F475849

General Info

Members Datasets Scaffolds Average Seq Length
696 471 1392 304

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0002891|Ga0466960_0002891_32_1063
Length 343
Sequence MLKAEQASFARLMVTPTAQNLIRVFFLREQMKKTAGSGSTIKHVHVIGAGAMGGDIAAWVAGQGLRVSLADMKAEPIAGAVKRANELYGKIIRKRTEVRDALDRLIPDMDGEGVRNADLIIEAVPEKLELKHEVFKQFEQAVAPETVLASNTSGIPITKIAEVCEHPGRVVGMHWSNPPHLIPMIEVIPGEQTSQEAVDTTTELVRRVGYHPVQEREVPGFVENRILYAILRECLDLVDRGIISPEGLDLNVRWGIGYKLAVIGPMELLDMAGLDIYNAVGSYLNKDLSTSGDVSSTIREKIDEGRLGMKTGGGIYDYTPEQIDQLRAQRAGKLVAVRKALEA

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
308 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
309 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
310 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
311 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
312 2512875024
313 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
314 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
315 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
316 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
317 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
318 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
319 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
320 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
321 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
322 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
323 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
324 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
325 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
326 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
327 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
328 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
329 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
330 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
331 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
332 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
333 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
334 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
335 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
336 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
337 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
338 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
339 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
340 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
341 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
342 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
343 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
344 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
345 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
346 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
347 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
348 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
349 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
350 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
351 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
352 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
353 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
354 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
355 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
356 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
357 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
358 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
359 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
360 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
361 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
362 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
363 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
364 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
365 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
366 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
367 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
368 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
369 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
370 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
371 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
372 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
373 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
374 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
375 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
376 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
377 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
378 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
379 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
380 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
381 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
382 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
383 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
384 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
385 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
386 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
387 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
388 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
389 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
390 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
391 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
392 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
393 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
394 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
395 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
396 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
397 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
398 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
399 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
400 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
401 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
402 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
403 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
404 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
405 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
406 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
407 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
408 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
409 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
410 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
411 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
412 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
413 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
414 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
415 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
416 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
417 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
418 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
419 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
420 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
421 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
422 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
423 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
424 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
425 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
