3300025961 Ga0207712_10019558 Ga0207712_100195582 330
564 3300025981 Ga0207640_10006613 Ga0207640_100066132 330
565 3300026035 Ga0207703_10009595 Ga0207703_100095956 330
566 3300026041 Ga0207639_10108333 Ga0207639_101083332 330
567 3300026067 Ga0207678_10078492 Ga0207678_100784922 330
568 3300026078 Ga0207702_10006759 Ga0207702_100067598 330
569 3300026078 Ga0207702_10022981 Ga0207702_100229811 330
570 3300026078 Ga0207702_10157724 Ga0207702_101577242 330
571 3300026078 Ga0207702_10186541 Ga0207702_101865412 330
572 3300026078 Ga0207702_10214260 Ga0207702_102142601 330
573 3300026078 Ga0207702_10279072 Ga0207702_102790721 330
574 3300026088 Ga0207641_10000015 Ga0207641_10000015127 330
575 3300026089 Ga0207648_10000075 Ga0207648_1000007561 330
576 3300026095 Ga0207676_10034064 Ga0207676_100340642 330
577 3300026116 Ga0207674_10035173 Ga0207674_100351732 330
578 3300026121 Ga0207683_10002554 Ga0207683_1000255410 330
579 3300026142 Ga0207698_10002370 Ga0207698_1000237011 330
580 3300026142 Ga0207698_10011897 Ga0207698_100118973 330
581 3300028379 Ga0268266_10000195 Ga0268266_1000019537 330
582 3300028381 Ga0268264_10006198 Ga0268264_100061982 330
583 3300028786 Ga0307517_10000335 Ga0307517_1000033540 330
584 3300028794 Ga0307515_10000528 Ga0307515_100005281 330
585 3300028794 Ga0307515_10003943 Ga0307515_1000394329 330
586 3300028794 Ga0307515_10109008 Ga0307515_101090081 330
587 3300028794 Ga0307515_10123215 Ga0307515_101232152 330
588 3300028800 Ga0265338_10305366 Ga0265338_103053661 330
589 3300031507 Ga0307509_10033314 Ga0307509_100333143 330
590 3300031548 Ga0307408_100000164 Ga0307408_10000016451 330
591 3300031548 Ga0307408_100001486 Ga0307408_1000014868 330
592 3300031731 Ga0307405_10000045 Ga0307405_100000459 330
593 3300031731 Ga0307405_10104337 Ga0307405_101043372 330
594 3300031903 Ga0307407_10000002 Ga0307407_10000002161 330
595 3300031911 Ga0307412_10000001 Ga0307412_10000001539 330
596 3300031911 Ga0307412_10000697 Ga0307412_1000069710 330
597 3300031911 Ga0307412_10065524 Ga0307412_100655242 330
598 3300031911 Ga0307412_10083239 Ga0307412_100832392 330
599 3300031995 Ga0307409_100004241 Ga0307409_1000042415 330
600 3300031995 Ga0307409_100280770 Ga0307409_1002807702 330
601 3300032002 Ga0307416_100000005 Ga0307416_100000005163 330
602 3300032004 Ga0307414_10000952 Ga0307414_1000095212 330
603 3300032004 Ga0307414_10017292 Ga0307414_100172923 330
604 3300032004 Ga0307414_10028685 Ga0307414_100286852 330
605 3300032004 Ga0307414_10029693 Ga0307414_100296931 330
606 3300032004 Ga0307414_10031226 Ga0307414_100312262 330
607 3300032004 Ga0307414_10083648 Ga0307414_100836482 330
608 3300032004 Ga0307414_10151972 Ga0307414_101519722 330
609 3300033179 Ga0307507_10001000 Ga0307507_1000100014 330
610 3300033180 Ga0307510_10002118 Ga0307510_1000211819 330
611 3300037312 Ga0395899_0000017 Ga0395899_0000017_281343_282335 330
612 3300037312 Ga0395899_0000152 Ga0395899_0000152_63965_64957 330
613 3300037312 Ga0395899_0023158 Ga0395899_0023158_1581_2573 330
614 3300037312 Ga0395899_0153716 Ga0395899_0153716_283_1293 330
615 3300037418 Ga0395900_0000288 Ga0395900_0000288_29710_30702 330
616 3300037418 Ga0395900_0003963 Ga0395900_0003963_14164_15174 330
617 3300037418 Ga0395900_0009792 Ga0395900_0009792_2488_3480 330
618 3300037418 Ga0395900_0023483 Ga0395900_0023483_4293_5285 330
619 3300037466 Ga0395898_0045114 Ga0395898_0045114_3177_4169 330
620 3300037466 Ga0395898_0150420 Ga0395898_0150420_146_1156 330
