F475784

General Info

Members Datasets Scaffolds Average Seq Length
695 318 1390 151

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100852375|Ga0075430_1008523752
Length 172
Sequence MSSYRTIAREYYNPKIWRRCFPAESVDTETRAALSRLLRKERVAHLATLRSGAPMASMTLYLPDETFAAFFVHVSRLAWHTQDMLQDARVALSIAETDDGRADPFTLMRVTIRGNAVQIPEGPKEAWLARFPEQAINFELADFSFWKIAPRDARFVAGFGRIHNLSAADLHP

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
203 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
207 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
262 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
263 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
290 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
291 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
294 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 4.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100852375 3300006846 Bacteria 751
2 rootH2_10230354 3300003320 Bacteria 1092
3 JGI26137J50245_102323 3300003396 Viruses 591
4 Ga0065707_10164752 3300005295 Bacteria 1532
5 Ga0065707_10196211 3300005295 Bacteria 1321
6 Ga0065707_10569465 3300005295 Bacteria 709
7 Ga0065707_10831756 3300005295 Bacteria 587
8 Ga0070676_10157479 3300005328 Bacteria 1459
9 Ga0070676_10590518 3300005328 Unclassified 800
10 Ga0070683_101179282 3300005329 Bacteria 736
11 Ga0070690_100003369 3300005330 Bacteria 8723
12 Ga0070690_100007967 3300005330 Bacteria 6082
13 Ga0068869_100006668 3300005334 Bacteria 7334
14 Ga0068869_101098611 3300005334 Bacteria 696
15 Ga0070680_100003555 3300005336 Bacteria 11625
16 Ga0070680_100229525 3300005336 Bacteria 1568
17 Ga0070680_100802288 3300005336 Unclassified 811
18 Ga0070682_100007277 3300005337 Bacteria 6239
19 Ga0070682_100361278 3300005337 Bacteria 1086
20 Ga0068868_100010982 3300005338 Bacteria 6579
21 Ga0068868_100096516 3300005338 Bacteria 2388
22 Ga0070689_100002360 3300005340 Bacteria 12298
23 Ga0070689_100300647 3300005340 Bacteria 1336
24 Ga0070691_10016362 3300005341 Bacteria 3406
25 Ga0070691_10035993 3300005341 Bacteria 2332
26 Ga0070691_10144010 3300005341 Bacteria 1217
27 Ga0070687_100001773 3300005343 Bacteria 7789
28 Ga0070687_100754957 3300005343 Bacteria 685
29 Ga0070692_10011998 3300005345 Bacteria 3997
30 Ga0070692_10015417 3300005345 Bacteria 3615
31 Ga0070692_10400736 3300005345 Bacteria 866
32 Ga0070669_100001963 3300005353 Bacteria 14854
33 Ga0070675_100338299 3300005354 Bacteria 1333
34 Ga0070675_100929062 3300005354 Bacteria 798
35 Ga0070671_100185815 3300005355 Bacteria 1761
36 Ga0070674_100084697 3300005356 Bacteria 2274
37 Ga0070674_100450511 3300005356 Bacteria 1062
38 Ga0070673_100045204 3300005364 Bacteria 3414
39 Ga0070673_100421331 3300005364 Bacteria 1197
40 Ga0070688_100459025 3300005365 Bacteria 954
41 Ga0070688_100531981 3300005365 Bacteria 891
42 Ga0070703_10290726 3300005406 Bacteria 678
43 Ga0070709_10771266 3300005434 Bacteria 753
44 Ga0070713_100097027 3300005436 Bacteria 2546
45 Ga0070701_10003296 3300005438 Bacteria 6363
46 Ga0070701_10224539 3300005438 Bacteria 1122
47 Ga0070701_10224579 3300005438 Bacteria 1122
48 Ga0070701_10226281 3300005438 Bacteria 1118
49 Ga0070705_100007453 3300005440 Bacteria 5383
50 Ga0070705_100097802 3300005440 Bacteria 1845
51 Ga0070705_100400242 3300005440 Bacteria 1016
52 Ga0070700_100002410 3300005441 Bacteria 9532
53 Ga0070700_100010066 3300005441 Bacteria 5206
54 Ga0070700_100093839 3300005441 Bacteria 1964
55 Ga0070700_100108041 3300005441 Bacteria 1845
56 Ga0070700_100191954 3300005441 Bacteria 1429
57 Ga0070700_100551194 3300005441 Bacteria 896
58 Ga0070694_100016546 3300005444 Bacteria 4643
59 Ga0070694_100019205 3300005444 Bacteria 4346
60 Ga0070694_100058698 3300005444 Bacteria 2618
61 Ga0070694_100404411 3300005444 Bacteria 1069
62 Ga0070694_100572502 3300005444 Bacteria 907
63 Ga0070708_100445743 3300005445 Bacteria 1221
64 Ga0070678_100033174 3300005456 Bacteria 3581
65 Ga0070662_100143691 3300005457 Bacteria 1852
66 Ga0070662_100926234 3300005457 Bacteria 744
67 Ga0070681_10013546 3300005458 Bacteria 8109
68 Ga0068867_100000347 3300005459 Bacteria 30690