426 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
427 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
428 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
429 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
430 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
431 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
432 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
433 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
434 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
435 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
436 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
437 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
438 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
439 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
440 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
441 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
442 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
443 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
444 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
445 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
446 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
447 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
448 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
449 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
450 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
451 3004167301 Mesorhizobium loti 582 Isolate Unclassified
452 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
453 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
454 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
455 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
456 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
457 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
458 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
459 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
460 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
461 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
462 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
463 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
464 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
465 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
466 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
467 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
468 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
469 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
470 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
471 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.29
Metatranscriptomes 0
Isolates 23.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.32
Nodule 19.54
Rhizoplane 6.32
Rhizosphere 63.79
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0002891 3300044901 Bacteria 6525
2 JGI24740J21852_10003187 3300001979 Bacteria 7242
3 JGI25151J46595_10000422 3300003187 Bacteria 42474
4 JGI25153J46596_10000282 3300003215 Bacteria 38810
5 JGI25153J46596_10000289 3300003215 Bacteria 38374
6 JGI25160J50197_1008429 3300003354 Bacteria 3928
7 Ga0055531_10008441 3300003794 Bacteria 5432
8 Ga0065704_10123549 3300005289 Bacteria 1731
9 Ga0070658_10039233 3300005327 Bacteria 3820
10 Ga0070658_10051310 3300005327 Bacteria 3343
11 Ga0070683_100008274 3300005329 Bacteria 8838
12 Ga0070683_100010633 3300005329 Bacteria 7911
13 Ga0070683_100062772 3300005329 Bacteria 3454
14 Ga0070683_100529113 3300005329 Bacteria 1127
15 Ga0070680_100110167 3300005336 Bacteria 2292
16 Ga0070680_100126672 3300005336 Bacteria 2134
17 Ga0070680_100388297 3300005336 Unclassified 1189
18 Ga0070682_100244048 3300005337 Bacteria 1291
19 Ga0070660_100140924 3300005339 Bacteria 1934
20 Ga0070660_100279129 3300005339 Bacteria 1367
21 Ga0070692_10009245 3300005345 Bacteria 4437
22 Ga0070671_100237050 3300005355 Bacteria 1549
23 Ga0070659_100056326 3300005366 Bacteria 3100
24 Ga0070659_100269885 3300005366 Bacteria 1413
25 Ga0070667_100042488 3300005367 Bacteria 3814
26 Ga0070709_10031435 3300005434 Bacteria 3192
27 Ga0070709_10052406 3300005434 Bacteria 2564
28 Ga0070714_100015047 3300005435 Bacteria 6220
29 Ga0070714_100018405 3300005435 Bacteria 5674
30 Ga0070714_100066703 3300005435 Bacteria 3102
31 Ga0070714_100170231 3300005435 Bacteria 1976
32 Ga0070714_100249217 3300005435 Bacteria 1641
33 Ga0070714_100385657 3300005435 Bacteria 1322
34 Ga0070713_100015341 3300005436 Bacteria 5722
35 Ga0070713_100034676 3300005436 Bacteria 4057
36 Ga0070710_10002424 3300005437 Bacteria 8845
37 Ga0070710_10011013 3300005437 Bacteria 4457
38 Ga0070711_100000760 3300005439 Bacteria 16784
39 Ga0070711_100080194 3300005439 Bacteria 2323
40 Ga0070705_100012862 3300005440 Bacteria 4268
41 Ga0070694_100019804 3300005444 Bacteria 4283
42 Ga0070663_100004204 3300005455 Bacteria 8419
43 Ga0070663_100096705 3300005455 Bacteria 2197
44 Ga0070678_100009646 3300005456 Bacteria 5862
45 Ga0070678_100017796 3300005456 Bacteria 4586
46 Ga0070681_10000239 3300005458 Bacteria 43301
47 Ga0070681_10008270 3300005458 Bacteria 10184
48 Ga0070681_10017802 3300005458 Bacteria 7099
49 Ga0070681_10463443 3300005458 Bacteria 1180
50 Ga0070706_100031303 3300005467 Bacteria 4906
51 Ga0070706_100036680 3300005467 Bacteria 4529
52 Ga0070706_100138333 3300005467 Unclassified 2273
53 Ga0070706_100142409 3300005467 Bacteria 2238
54 Ga0070707_100036928 3300005468 Bacteria 4662
55 Ga0070698_100170076 3300005471 Bacteria 2120
56 Ga0070698_100208082 3300005471 Bacteria 1892
57 Ga0070699_100000141 3300005518 Bacteria 67612
58 Ga0070699_100018248 3300005518 Bacteria 6028
59 Ga0070699_100158156 3300005518 Bacteria 2005
60 Ga0070679_100005959 3300005530 Bacteria 11331
61 Ga0070679_100159138 3300005530 Bacteria 2233
62 Ga0070679_100224331 3300005530 Bacteria 1839
63 Ga0070679_100246149 3300005530 Bacteria 1745
64 Ga0070684_100004634 3300005535 Bacteria 10491
65 Ga0070684_100004936 3300005535 Bacteria 10179
66 Ga0070684_100008470 3300005535 Bacteria 8043
67 Ga0070697_100000327 3300005536 Bacteria 37480
68 Ga0068853_100026192 3300005539 Bacteria 4896
69 Ga0070696_100004716 3300005546 Bacteria 9115
70 Ga0070693_100008149 3300005547 Bacteria 5148
71 Ga0070693_100082869 3300005547 Bacteria 1916
72 Ga0070665_100553343 3300005548 Bacteria 1163
73 Ga0068855_100071635 3300005563 Bacteria 4030
74 Ga0068855_100237514 3300005563 Bacteria 2038
75 Ga0068855_100254766 3300005563 Bacteria 1957
76 Ga0070664_100169905 3300005564 Bacteria 1934
77 Ga0070664_100381612 3300005564 Bacteria 1286
78 Ga0068857_100054091 3300005577 Bacteria 3562
79 Ga0068854_100008245 3300005578 Bacteria 6690
80 Ga0068854_100092220 3300005578 Bacteria 2256
81 Ga0068856_100000782 3300005614 Bacteria 34475
82 Ga0068856_100012705 3300005614 Bacteria 8154
83 Ga0068856_100047335 3300005614 Bacteria 4236
84 Ga0068856_100066184 3300005614 Bacteria 3571
85 Ga0068856_100351747 3300005614 Bacteria 1492
86 Ga0070702_100002307 3300005615 Bacteria 8180
87 Ga0068852_100271538 3300005616 Bacteria 1632
88 Ga0068864_100107736 3300005618 Bacteria 2479
89 Ga0068866_10028597 3300005718 Bacteria 2658
90 Ga0068851_10005382 3300005834 Bacteria 5803
91 Ga0068858_100132933 3300005842 Bacteria 2334
92 Ga0068858_100314321 3300005842 Bacteria 1496
93 Ga0068860_100055507 3300005843 Bacteria 3766
94 Ga0068860_100299073 3300005843 Bacteria 1576
95 Ga0068862_100041104 3300005844 Bacteria 3933