621 3300037471 Ga0395905_0000411 Ga0395905_0000411_8485_9477 330
622 3300037471 Ga0395905_0029207 Ga0395905_0029207_3389_4381 330
623 3300037471 Ga0395905_0157834 Ga0395905_0157834_571_1581 330
624 3300038443 Ga0395901_0158625 Ga0395901_0158625_1293_2285 330
625 3300039447 Ga0436361_1111083 Ga0436361_1111083_3142_4134 330
626 3300042005 Ga0439448_0004770 Ga0439448_0004770_2572_3564 330
627 3300044684 Ga0466966_0062890 Ga0466966_0062890_995_1987 330
628 3300044765 Ga0466970_0207038 Ga0466970_0207038_35_1045 330
629 3300045049 Ga0466959_0000904 Ga0466959_0000904_15242_16252 330
630 3300045049 Ga0466959_0109921 Ga0466959_0109921_233_1225 330
631 3300046453 Ga0495627_006048 Ga0495627_006048_775_1773 330
632 3300046471 Ga0495650_0000095 Ga0495650_0000095_184634_185626 330
633 3300046471 Ga0495650_0042565 Ga0495650_0042565_188_1180 330
634 3300046492 Ga0495585_0000034 Ga0495585_0000034_31368_32360 330
635 3300046492 Ga0495585_0000313 Ga0495585_0000313_31637_32629 330
636 3300046500 Ga0495596_0008189 Ga0495596_0008189_1814_2806 330
637 3300046506 Ga0495583_0012709 Ga0495583_0012709_2666_3658 330
638 3300046507 Ga0495606_0000009 Ga0495606_0000009_65101_66093 330
639 3300046507 Ga0495606_0003788 Ga0495606_0003788_12922_13914 330
640 3300046507 Ga0495606_0005118 Ga0495606_0005118_5471_6463 330
641 3300046507 Ga0495606_0053385 Ga0495606_0053385_1108_2106 330
642 3300046512 Ga0495610_0000084 Ga0495610_0000084_85612_86664 330
643 3300046512 Ga0495610_0000284 Ga0495610_0000284_3969_4967 330
644 3300046512 Ga0495610_0010992 Ga0495610_0010992_1362_2354 330
645 3300046513 Ga0495616_0007971 Ga0495616_0007971_3498_4490 330
646 3300046514 Ga0495618_0174558 Ga0495618_0174558_319_1311 330
647 3300046519 Ga0495632_0068031 Ga0495632_0068031_206_1204 330
648 3300046520 Ga0495637_0008889 Ga0495637_0008889_374_1372 330
649 3300046524 Ga0495648_0028569 Ga0495648_0028569_1058_2050 330
650 3300046524 Ga0495648_0041493 Ga0495648_0041493_802_1794 330
651 3300046538 Ga0495609_0004648 Ga0495609_0004648_645_1637 330
652 3300046538 Ga0495609_0034905 Ga0495609_0034905_419_1411 330
653 3300046558 Ga0495633_0000074 Ga0495633_0000074_2137_3129 330
654 3300046558 Ga0495633_0002697 Ga0495633_0002697_6120_7112 330
655 3300046616 Ga0495668_0000017 Ga0495668_0000017_333486_334478 330
656 3300046660 Ga0495625_0000007 Ga0495625_0000007_266845_267837 330
657 3300046660 Ga0495625_0000679 Ga0495625_0000679_16309_17301 330
658 3300046660 Ga0495625_0006979 Ga0495625_0006979_8464_9456 330
659 3300046660 Ga0495625_0016119 Ga0495625_0016119_3387_4379 330
660 3300046660 Ga0495625_0063646 Ga0495625_0063646_741_1733 330
661 3300046665 Ga0495661_0002451 Ga0495661_0002451_11448_12440 330
662 3300046665 Ga0495661_0034563 Ga0495661_0034563_2033_3025 330
663 3300046694 Ga0495649_0000007 Ga0495649_0000007_184517_185509 330
664 3300046794 Ga0495589_0058180 Ga0495589_0058180_215_1207 330
665 3300046810 Ga0495660_0003408 Ga0495660_0003408_991_1983 330
666 3300047323 Ga0495683_0038745 Ga0495683_0038745_791_1783 330
667 3300047443 Ga0495687_000713 Ga0495687_000713_29508_30500 330
668 3300047443 Ga0495687_000846 Ga0495687_000846_25126_26118 330
669 3300047443 Ga0495687_063602 Ga0495687_063602_420_1412 330
670 3300047445 Ga0495677_0012175 Ga0495677_0012175_174_1166 330
671 3300047446 Ga0495679_018985 Ga0495679_018985_872_1864 330
672 3300047470 Ga0495681_0024609 Ga0495681_0024609_1684_2682 330
673 3300047472 Ga0495686_0000614 Ga0495686_0000614_13047_14039 330