96 Ga0081455_10013576 3300005937 Bacteria 8027
97 Ga0081455_10043555 3300005937 Bacteria 3924
98 Ga0081455_10103762 3300005937 Bacteria 2276
99 Ga0081538_10012945 3300005981 Bacteria 6643
100 Ga0081538_10028856 3300005981 Bacteria 3805
101 Ga0081538_10042986 3300005981 Bacteria 2844
102 Ga0081539_10123432 3300005985 Bacteria 1283
103 Ga0070717_10003044 3300006028 Bacteria 11955
104 Ga0070717_10007606 3300006028 Bacteria 8051
105 Ga0070717_10012442 3300006028 Bacteria 6490
106 Ga0075365_10008490 3300006038 Bacteria 5840
107 Ga0075365_10012725 3300006038 Bacteria 5008
108 Ga0075363_100000168 3300006048 Bacteria 16920
109 Ga0075364_10014226 3300006051 Bacteria 4913
110 Ga0070715_10003436 3300006163 Bacteria 5039
111 Ga0070716_100002254 3300006173 Bacteria 8886
112 Ga0075367_10019197 3300006178 Bacteria 3788
113 Ga0075370_10003361 3300006353 Bacteria 7606
114 Ga0068871_100162110 3300006358 Bacteria 1913
115 Ga0075428_100026435 3300006844 Bacteria 6425
116 Ga0075428_100062848 3300006844 Bacteria 4064
117 Ga0075434_100269099 3300006871 Bacteria 1723
118 Ga0075434_100440757 3300006871 Bacteria 1324
119 Ga0068865_100037770 3300006881 Bacteria 3263
120 Ga0068865_100065707 3300006881 Bacteria 2557
121 Ga0068865_100184785 3300006881 Bacteria 1608
122 Ga0075436_100032149 3300006914 Bacteria 3616
123 Ga0075436_100096988 3300006914 Bacteria 2051
124 Ga0075435_100337845 3300007076 Bacteria 1291
125 Ga0099794_10006558 3300007265 Bacteria 4724
126 Ga0099794_10037538 3300007265 Bacteria 2294
127 Ga0105240_10155424 3300009093 Bacteria 2721
128 Ga0111539_10002681 3300009094 Bacteria 23562
129 Ga0111539_10061565 3300009094 Bacteria 4446
130 Ga0111539_10330550 3300009094 Bacteria 1774
131 Ga0105245_10003492 3300009098 Bacteria 14064
132 Ga0105245_10084029 3300009098 Bacteria 2915
133 Ga0105247_10007241 3300009101 Bacteria 6812
134 Ga0105243_10023729 3300009148 Bacteria 4675
135 Ga0105243_10147338 3300009148 Bacteria 2016
136 Ga0105243_10273034 3300009148 Bacteria 1519
137 Ga0105241_10124458 3300009174 Bacteria 2080
138 Ga0105241_10504232 3300009174 Bacteria 1080
139 Ga0105242_10214050 3300009176 Bacteria 1719
140 Ga0105242_10223532 3300009176 Bacteria 1684
141 Ga0105248_10030951 3300009177 Bacteria 5978
142 Ga0105248_10262482 3300009177 Bacteria 1944
143 Ga0105237_10007176 3300009545 Bacteria 12239
144 Ga0105238_10015217 3300009551 Bacteria 7788
145 Ga0105238_10271769 3300009551 Bacteria 1675
146 Ga0105249_10082946 3300009553 Bacteria 2983
147 Ga0099796_10022242 3300010159 Bacteria 1965
148 Ga0105239_10029177 3300010375 Bacteria 6065
149 Ga0105239_10138406 3300010375 Bacteria 2712
150 Ga0105239_10182411 3300010375 Bacteria 2348
151 Ga0105239_10220309 3300010375 Bacteria 2128
152 Ga0105239_10281107 3300010375 Bacteria 1874
153 Ga0105246_10485644 3300011119 Bacteria 1046
154 Ga0157373_10002490 3300013100 Bacteria 14031
155 Ga0157371_10009207 3300013102 Bacteria 7795
156 Ga0157370_10038929 3300013104 Bacteria 4598
157 Ga0157370_10081019 3300013104 Bacteria 3055
158 Ga0157370_10125719 3300013104 Bacteria 2393
159 Ga0157370_10229231 3300013104 Bacteria 1719
160 Ga0157370_10275147 3300013104 Bacteria 1555
161 Ga0157369_10155586 3300013105 Bacteria 2415
162 Ga0157369_10281213 3300013105 Bacteria 1733
163 Ga0157369_10384542 3300013105 Bacteria 1456
164 Ga0157374_10284310 3300013296 Unclassified 1633
165 Ga0157378_10010162 3300013297 Bacteria 8209
166 Ga0157372_10017474 3300013307 Bacteria 7699
167 Ga0157372_10019958 3300013307 Bacteria 7225
168 Ga0157372_10053308 3300013307 Bacteria 4508
169 Ga0157372_10195338 3300013307 Bacteria 2344
170 Ga0157375_10158573 3300013308 Bacteria 2403
171 Ga0157375_10206028 3300013308 Bacteria 2123
172 Ga0163163_10199775 3300014325 Bacteria 2048
173 Ga0157380_10064744 3300014326 Bacteria 2935
174 Ga0157379_10003546 3300014968 Bacteria 13218
175 Ga0157376_10034123 3300014969 Bacteria 4105
176 Ga0213875_10001781 3300021388 Bacteria 13457
177 Ga0209130_1000386 3300025284 Bacteria 49249
178 Ga0209025_1000215 3300025294 Bacteria 138335
179 Ga0209758_1000048 3300025297 Bacteria 358400
180 Ga0209758_1002845 3300025297 Bacteria 16813
181 Ga0209758_1007382 3300025297 Bacteria 7512
182 Ga0209050_1006121 3300025298 Bacteria 7259
183 Ga0207426_1000092 3300025302 Bacteria 278907
184 Ga0209051_1011972 3300025303 Bacteria 4233
185 Ga0209257_1002078 3300025304 Bacteria 21096
186 Ga0207692_10003957 3300025898 Bacteria 5818
187 Ga0207642_10111571 3300025899 Bacteria 1393
188 Ga0207647_10043261 3300025904 Bacteria 2819
189 Ga0207685_10106793 3300025905 Bacteria 1207
190 Ga0207705_10028778 3300025909 Bacteria 3960
191 Ga0207705_10056529 3300025909 Bacteria 2829
192 Ga0207684_10038941 3300025910 Bacteria 4034
193 Ga0207684_10451704 3300025910 Bacteria 1103
194 Ga0207654_10026627 3300025911 Bacteria 3134
195 Ga0207654_10028887 3300025911 Bacteria 3028
196 Ga0207654_10077823 3300025911 Bacteria 1989
197 Ga0207707_10004298 3300025912 Bacteria 12617
198 Ga0207707_10011771 3300025912 Bacteria 7610
199 Ga0207707_10072550 3300025912 Bacteria 3001
200 Ga0207707_10107887 3300025912 Bacteria 2434
201 Ga0207707_10112305 3300025912 Bacteria 2382
202 Ga0207695_10095520 3300025913 Bacteria 2976
203 Ga0207695_10310777 3300025913 Bacteria 1466
204 Ga0207693_10004090 3300025915 Bacteria 12395
205 Ga0207663_10006165 3300025916 Bacteria 6108
206 Ga0207663_10007428 3300025916 Bacteria 5682
207 Ga0207663_10040896 3300025916 Bacteria 2821
208 Ga0207660_10037365 3300025917 Bacteria 3383
209 Ga0207660_10039866 3300025917 Bacteria 3285
210 Ga0207660_10062467 3300025917 Bacteria 2683
211 Ga0207657_10000488 3300025919 Bacteria 41854
212 Ga0207657_10041598 3300025919 Bacteria 4063
213 Ga0207657_10408684 3300025919 Bacteria 1067
214 Ga0207649_10340110 3300025920 Bacteria 1108
215 Ga0207652_10031349 3300025921 Bacteria 4464
216 Ga0207652_10041367 3300025921 Bacteria 3918
217 Ga0207652_10155410 3300025921 Bacteria 2049
218 Ga0207646_10006788 3300025922 Bacteria 11780
219 Ga0207681_10208323 3300025923 Bacteria 1505
220 Ga0207694_10003222 3300025924 Bacteria 13001
221 Ga0207694_10258655 3300025924 Bacteria 1426
222 Ga0207687_10004325 3300025927 Bacteria 9484
223 Ga0207700_10006858 3300025928 Bacteria 6925
224 Ga0207700_10018770 3300025928 Bacteria 4656
225 Ga0207664_10009143 3300025929 Bacteria 6943
226 Ga0207664_10029110 3300025929 Bacteria 4204
227 Ga0207664_10029825 3300025929 Bacteria 4159
228 Ga0207664_10046075 3300025929 Bacteria 3422
229 Ga0207690_10241410 3300025932 Bacteria 1392
230 Ga0207706_10555169 3300025933 Unclassified 988
231 Ga0207709_10127621 3300025935 Bacteria 1728
232 Ga0207665_10001699 3300025939 Bacteria 14801
233 Ga0207665_10083633 3300025939 Bacteria 2201
234 Ga0207711_10013409 3300025941 Bacteria 6809
235 Ga0207661_10002073 3300025944 Bacteria 13786
236 Ga0207661_10022404 3300025944 Bacteria 4757
237 Ga0207661_10025704 3300025944 Bacteria 4479
238 Ga0207661_10146685 3300025944 Bacteria 2036
239 Ga0207679_10029634 3300025945 Bacteria 3812
240 Ga0207679_10159766 3300025945 Bacteria 1844
241 Ga0207667_10011584 3300025949 Bacteria 10240
242 Ga0207667_10097037 3300025949 Bacteria 3042
243 Ga0207667_10106327 3300025949 Bacteria 2895
244 Ga0207667_10168206 3300025949 Bacteria 2253
245 Ga0207640_10015848 3300025981 Bacteria 4373
246 Ga0207703_10177900 3300026035 Bacteria 1876
247 Ga0207639_10048380 3300026041 Bacteria 3218
248 Ga0207678_10002898 3300026067 Bacteria 15570
249 Ga0207708_10061355 3300026075 Bacteria 2871
250 Ga0207702_10035128 3300026078 Bacteria 4191
251 Ga0207702_10043468 3300026078 Bacteria 3772
252 Ga0207702_10307024 3300026078 Bacteria 1507
253 Ga0207702_10312483 3300026078 Bacteria 1494
254 Ga0207674_10011578 3300026116 Bacteria 9906
255 Ga0207675_100087923 3300026118 Bacteria 2919
256 Ga0207683_10000159 3300026121 Bacteria 57009
257 Ga0207683_10025985 3300026121 Bacteria 5055
258 Ga0207428_10007814 3300027907 Bacteria 9736
259 Ga0207428_10036395 3300027907 Bacteria 4015
260 Ga0268265_10042089 3300028380 Bacteria 3386
261 Ga0265326_10020447 3300028558 Bacteria 1898
262 Ga0265336_10012133 3300028666 Bacteria 2905
263 Ga0265331_10002763 3300031250 Bacteria 11656
264 Ga0307513_10080270 3300031456 Bacteria 3366
265 Ga0307513_10084290 3300031456 Bacteria 3265
266 Ga0265313_10006984 3300031595 Bacteria 7830
267 Ga0265314_10060758 3300031711 Bacteria 2578
268 Ga0265314_10192257 3300031711 Bacteria 1213
269 Ga0265342_10031339 3300031712 Bacteria 3288
270 Ga0316576_10003521 3300031727 Bacteria 9195
271 Ga0307516_10129304 3300031730 Bacteria 2307
272 Ga0307405_10089386 3300031731 Bacteria 2035
273 Ga0307410_10020257 3300031852 Bacteria 4064
274 Ga0307406_10185567 3300031901 Bacteria 1518
275 Ga0307409_100022725 3300031995 Bacteria 4327
276 Ga0307409_100104123 3300031995 Bacteria 2363
277 Ga0307409_100287833 3300031995 Unclassified 1522
278 Ga0307416_100025229 3300032002 Unclassified 4354
279 Ga0307416_100467512 3300032002 Unclassified 1318
280 Ga0307411_10015920 3300032005 Bacteria 4241
281 Ga0307415_100033453 3300032126 Bacteria 3337
282 Ga0373926_0023316 3300035083 Bacteria 2149
283 Ga0373934_0016043 3300035086 Bacteria 2845
284 Ga0373944_0006385 3300035089 Bacteria 3130
285 Ga0373936_0001775 3300035113 Bacteria 7928
286 Ga0373936_0014510 3300035113 Bacteria 3013
287 Ga0373945_0001429 3300035116 Bacteria 7267
288 Ga0373943_0001094 3300035170 Bacteria 12075
289 Ga0373946_0001116 3300035171 Bacteria 9277
290 Ga0373955_0012354 3300035172 Bacteria 4105
291 Ga0316574_0127224 3300035398 Bacteria 1638
292 Ga0373924_0037075 3300035410 Bacteria 1983
293 Ga0373935_0003207 3300035692 Bacteria 9438
294 Ga0373927_0003183 3300035695 Bacteria 11837
295 Ga0373947_0002853 3300035725 Bacteria 10322
296 Ga0373937_0140734 3300036401 Bacteria 2257
297 Ga0373925_0002946 3300037068 Bacteria 13432
298 Ga0373925_0019199 3300037068 Bacteria 4972
299 Ga0395899_0167409 3300037312 Bacteria 1550
300 Ga0395900_0167645 3300037418 Bacteria 2237
301 Ga0395900_0203797 3300037418 Bacteria 2000
302 Ga0395898_0005901 3300037466 Bacteria 13168
303 Ga0395898_0108517 3300037466 Bacteria 2661
304 Ga0395898_0129683 3300037466 Bacteria 2415
305 Ga0395898_0218158 3300037466 Bacteria 1820
306 Ga0395905_0076613 3300037471 Bacteria 3134
307 Ga0395905_0091720 3300037471 Bacteria 2848
308 Ga0395905_0555964 3300037471 Bacteria 1049
309 Ga0436364_0277048 3300037853 Bacteria 24522
310 Ga0395901_0006584 3300038443 Bacteria 11738
311 Ga0395901_0092520 3300038443 Bacteria 3165
312 Ga0395901_0101796 3300038443 Bacteria 3014
313 Ga0395901_0375382 3300038443 Bacteria 1464
314 Ga0436365_0123247 3300039437 Bacteria 4903
315 Ga0436362_1291495 3300039453 Bacteria 2699
316 Ga0451789_1312686 3300041443 Bacteria 1486
317 Ga0439448_0032314 3300042005 Bacteria 1665
318 Ga0439463_007397 3300042016 Bacteria 2712
319 Ga0466965_0011827 3300044683 Bacteria 4098
320 Ga0466963_0003808 3300044694 Bacteria 8699
321 Ga0466964_0055467 3300044706 Bacteria 1636
322 Ga0466971_0003047 3300044719 Bacteria 7121
323 Ga0466970_0085359 3300044765 Bacteria 1710
324 Ga0466957_0000934 3300044842 Bacteria 14956
325 Ga0466959_0033796 3300045049 Bacteria 3782
326 Ga0466958_0034782 3300045836 Bacteria 3008
327 Ga0466967_0468626 3300045976 Bacteria 1233
328 Ga0495629_0003298 3300046459 Bacteria 12191
329 Ga0495629_0098155 3300046459 Bacteria 2044
330 Ga0495641_0009218 3300046461 Bacteria 5893
331 Ga0495641_0013821 3300046461 Bacteria 4405
332 Ga0495653_0101729 3300046463 Bacteria 2081
333 Ga0495582_0000548 3300046473 Bacteria 20756
334 Ga0495639_0004900 3300046475 Bacteria 5744
335 Ga0495639_0139465 3300046475 Bacteria 1165
336 Ga0495662_0014837 3300046476 Bacteria 3785
337 Ga0495662_0021239 3300046476 Bacteria 3138
338 Ga0495664_0004750 3300046477 Bacteria 7427
339 Ga0495584_0207993 3300046491 Bacteria 995
340 Ga0495610_0016917 3300046512 Bacteria 4177
341 Ga0495618_0018136 3300046514 Bacteria 4320
342 Ga0495630_0006682 3300046517 Bacteria 8221
343 Ga0495630_0165156 3300046517 Bacteria 1685
344 Ga0495666_0005834 3300046526 Bacteria 6206
345 Ga0495652_0020890 3300046529 Bacteria 5819
346 Ga0495652_0037173 3300046529 Bacteria 4226
347 Ga0495652_0351209 3300046529 Bacteria 1056
348 Ga0495665_0000771 3300046531 Bacteria 16688
349 Ga0495640_0007304 3300046533 Bacteria 8700
350 Ga0495586_0001851 3300046535 Bacteria 11515
351 Ga0495586_0199987 3300046535 Bacteria 1133
352 Ga0495645_0112318 3300046543 Bacteria 1927
353 Ga0495667_0011566 3300046559 Bacteria 5975
354 Ga0495667_0169389 3300046559 Bacteria 1403
355 Ga0495668_0060517 3300046616 Bacteria 2089
356 Ga0495634_0007682 3300046642 Bacteria 8071
357 Ga0495625_0127718 3300046660 Bacteria 1725
358 Ga0495635_0000530 3300046663 Bacteria 24241
359 Ga0495635_0060762 3300046663 Bacteria 2596
360 Ga0495635_0373492 3300046663 Bacteria 949
361 Ga0495599_0020151 3300046678 Bacteria 4154
362 Ga0495646_0034065 3300046680 Bacteria 3164
363 Ga0495647_0009086 3300046681 Bacteria 3356
364 Ga0495658_0000364 3300046683 Bacteria 25493
365 Ga0495658_0048626 3300046683 Bacteria 2392
366 Ga0495658_0078671 3300046683 Bacteria 1931
367 Ga0495613_0001395 3300046689 Bacteria 18393
368 Ga0495613_0220862 3300046689 Bacteria 1330
369 Ga0495624_0017972 3300046690 Bacteria 4737
370 Ga0495624_0018627 3300046690 Bacteria 4642
371 Ga0495604_0039381 3300047317 Bacteria 3715
372 Ga0495674_0000369 3300047319 Bacteria 40089
373 Ga0495674_0061587 3300047319 Bacteria 3269
374 Ga0495674_0149164 3300047319 Bacteria 1961
375 Ga0495674_0258814 3300047319 Bacteria 1430
376 Ga0495676_0000728 3300047321 Bacteria 27424
377 Ga0495676_0003347 3300047321 Bacteria 14488
378 Ga0495676_0182903 3300047321 Bacteria 1468
379 Ga0495680_0128808 3300047322 Bacteria 1861
380 Ga0495684_0001714 3300047471 Bacteria 17650
381 Ga0495684_0001889 3300047471 Bacteria 16793
382 Ga0495684_0167000 3300047471 Bacteria 1639
383 Ga0495593_0005310 3300047673 Bacteria 7615
384 Ga0495602_0229735 3300048088 Bacteria 1395
385 Ga0495614_0006257 3300048089 Bacteria 5348
386 Ga0496100_0215874 3300048903 Bacteria 1405
387 Ga0496100_0218707 3300048903 Bacteria 1397
388 Ga0496101_0054718 3300048904 Bacteria 2881
389 Ga0496102_0015724 3300048905 Bacteria 6593
390 Ga0496102_0033088 3300048905 Bacteria 4645
391 Ga0496102_0509498 3300048905 Unclassified 1126
392 Ga0496103_0014969 3300048906 Bacteria 4611
393 Ga0496104_0000121 3300048907 Bacteria 71946
394 Ga0496104_0000883 3300048907 Bacteria 25819
395 Ga0496104_0029457 3300048907 Bacteria 5093
396 Ga0496104_0043799 3300048907 Bacteria 4203
397 Ga0496105_0000124 3300048908 Bacteria 52364
398 Ga0496105_0022099 3300048908 Bacteria 5152
399 Ga0496105_0045230 3300048908 Bacteria 3632
400 Ga0496106_0040681 3300048909 Bacteria 3481
401 Ga0496106_0113747 3300048909 Bacteria 2110
402 Ga0496106_0149439 3300048909 Bacteria 1842
403 Ga0496107_0009990 3300048910 Bacteria 6582
404 Ga0496107_0246600 3300048910 Bacteria 1329