674 3300047472 Ga0495686_0001530 Ga0495686_0001530_14547_15539 330
675 3300047472 Ga0495686_0011382 Ga0495686_0011382_2468_3460 330
676 3300047472 Ga0495686_0017078 Ga0495686_0017078_2232_3224 330
677 3300047472 Ga0495686_0046647 Ga0495686_0046647_1706_2698 330
678 3300047472 Ga0495686_0101303 Ga0495686_0101303_573_1565 330
679 3300047472 Ga0495686_0122018 Ga0495686_0122018_225_1217 330
680 3300048089 Ga0495614_0014793 Ga0495614_0014793_158_1150 330
681 3300048918 Ga0496115_0017883 Ga0496115_0017883_4013_5011 330
682 3300048925 Ga0496122_0000783 Ga0496122_0000783_23224_24222 330
683 3300048926 Ga0496123_0002343 Ga0496123_0002343_3090_4088 330
684 3300049459 Ga0495678_016616 Ga0495678_016616_73_1065 330
685 3300049663 Ga0501223_001133 Ga0501223_001133_561_1553 330
686 3300049679 Ga0501249_013449 Ga0501249_013449_183_1181 330
687 3300050493 nmdc:mga0k408_3924_c1 nmdc:mga0k408_3924_c1_4903_5895 330
688 3300050493 nmdc:mga0k408_397_c1 nmdc:mga0k408_397_c1_196_1188 330
689 3300050496 nmdc:mga07m45_104785_c1 nmdc:mga07m45_104785_c1_32_1024 330
690 3300053080 Ga0500635_0006761 Ga0500635_0006761_1423_2415 330
691 3300053093 Ga0500651_0000951 Ga0500651_0000951_3698_4690 330
692 3300053122 Ga0500608_000220 Ga0500608_000220_2258_3250 330
693 3300053122 Ga0500608_002387 Ga0500608_002387_364_1356 330
694 3300053123 Ga0500614_009600 Ga0500614_009600_739_1731 330
695 3300053130 Ga0500642_0012313 Ga0500642_0012313_1492_2484 330
696 3300053156 Ga0500622_0003794 Ga0500622_0003794_4333_5325 330
697 3300053157 Ga0500624_000183 Ga0500624_000183_20647_21639 330
698 iso_pu_bacteria 2739367656 2739615017 330
699 iso_pu_bacteria 2818991437 2819547116 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02445

NadA

Quinolinate synthetase A protein

45

343

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9597 22 325
7p4p-assembly1.cif.gz_A structure of the quinolinate synthase a84l variant complexed with citrate 0.9594 23 324
5lqm-assembly1.cif.gz_A structure of quinolinate synthase y21f mutant in complex with citrate 0.9578 23 324
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9565 22 325
5kts-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii quinolinate synthase (nada) with bound citraconate and fe4s4 cluster 0.9506 20 325
ID Description Score Start End Superfamily
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 1.004 24 97 3.40.50.10800
af_P11458_25_111_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9799 24 101 3.40.50.10800
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9773 24 97 3.40.50.10800
5ktnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9763 20 97 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9659 110 179 3.40.50.10800
ID Description Score Start End GO Terms
AF-A0A3D3PJX2-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.002 79 238 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A4Q6DYH0-F1-model_v4 Quinolinate synthase (EC 2.5.1.72) 0.9995 41 330 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A3M1EYU8-F1-model_v4 Quinolinate synthase (EC 2.5.1.72) 0.9979 8 264 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A519SQS6-F1-model_v4 Quinolinate synthase (EC 2.5.1.72) 0.9977 98 330 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A2X2J232-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 0.9975 82 201 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
94.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map