405 Ga0496108_0001625 3300048911 Bacteria 17818
406 Ga0496108_0002993 3300048911 Bacteria 13571
407 Ga0496108_0074966 3300048911 Bacteria 2858
408 Ga0496108_0285019 3300048911 Bacteria 1438
409 Ga0496109_0000468 3300048912 Bacteria 34392
410 Ga0496109_0000677 3300048912 Bacteria 28303
411 Ga0496109_0008769 3300048912 Bacteria 8611
412 Ga0496110_0000093 3300048913 Bacteria 48032
413 Ga0496110_0000569 3300048913 Bacteria 25289
414 Ga0496110_0025848 3300048913 Bacteria 5020
415 Ga0496110_0139343 3300048913 Bacteria 2193
416 Ga0496111_0000593 3300048914 Bacteria 19046
417 Ga0496111_0000880 3300048914 Bacteria 16329
418 Ga0496112_0124408 3300048915 Bacteria 2550
419 Ga0496112_0130157 3300048915 Bacteria 2488
420 Ga0496112_0140535 3300048915 Bacteria 2384
421 Ga0496112_0405738 3300048915 Bacteria 1302
422 Ga0496113_0005433 3300048916 Bacteria 7944
423 Ga0496114_0000120 3300048917 Bacteria 56473
424 Ga0496114_0001221 3300048917 Bacteria 19422
425 Ga0496114_0002143 3300048917 Bacteria 15005
426 Ga0496114_0016084 3300048917 Bacteria 6021
427 Ga0496115_0004535 3300048918 Bacteria 10048
428 Ga0496117_0046681 3300048920 Bacteria 3113
429 Ga0496119_0036076 3300048922 Bacteria 3232
430 Ga0496120_0013114 3300048923 Bacteria 5601
431 Ga0496126_0032727 3300048929 Bacteria 4896
432 Ga0496126_0069271 3300048929 Bacteria 3148
433 Ga0496126_0165186 3300048929 Bacteria 1889
434 Ga0496126_0212887 3300048929 Bacteria 1626
435 Ga0501032_0000430 3300049569 Bacteria 34776
436 Ga0501032_0056280 3300049569 Bacteria 2644
437 Ga0501033_0005727 3300049570 Bacteria 9799
438 Ga0501034_0013536 3300049571 Bacteria 8396
439 Ga0501034_0104883 3300049571 Bacteria 2820
440 Ga0501037_0019941 3300049573 Bacteria 4948
441 Ga0501037_0160088 3300049573 Bacteria 1605
442 Ga0501038_0003181 3300049574 Bacteria 15308
443 Ga0501038_0066294 3300049574 Bacteria 3075
444 Ga0501038_0303400 3300049574 Bacteria 1253
445 Ga0501039_0001639 3300049575 Bacteria 16499
446 Ga0501039_0083334 3300049575 Bacteria 2490
447 Ga0501040_0060921 3300049576 Bacteria 2594
448 Ga0501041_0134535 3300049577 Bacteria 1540
449 Ga0501042_0262527 3300049578 Bacteria 1247
450 Ga0501043_0002280 3300049579 Bacteria 16309
451 Ga0501043_0080322 3300049579 Bacteria 2562
452 Ga0501046_0002162 3300049580 Bacteria 18558
453 Ga0501046_0156449 3300049580 Bacteria 1716
454 Ga0501046_0278859 3300049580 Bacteria 1225
455 Ga0501047_0013089 3300049581 Bacteria 7857
456 Ga0501047_0037269 3300049581 Bacteria 4701
457 Ga0501047_0242413 3300049581 Bacteria 1653
458 Ga0501048_0021719 3300049582 Bacteria 4697
459 Ga0501067_0040041 3300049583 Bacteria 2603
460 Ga0501067_0055310 3300049583 Bacteria 2199
461 Ga0501068_0008079 3300049584 Bacteria 5839
462 Ga0501069_0001195 3300049585 Bacteria 12637
463 Ga0501069_0001331 3300049585 Bacteria 12095
464 Ga0501069_0076213 3300049585 Bacteria 1885
465 Ga0501070_0001304 3300049586 Bacteria 22381
466 Ga0501070_0029166 3300049586 Bacteria 4628
467 Ga0501071_0366768 3300049587 Bacteria 1097
468 Ga0501072_0160313 3300049588 Bacteria 1794
469 Ga0501073_0003837 3300049589 Bacteria 11278
470 Ga0501073_0017695 3300049589 Bacteria 5159
471 Ga0501074_0194809 3300049590 Bacteria 1444
472 Ga0501075_0323525 3300049591 Bacteria 1175
473 Ga0501076_0028972 3300049592 Bacteria 4303
474 Ga0501076_0148511 3300049592 Bacteria 1906
475 Ga0501077_0206547 3300049593 Bacteria 1248
476 Ga0501079_0147623 3300049741 Bacteria 1833
477 Ga0501079_0242964 3300049741 Bacteria 1407
478 Ga0501080_0010932 3300049742 Bacteria 8305
479 Ga0501080_0047787 3300049742 Bacteria 3984
480 Ga0501080_0055195 3300049742 Bacteria 3700
481 Ga0501083_0003290 3300049744 Bacteria 11287
482 Ga0501083_0011242 3300049744 Bacteria 6281
483 Ga0501083_0027257 3300049744 Bacteria 3943
484 Ga0501083_0062083 3300049744 Bacteria 2494
485 Ga0501035_0038714 3300049822 Bacteria 4316
486 Ga0501035_0393376 3300049822 Bacteria 1154
487 Ga0501044_0004358 3300049823 Bacteria 15851
488 Ga0501044_0017978 3300049823 Bacteria 7580
489 Ga0501044_0077127 3300049823 Bacteria 3380
490 Ga0501045_0099118 3300049824 Bacteria 2156
491 nmdc:mga03n38_3996_c1 3300050490 Bacteria 4818
492 nmdc:mga00v17_6868_c1 3300050491 Bacteria 6050
493 nmdc:mga0yw44_10609_c1 3300050492 Bacteria 4716
494 nmdc:mga06z11_16361_c1 3300050494 Bacteria 3339
495 nmdc:mga07m45_3225_c1 3300050496 Bacteria 7828
496 nmdc:mga05p37_280736_c1 3300050507 Bacteria 1986
497 nmdc:mga0qj67_222107_c1 3300050509 Bacteria 1533
498 nmdc:mga06r32_498359_c1 3300050510 Bacteria 1195
499 nmdc:mga08y16_101060_c1 3300050511 Bacteria 3002
500 nmdc:mga08y16_116473_c1 3300050511 Bacteria 2781
501 nmdc:mga08y16_158_c1 3300050511 Bacteria 58796
502 nmdc:mga08y16_79160_c1 3300050511 Bacteria 3425
503 nmdc:mga0n895_14511_c1 3300050512 Bacteria 7159
504 nmdc:mga0n895_416630_c1 3300050512 Bacteria 1358
505 nmdc:mga0a205_169279_c1 3300050515 Bacteria 2080
506 nmdc:mga0a205_287405_c1 3300050515 Bacteria 1519
507 nmdc:mga0a205_450_c1 3300050515 Bacteria 30909
508 nmdc:mga0a205_511479_c1 3300050515 Bacteria 1057
509 Ga0495619_0088719 3300053085 Bacteria 2092
510 Ga0495619_0103521 3300053085 Bacteria 1939
511 Ga0500578_0064643 3300053086 Bacteria 2333
512 Ga0500646_0003583 3300053090 Bacteria 3977
513 Ga0500556_0000007 3300053104 Bacteria 331400
514 Ga0500594_0030881 3300053118 Bacteria 1409
515 Ga0500642_0002211 3300053130 Bacteria 5663
516 Ga0500568_0000154 3300053139 Bacteria 59534
517 Ga0500568_0000653 3300053139 Bacteria 25004
518 Ga0500588_0022507 3300053146 Bacteria 1717
519 Ga0500604_0021905 3300053151 Bacteria 1810
520 Ga0500616_0000113 3300053153 Bacteria 150722
521 Ga0500616_0000859 3300053153 Bacteria 33743
522 Ga0500609_000267 3300053731 Bacteria 7589
523 Ga0501084_0024967 3300054114 Bacteria 4987
524 Ga0501084_0142653 3300054114 Bacteria 2017
525 Ga0501084_0349850 3300054114 Bacteria 1248
526 Ga0590071_016972 3300059421 Bacteria 1709
527 Ga0590075_010300 3300059424 Bacteria 2249
528 Ga0501082_0002268 3300060353 Bacteria 16847
529 Ga0501082_0006905 3300060353 Bacteria 9819
530 Ga0501082_0043128 3300060353 Bacteria 3889
531 Ga0466962_0012202 3300061719 Bacteria 4130
532 2509143756 2508501127 Bacteria 7037543
533 2509373098 2509276018 Bacteria 6910194
534 2509395011 2509276022 Bacteria 6200534
535 2510314273 2510065059 Bacteria 6847884
536 2512928991 2512875016 Bacteria 6529530
537 2512963564 2512875024 Bacteria 7195110
538 2514038175 2513237164 Bacteria 7563725
539 2588514538 2588253730 Bacteria 6881675
540 2597814541 2597489875 Bacteria 7010078
541 2643984738 2643221595 Bacteria 6565519
542 2644153062 2643221627 Bacteria 6761570
543 2688597347 2687453392 Bacteria 6880454
544 2756671645 2756170246 Bacteria 7451806
545 2765469243 2765235802 Bacteria 5618596
546 2821447294 2821443989 Bacteria 7658172
547 2837652057 2837651117 Bacteria 3772164
548 2837679591 2837678835 Bacteria 5252418
549 2839996319 2839993093 Bacteria 5512535
550 2841740657 2841734538 Bacteria 6784580
551 2844008435 2844002411 Bacteria 7168230
552 2844012726 2844009547 Bacteria 6728125
553 2856323208 2856320880 Bacteria 7263508
554 2856334000 2856328259 Bacteria 6528202
555 2856339929 2856334872 Bacteria 7037011
556 2857374591 2857367948 Bacteria 6965560
557 2869163920 2869162929 Bacteria 6399702
558 2869174715 2869169390 Bacteria 6659796
559 2869236282 2869234852 Bacteria 6654993
560 2869248732 2869242130 Bacteria 6609239
561 2869256500 2869249662 Bacteria 6868783
562 2869262273 2869256925 Bacteria 6981691
563 2869270366 2869264136 Bacteria 6880765
564 2869274405 2869271264 Bacteria 6908218
565 2869282759 2869278585 Bacteria 7077053
566 2871459347 2871451962 Bacteria 7336357
567 2871465034 2871459585 Bacteria 6866887
568 2871467851 2871466892 Bacteria 6923287
569 2871480487 2871474448 Bacteria 6806570
570 2871481447 2871481445 Bacteria 6700002
571 2874110722 2874109183 Bacteria 6517025
572 2874119854 2874116593 Bacteria 6674494
573 2874132892 2874131515 Bacteria 6820270
574 2874142417 2874139085 Bacteria 7021506
575 2874168629 2874162495 Bacteria 6174670
576 2874171186 2874168670 Bacteria 8062617
577 2876369457 2876363079 Bacteria 6544991
578 2876389603 2876386047 Bacteria 6698674
579 2876403399 2876399893 Bacteria 6927900
580 2876408085 2876406927 Bacteria 6191900
581 2876422515 2876420981 Bacteria 6687741
582 2878731702 2878730984 Bacteria 6380721
583 2878744398 2878738818 Bacteria 7136951
584 2878778051 2878774303 Bacteria 6108671
585 2878785557 2878781027 Bacteria 6834456
586 2878793249 2878788777 Bacteria 6567085
587 2883295970 2883291878 Bacteria 5894118
588 2883358729 2883354860 Bacteria 5865246
589 2885316823 2885312484 Bacteria 6415165
590 2888338432 2888337043 Bacteria 6629336
591 2888355574 2888350351 Bacteria 7372807
592 2889017791 2889016732 Bacteria 6700763
593 2891050183 2891048133 Bacteria 4447501
594 2903453044 2903448605 Bacteria 7357801
595 2903523959 2903521522 Bacteria 6525694
596 2903531580 2903528002 Bacteria 6586099
597 2904583725 2904578770 Bacteria 5302906
598 2906355784 2906354277 Bacteria 6991324
599 2906366246 2906363423 Bacteria 6856682
600 2906377073 2906370794 Bacteria 6881062
601 2906389060 2906386501 Bacteria 5977019
602 2906393760 2906393657 Bacteria 6790866
603 2906404065 2906401398 Bacteria 6693206
604 2906413077 2906408224 Bacteria 6162342
605 2906431569 2906427513 Bacteria 6375796
606 2919124863 2919119836 Bacteria 5208557
607 2922130571 2922130491 Bacteria 7173936
608 2922176118 2922172374 Bacteria 6167644
609 2922179257 2922178524 Bacteria 6025201
610 2922186206 2922185730 Bacteria 7113964
611 2924724698 2924718760 Bacteria 6331356
612 2924737761 2924733363 Bacteria 7574837
613 2924743988 2924741084 Bacteria 6661321
614 2924752827 2924748358 Bacteria 6154725
615 2924756259 2924754689 Bacteria 6774424
616 2924782428 2924776078 Bacteria 7492003
617 2937836834 2937836603 Bacteria 6811263
618 2937853927 2937848649 Bacteria 6983481
619 2937863526 2937861824 Bacteria 6660327
620 2937871795 2937868953 Bacteria 6639878
621 2937881069 2937877337 Bacteria 7246526
622 2937977163 2937972304 Bacteria 7532020
623 2937986621 2937980651 Bacteria 6517427
624 2958039542 2958034702 Bacteria 6989922
625 2958052829 2958041894 Bacteria 13082850
626 2958065041 2958064165 Bacteria 7158582
627 2958076983 2958071322 Bacteria 6815895
628 2958088374 2958084443 Bacteria 7312792
629 2958098179 2958092219 Bacteria 6861151
630 2958103793 2958100919 Bacteria 6800575
631 2958108637 2958108152 Bacteria 6681128
632 2958123781 2958122699 Bacteria 7280457
633 2958146217 2958144490 Bacteria 6677056
634 2961140977 2961136820 Bacteria 6775228
635 2961188538 2961183825 Bacteria 6688536
636 2963650243 2963644680 Bacteria 6530403
637 2965027721 2965025482 Bacteria 6532201
638 2965034249 2965032056 Bacteria 6887443
639 2965043142 2965040258 Bacteria 6855979
640 2965095152 2965089291 Bacteria 6866420
641 2965105105 2965102966 Bacteria 6800987
642 2965117505 2965110997 Bacteria 6693150
643 2965126396 2965119406 Bacteria 6956431
644 2968020869 2968016561 Bacteria 7022047
645 2968086410 2968083720 Bacteria 7351627
646 2968144098 2968138860 Bacteria 6605449
647 2970474166 2970469710 Bacteria 6969209
648 2970495084 2970489779 Bacteria 6517260
649 2970515508 2970510686 Bacteria 7006402
650 2970532847 2970532167 Bacteria 6553173
651 2970548419 2970547951 Bacteria 6931819
652 2970597368 2970593180 Bacteria 7073582
653 2970619992 2970619444 Bacteria 6986144
654 2970628956 2970627176 Bacteria 6680862
655 2977855965 2977851361 Bacteria 6694324
656 2977880306 2977872689 Bacteria 7270173
657 2977899556 2977898635 Bacteria 6675551
658 2977913059 2977907340 Bacteria 6577984
659 2977922373 2977915119 Bacteria 6829656
660 2977926395 2977922695 Bacteria 6956781
661 2977938565 2977935797 Bacteria 6252826
662 2977957213 2977950692 Bacteria 6893264
663 2977958727 2977957713 Bacteria 6877875
664 2977979938 2977971508 Bacteria 7472917
665 2979715434 2979710463 Bacteria 6785254
666 2979749752 2979742915 Bacteria 7301278
667 2979765715 2979764755 Bacteria 6610066
668 2979773606 2979772303 Bacteria 6618277
669 2979797934 2979793036 Bacteria 6808957
670 2987647248 2987645492 Bacteria 6117018
671 2987675483 2987673487 Bacteria 6884027
672 2995393417 2995392953 Bacteria 4539380
673 2996314590 2996310559 Bacteria 6357320
674 2996352513 2996348954 Bacteria 7239054
675 2996390138 2996386984 Bacteria 6978667
676 3004167789 3004167301 Bacteria 8330599
677 3004213392 3004211236 Bacteria 7417683
678 3004221981 3004218560 Bacteria 7421728
679 3004234876 3004232784 Bacteria 6662140
680 3004244985 3004239961 Bacteria 6892290
681 3004254256 3004248173 Bacteria 6563236
682 3004273665 3004268573 Bacteria 7043476
683 3004279195 3004275668 Bacteria 7114440
684 3004296732 3004289098 Bacteria 6135450
685 3004338414 3004334049 Bacteria 8449246
686 637078706 637000159 Bacteria 7596297
687 649871899 649633066 Bacteria 6690028
688 8004305367 8004300914 Bacteria 6132239
689 8004316162 8004312739 Bacteria 7444653
690 8004362166 8004361976 Bacteria 6858373
691 8004639316 8004633249 Bacteria 6723080
692 8004644962 8004640170 Bacteria 6723001
693 8004696561 8004695233 Bacteria 6731676
694 8004734419 8004727605 Bacteria 6643904
695 8033684671 8033684223 Bacteria 6906479
696 8056038054 8056037122 Bacteria 3854319
697 Ga0466960_0002891
698 JGI24740J21852_10003187
699 JGI25151J46595_10000422
700 JGI25153J46596_10000282
701 JGI25153J46596_10000289
702 JGI25160J50197_1008429
703 Ga0055531_10008441
704 Ga0065704_10123549
705 Ga0070658_10039233
706 Ga0070658_10051310
707 Ga0070683_100008274
708 Ga0070683_100010633
709 Ga0070683_100062772
710 Ga0070683_100529113
711 Ga0070680_100110167
712 Ga0070680_100126672
713 Ga0070680_100388297
714 Ga0070682_100244048
715 Ga0070660_100140924
716 Ga0070660_100279129
717 Ga0070692_10009245
718 Ga0070671_100237050
719 Ga0070659_100056326
720 Ga0070659_100269885
721 Ga0070667_100042488
722 Ga0070709_10031435
723 Ga0070709_10052406
724 Ga0070714_100015047
725 Ga0070714_100018405
726 Ga0070714_100066703
727 Ga0070714_100170231
728 Ga0070714_100249217
729 Ga0070714_100385657
730 Ga0070713_100015341
731 Ga0070713_100034676
732 Ga0070710_10002424
733 Ga0070710_10011013
734 Ga0070711_100000760
735 Ga0070711_100080194
736 Ga0070705_100012862
737 Ga0070694_100019804
738 Ga0070663_100004204
739 Ga0070663_100096705
740 Ga0070678_100009646
741 Ga0070678_100017796
742 Ga0070681_10000239
743 Ga0070681_10008270
744 Ga0070681_10017802
745 Ga0070681_10463443
746 Ga0070706_100031303
747 Ga0070706_100036680
748 Ga0070706_100138333
749 Ga0070706_100142409
750 Ga0070707_100036928
751 Ga0070698_100170076
752 Ga0070698_100208082
753 Ga0070699_100000141
754 Ga0070699_100018248
755 Ga0070699_100158156
756 Ga0070679_100005959
757 Ga0070679_100159138
758 Ga0070679_100224331
759 Ga0070679_100246149
760 Ga0070684_100004634
761 Ga0070684_100004936
762 Ga0070684_100008470
763 Ga0070697_100000327
764 Ga0068853_100026192
765 Ga0070696_100004716
766 Ga0070693_100008149
767 Ga0070693_100082869
768 Ga0070665_100553343
769 Ga0068855_100071635
770 Ga0068855_100237514
771 Ga0068855_100254766
772 Ga0070664_100169905
773 Ga0070664_100381612
774 Ga0068857_100054091
775 Ga0068854_100008245
776 Ga0068854_100092220
777 Ga0068856_100000782
778 Ga0068856_100012705
779 Ga0068856_100047335
780 Ga0068856_100066184
781 Ga0068856_100351747
782 Ga0070702_100002307
783 Ga0068852_100271538
784 Ga0068864_100107736
785 Ga0068866_10028597
786 Ga0068851_10005382
787 Ga0068858_100132933
788 Ga0068858_100314321
789 Ga0068860_100055507
790 Ga0068860_100299073
791 Ga0068862_100041104
792 Ga0081455_10013576
793 Ga0081455_10043555
794 Ga0081455_10103762
795 Ga0081538_10012945
796 Ga0081538_10028856
797 Ga0081538_10042986
798 Ga0081539_10123432
799 Ga0070717_10003044
800 Ga0070717_10007606
801 Ga0070717_10012442
802 Ga0075365_10008490
803 Ga0075365_10012725
804 Ga0075363_100000168
805 Ga0075364_10014226
806 Ga0070715_10003436
807 Ga0070716_100002254
808 Ga0075367_10019197
809 Ga0075370_10003361
810 Ga0068871_100162110
811 Ga0075428_100026435
812 Ga0075428_100062848
813 Ga0075434_100269099
814 Ga0075434_100440757
815 Ga0068865_100037770
816 Ga0068865_100065707
817 Ga0068865_100184785
818 Ga0075436_100032149
819 Ga0075436_100096988
820 Ga0075435_100337845
821 Ga0099794_10006558
822 Ga0099794_10037538
823 Ga0105240_10155424
824 Ga0111539_10002681
825 Ga0111539_10061565
826 Ga0111539_10330550
827 Ga0105245_10003492
828 Ga0105245_10084029
829 Ga0105247_10007241
830 Ga0105243_10023729
831 Ga0105243_10147338
832 Ga0105243_10273034
833 Ga0105241_10124458
834 Ga0105241_10504232
835 Ga0105242_10214050
836 Ga0105242_10223532
837 Ga0105248_10030951
838 Ga0105248_10262482
839 Ga0105237_10007176
840 Ga0105238_10015217
841 Ga0105238_10271769
842 Ga0105249_10082946
843 Ga0099796_10022242
844 Ga0105239_10029177
845 Ga0105239_10138406
846 Ga0105239_10182411
847 Ga0105239_10220309
848 Ga0105239_10281107
849 Ga0105246_10485644
850 Ga0157373_10002490
851 Ga0157371_10009207
852 Ga0157370_10038929
853 Ga0157370_10081019
854 Ga0157370_10125719
855 Ga0157370_10229231
856 Ga0157370_10275147
857 Ga0157369_10155586
858 Ga0157369_10281213
859 Ga0157369_10384542
860 Ga0157374_10284310
861 Ga0157378_10010162
862 Ga0157372_10017474
863 Ga0157372_10019958
864 Ga0157372_10053308
865 Ga0157372_10195338
866 Ga0157375_10158573
867 Ga0157375_10206028
868 Ga0163163_10199775
869 Ga0157380_10064744
870 Ga0157379_10003546
871 Ga0157376_10034123
872 Ga0213875_10001781
873 Ga0209130_1000386
874 Ga0209025_1000215
875 Ga0209758_1000048
876 Ga0209758_1002845
877 Ga0209758_1007382
878 Ga0209050_1006121
879 Ga0207426_1000092
880 Ga0209051_1011972
881 Ga0209257_1002078
882 Ga0207692_10003957
883 Ga0207642_10111571
884 Ga0207647_10043261
885 Ga0207685_10106793
886 Ga0207705_10028778
887 Ga0207705_10056529
888 Ga0207684_10038941
889 Ga0207684_10451704
890 Ga0207654_10026627
891 Ga0207654_10028887
892 Ga0207654_10077823
893 Ga0207707_10004298
894 Ga0207707_10011771
895 Ga0207707_10072550
896 Ga0207707_10107887
897 Ga0207707_10112305
898 Ga0207695_10095520
899 Ga0207695_10310777
900 Ga0207693_10004090
901 Ga0207663_10006165
902 Ga0207663_10007428
903 Ga0207663_10040896
904 Ga0207660_10037365
905 Ga0207660_10039866
906 Ga0207660_10062467
907 Ga0207657_10000488
908 Ga0207657_10041598
909 Ga0207657_10408684
910 Ga0207649_10340110
911 Ga0207652_10031349
912 Ga0207652_10041367
913 Ga0207652_10155410
914 Ga0207646_10006788
915 Ga0207681_10208323
916 Ga0207694_10003222
917 Ga0207694_10258655
918 Ga0207687_10004325
919 Ga0207700_10006858
920 Ga0207700_10018770
921 Ga0207664_10009143
922 Ga0207664_10029110
923 Ga0207664_10029825
924 Ga0207664_10046075
925 Ga0207690_10241410
926 Ga0207706_10555169
927 Ga0207709_10127621
928 Ga0207665_10001699
929 Ga0207665_10083633
930 Ga0207711_10013409
931 Ga0207661_10002073
932 Ga0207661_10022404
933 Ga0207661_10025704
934 Ga0207661_10146685
935 Ga0207679_10029634
936 Ga0207679_10159766
937 Ga0207667_10011584
938 Ga0207667_10097037
939 Ga0207667_10106327
940 Ga0207667_10168206
941 Ga0207640_10015848
942 Ga0207703_10177900
943 Ga0207639_10048380
944 Ga0207678_10002898
945 Ga0207708_10061355
946 Ga0207702_10035128
947 Ga0207702_10043468
948 Ga0207702_10307024
949 Ga0207702_10312483
950 Ga0207674_10011578
951 Ga0207675_100087923
952 Ga0207683_10000159
953 Ga0207683_10025985
954 Ga0207428_10007814
955 Ga0207428_10036395
956 Ga0268265_10042089
957 Ga0265326_10020447
958 Ga0265336_10012133
959 Ga0265331_10002763
960 Ga0307513_10080270
961 Ga0307513_10084290
962 Ga0265313_10006984
963 Ga0265314_10060758
964 Ga0265314_10192257
965 Ga0265342_10031339
966 Ga0316576_10003521
967 Ga0307516_10129304
968 Ga0307405_10089386
969 Ga0307410_10020257
970 Ga0307406_10185567
971 Ga0307409_100022725
972 Ga0307409_100104123
973 Ga0307409_100287833
974 Ga0307416_100025229
975 Ga0307416_100467512
976 Ga0307411_10015920
977 Ga0307415_100033453
978 Ga0373926_0023316
979 Ga0373934_0016043
980 Ga0373944_0006385
981 Ga0373936_0001775
982 Ga0373936_0014510
983 Ga0373945_0001429
984 Ga0373943_0001094
985 Ga0373946_0001116
986 Ga0373955_0012354
987 Ga0316574_0127224
988 Ga0373924_0037075
989 Ga0373935_0003207
990 Ga0373927_0003183
991 Ga0373947_0002853
992 Ga0373937_0140734
993 Ga0373925_0002946
994 Ga0373925_0019199
995 Ga0395899_0167409
996 Ga0395900_0167645
997 Ga0395900_0203797
998 Ga0395898_0005901
999 Ga0395898_0108517
1000 Ga0395898_0129683
1001 Ga0395898_0218158
1002 Ga0395905_0076613
1003 Ga0395905_0091720
1004 Ga0395905_0555964
1005 Ga0436364_0277048
1006 Ga0395901_0006584
1007 Ga0395901_0092520
1008 Ga0395901_0101796
1009 Ga0395901_0375382
1010 Ga0436365_0123247
1011 Ga0436362_1291495
1012 Ga0451789_1312686
1013 Ga0439448_0032314
1014 Ga0439463_007397
1015 Ga0466965_0011827
1016 Ga0466963_0003808
1017 Ga0466964_0055467
1018 Ga0466971_0003047
1019 Ga0466970_0085359
1020 Ga0466957_0000934
1021 Ga0466959_0033796
1022 Ga0466958_0034782
1023 Ga0466967_0468626
1024 Ga0495629_0003298
1025 Ga0495629_0098155
1026 Ga0495641_0009218
1027 Ga0495641_0013821
1028 Ga0495653_0101729
1029 Ga0495582_0000548
1030 Ga0495639_0004900
1031 Ga0495639_0139465
1032 Ga0495662_0014837
1033 Ga0495662_0021239
1034 Ga0495664_0004750
1035 Ga0495584_0207993
1036 Ga0495610_0016917
1037 Ga0495618_0018136
1038 Ga0495630_0006682
1039 Ga0495630_0165156
1040 Ga0495666_0005834
1041 Ga0495652_0020890
1042 Ga0495652_0037173
1043 Ga0495652_0351209
1044 Ga0495665_0000771
1045 Ga0495640_0007304
1046 Ga0495586_0001851
1047 Ga0495586_0199987
1048 Ga0495645_0112318
1049 Ga0495667_0011566
1050 Ga0495667_0169389
1051 Ga0495668_0060517
1052 Ga0495634_0007682
1053 Ga0495625_0127718
1054 Ga0495635_0000530
1055 Ga0495635_0060762
1056 Ga0495635_0373492
1057 Ga0495599_0020151
1058 Ga0495646_0034065
1059 Ga0495647_0009086
1060 Ga0495658_0000364
1061 Ga0495658_0048626
1062 Ga0495658_0078671
1063 Ga0495613_0001395
1064 Ga0495613_0220862
1065 Ga0495624_0017972
1066 Ga0495624_0018627
1067 Ga0495604_0039381
1068 Ga0495674_0000369
1069 Ga0495674_0061587
1070 Ga0495674_0149164
1071 Ga0495674_0258814
1072 Ga0495676_0000728
1073 Ga0495676_0003347
1074 Ga0495676_0182903
1075 Ga0495680_0128808
1076 Ga0495684_0001714
1077 Ga0495684_0001889
1078 Ga0495684_0167000
1079 Ga0495593_0005310
1080 Ga0495602_0229735
1081 Ga0495614_0006257
1082 Ga0496100_0215874
1083 Ga0496100_0218707
1084 Ga0496101_0054718
1085 Ga0496102_0015724
1086 Ga0496102_0033088
1087 Ga0496102_0509498
1088 Ga0496103_0014969
1089 Ga0496104_0000121
1090 Ga0496104_0000883
1091 Ga0496104_0029457
1092 Ga0496104_0043799
1093 Ga0496105_0000124
1094 Ga0496105_0022099
1095 Ga0496105_0045230
1096 Ga0496106_0040681
1097 Ga0496106_0113747
1098 Ga0496106_0149439
1099 Ga0496107_0009990
1100 Ga0496107_0246600
1101 Ga0496108_0001625
1102 Ga0496108_0002993
1103 Ga0496108_0074966
1104 Ga0496108_0285019
1105 Ga0496109_0000468
1106 Ga0496109_0000677
1107 Ga0496109_0008769
1108 Ga0496110_0000093
1109 Ga0496110_0000569
1110 Ga0496110_0025848
1111 Ga0496110_0139343
1112 Ga0496111_0000593
1113 Ga0496111_0000880
1114 Ga0496112_0124408
1115 Ga0496112_0130157
1116 Ga0496112_0140535
1117 Ga0496112_0405738
1118 Ga0496113_0005433
1119 Ga0496114_0000120
1120 Ga0496114_0001221
1121 Ga0496114_0002143
1122 Ga0496114_0016084
1123 Ga0496115_0004535
1124 Ga0496117_0046681
1125 Ga0496119_0036076
1126 Ga0496120_0013114
1127 Ga0496126_0032727
1128 Ga0496126_0069271
1129 Ga0496126_0165186
1130 Ga0496126_0212887
1131 Ga0501032_0000430
1132 Ga0501032_0056280
1133 Ga0501033_0005727
1134 Ga0501034_0013536
1135 Ga0501034_0104883
1136 Ga0501037_0019941
1137 Ga0501037_0160088
1138 Ga0501038_0003181
1139 Ga0501038_0066294
1140 Ga0501038_0303400
1141 Ga0501039_0001639
1142 Ga0501039_0083334
1143 Ga0501040_0060921
1144 Ga0501041_0134535
1145 Ga0501042_0262527
1146 Ga0501043_0002280
1147 Ga0501043_0080322
1148 Ga0501046_0002162
1149 Ga0501046_0156449
1150 Ga0501046_0278859
1151 Ga0501047_0013089
1152 Ga0501047_0037269
1153 Ga0501047_0242413
1154 Ga0501048_0021719
1155 Ga0501067_0040041
1156 Ga0501067_0055310
1157 Ga0501068_0008079
1158 Ga0501069_0001195
1159 Ga0501069_0001331
1160 Ga0501069_0076213
1161 Ga0501070_0001304
1162 Ga0501070_0029166
1163 Ga0501071_0366768
1164 Ga0501072_0160313
1165 Ga0501073_0003837
1166 Ga0501073_0017695
1167 Ga0501074_0194809
1168 Ga0501075_0323525
1169 Ga0501076_0028972
1170 Ga0501076_0148511
1171 Ga0501077_0206547
1172 Ga0501079_0147623
1173 Ga0501079_0242964
1174 Ga0501080_0010932
1175 Ga0501080_0047787
1176 Ga0501080_0055195
1177 Ga0501083_0003290
1178 Ga0501083_0011242
1179 Ga0501083_0027257
1180 Ga0501083_0062083
1181 Ga0501035_0038714
1182 Ga0501035_0393376
1183 Ga0501044_0004358
1184 Ga0501044_0017978
1185 Ga0501044_0077127
1186 Ga0501045_0099118
1187 nmdc:mga03n38_3996_c1
1188 nmdc:mga00v17_6868_c1
1189 nmdc:mga0yw44_10609_c1
1190 nmdc:mga06z11_16361_c1
1191 nmdc:mga07m45_3225_c1
1192 nmdc:mga05p37_280736_c1
1193 nmdc:mga0qj67_222107_c1
1194 nmdc:mga06r32_498359_c1
1195 nmdc:mga08y16_101060_c1
1196 nmdc:mga08y16_116473_c1
1197 nmdc:mga08y16_158_c1
1198 nmdc:mga08y16_79160_c1
1199 nmdc:mga0n895_14511_c1
1200 nmdc:mga0n895_416630_c1
1201 nmdc:mga0a205_169279_c1
1202 nmdc:mga0a205_287405_c1
1203 nmdc:mga0a205_450_c1
1204 nmdc:mga0a205_511479_c1
1205 Ga0495619_0088719
1206 Ga0495619_0103521
1207 Ga0500578_0064643
1208 Ga0500646_0003583
1209 Ga0500556_0000007
1210 Ga0500594_0030881
1211 Ga0500642_0002211
1212 Ga0500568_0000154
1213 Ga0500568_0000653
1214 Ga0500588_0022507
1215 Ga0500604_0021905
1216 Ga0500616_0000113
1217 Ga0500616_0000859
1218 Ga0500609_000267
1219 Ga0501084_0024967
1220 Ga0501084_0142653
1221 Ga0501084_0349850
1222 Ga0590071_016972
1223 Ga0590075_010300
1224 Ga0501082_0002268
1225 Ga0501082_0006905
1226 Ga0501082_0043128
1227 Ga0466962_0012202
1228 2509143756
1229 2509373098
1230 2509395011
1231 2510314273
1232 2512928991
1233 2512963564
1234 2514038175
1235 2588514538
1236 2597814541
1237 2643984738
1238 2644153062
1239 2688597347
1240 2756671645
1241 2765469243
1242 2821447294
1243 2837652057
1244 2837679591
1245 2839996319
1246 2841740657
1247 2844008435
1248 2844012726
1249 2856323208
1250 2856334000
1251 2856339929
1252 2857374591
1253 2869163920
1254 2869174715
1255 2869236282
1256 2869248732
1257 2869256500
1258 2869262273
1259 2869270366
1260 2869274405
1261 2869282759
1262 2871459347
1263 2871465034
1264 2871467851
1265 2871480487
1266 2871481447
1267 2874110722
1268 2874119854
1269 2874132892
1270 2874142417
1271 2874168629
1272 2874171186
1273 2876369457
1274 2876389603
1275 2876403399
1276 2876408085
1277 2876422515
1278 2878731702
1279 2878744398
1280 2878778051
1281 2878785557
1282 2878793249
1283 2883295970
1284 2883358729
1285 2885316823
1286 2888338432
1287 2888355574
1288 2889017791
1289 2891050183
1290 2903453044
1291 2903523959
1292 2903531580
1293 2904583725
1294 2906355784
1295 2906366246
1296 2906377073
1297 2906389060
1298 2906393760
1299 2906404065
1300 2906413077
1301 2906431569
1302 2919124863
1303 2922130571
1304 2922176118
1305 2922179257
1306 2922186206
1307 2924724698
1308 2924737761
1309 2924743988
1310 2924752827
1311 2924756259
1312 2924782428
1313 2937836834
1314 2937853927
1315 2937863526
1316 2937871795
1317 2937881069
1318 2937977163
1319 2937986621
1320 2958039542
1321 2958052829
1322 2958065041
1323 2958076983
1324 2958088374
1325 2958098179
1326 2958103793
1327 2958108637
1328 2958123781
1329 2958146217
1330 2961140977
1331 2961188538
1332 2963650243
1333 2965027721
1334 2965034249
1335 2965043142
1336 2965095152
1337 2965105105
1338 2965117505
1339 2965126396
1340 2968020869
1341 2968086410
1342 2968144098
1343 2970474166
1344 2970495084
1345 2970515508
1346 2970532847
1347 2970548419
1348 2970597368
1349 2970619992
1350 2970628956
1351 2977855965
1352 2977880306
1353 2977899556
1354 2977913059
1355 2977922373
1356 2977926395
1357 2977938565
1358 2977957213
1359 2977958727
1360 2977979938
1361 2979715434
1362 2979749752
1363 2979765715
1364 2979773606
1365 2979797934
1366 2987647248
1367 2987675483
1368 2995393417
1369 2996314590
1370 2996352513
1371 2996390138
1372 3004167789
1373 3004213392
1374 3004221981
1375 3004234876
1376 3004244985
1377 3004254256
1378 3004273665
1379 3004279195
1380 3004296732
1381 3004338414
1382 637078706
1383 649871899
1384 8004305367
1385 8004316162
1386 8004362166
1387 8004639316
1388 8004644962
1389 8004696561
1390 8004734419
1391 8033684671
1392 8056038054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

43

218

0.96

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

220

318

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9267 2 35
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9253 4 35
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9253 3 34
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.9239 3 34
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.9217 3 34
ID Description Score Start End Superfamily
4om8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9939 1 185 3.40.50.720
4om8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9886 1 185 3.40.50.720
af_A0A0R0JSV2_33_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9611 68 186 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.95 3 35 3.50.50.60
af_L7N688_2_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9436 2 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527X910-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9953 1 130 GO:0006631
GO:0016491
GO:0070403
AF-A0A436J5Z5-F1-model_v4 deleted 0.9942 1 88
AF-A0A528BBQ8-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9908 26 211 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A527X910-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9878 1 130 GO:0006631
GO:0016491
GO:0070403
AF-A0A436J5Z5-F1-model_v4 deleted 0.9831 1 88

Map