69 Ga0068867_100009496 3300005459 Bacteria 6861
70 Ga0068867_100412685 3300005459 Bacteria 1142
71 Ga0068867_100593690 3300005459 Bacteria 965
72 Ga0068867_101345142 3300005459 Bacteria 661
73 Ga0070685_10490130 3300005466 Bacteria 868
74 Ga0070685_10842349 3300005466 Bacteria 679
75 Ga0070707_100912174 3300005468 Bacteria 843
76 Ga0070699_100027635 3300005518 Bacteria 4893
77 Ga0070699_100088027 3300005518 Bacteria 2712
78 Ga0070699_100734215 3300005518 Bacteria 903
79 Ga0070699_101012634 3300005518 Bacteria 762
80 Ga0070679_100191382 3300005530 Bacteria 2014
81 Ga0070679_100387003 3300005530 Bacteria 1345
82 Ga0070684_100017611 3300005535 Bacteria 5869
83 Ga0070697_100182203 3300005536 Bacteria 1780
84 Ga0068853_100053794 3300005539 Bacteria 3468
85 Ga0068853_101652479 3300005539 Unclassified 621
86 Ga0070672_100482971 3300005543 Bacteria 1070
87 Ga0070672_100837468 3300005543 Bacteria 811
88 Ga0070672_101660971 3300005543 Bacteria 574
89 Ga0070686_100005616 3300005544 Bacteria 6948
90 Ga0070686_100083373 3300005544 Bacteria 2122
91 Ga0070686_100138232 3300005544 Bacteria 1693
92 Ga0070686_100482220 3300005544 Bacteria 959
93 Ga0070686_100689286 3300005544 Bacteria 814
94 Ga0070695_100009100 3300005545 Bacteria 5903
95 Ga0070695_100033512 3300005545 Bacteria 3214
96 Ga0070695_100102722 3300005545 Bacteria 1928
97 Ga0070695_100125666 3300005545 Bacteria 1761
98 Ga0070695_100546878 3300005545 Bacteria 902
99 Ga0070696_100001380 3300005546 Bacteria 15883
100 Ga0070696_100006062 3300005546 Bacteria 8071
101 Ga0070696_100007654 3300005546 Bacteria 7219
102 Ga0070696_100013721 3300005546 Bacteria 5440
103 Ga0070696_100116374 3300005546 Bacteria 1930
104 Ga0070696_101497186 3300005546 Unclassified 578
105 Ga0070693_100000208 3300005547 Bacteria 27286
106 Ga0070693_100165314 3300005547 Bacteria 1413
107 Ga0070704_100001465 3300005549 Bacteria 12661
108 Ga0070704_100052015 3300005549 Bacteria 2888
109 Ga0070704_100329519 3300005549 Bacteria 1282
110 Ga0068855_100015728 3300005563 Bacteria 9102
111 Ga0068857_100648242 3300005577 Bacteria 1001
112 Ga0068854_100272752 3300005578 Bacteria 1359
113 Ga0068854_100317691 3300005578 Bacteria 1265
114 Ga0068856_100036287 3300005614 Bacteria 4834
115 Ga0068856_100809283 3300005614 Bacteria 956
116 Ga0070702_100004253 3300005615 Bacteria 6526
117 Ga0070702_100029298 3300005615 Bacteria 2992
118 Ga0070702_100283838 3300005615 Bacteria 1138
119 Ga0070702_100552093 3300005615 Bacteria 855
120 Ga0070702_100915334 3300005615 Unclassified 688
121 Ga0068852_100134813 3300005616 Bacteria 2279
122 Ga0068859_100006943 3300005617 Bacteria 11498
123 Ga0068859_100026359 3300005617 Bacteria 5827
124 Ga0068859_100035478 3300005617 Bacteria 5004
125 Ga0068859_100549284 3300005617 Bacteria 1250
126 Ga0068859_100561406 3300005617 Bacteria 1236
127 Ga0068864_100187639 3300005618 Bacteria 1894
128 Ga0068864_100947360 3300005618 Bacteria 852
129 Ga0068866_10003990 3300005718 Bacteria 6057
130 Ga0068866_10502358 3300005718 Bacteria 803
131 Ga0068861_100000215 3300005719 Bacteria 31072
132 Ga0068861_100065877 3300005719 Bacteria 2791
133 Ga0068861_100367623 3300005719 Bacteria 1267
134 Ga0068861_100884424 3300005719 Bacteria 845
135 Ga0068870_10192142 3300005840 Bacteria 1232
136 Ga0068870_10571114 3300005840 Bacteria 764
137 Ga0068863_100627644 3300005841 Bacteria 1065
138 Ga0068863_100697944 3300005841 Bacteria 1008
139 Ga0068858_100003477 3300005842 Bacteria 15611
140 Ga0068858_100527912 3300005842 Bacteria 1142
141 Ga0068858_100992089 3300005842 Unclassified 823
142 Ga0068860_100006430 3300005843 Bacteria 11799
143 Ga0068860_100982381 3300005843 Bacteria 862
144 Ga0068862_100002007 3300005844 Bacteria 18465
145 Ga0068862_100007738 3300005844 Bacteria 8886
146 Ga0070712_100325443 3300006175 Bacteria 1251
147 Ga0097621_100001643 3300006237 Bacteria 15299
148 Ga0097621_100006336 3300006237 Bacteria 8397
149 Ga0097621_101057203 3300006237 Bacteria 761
150 Ga0068871_100000860 3300006358 Bacteria 20244
151 Ga0068871_100001672 3300006358 Bacteria 14911
152 Ga0075428_100004699 3300006844 Bacteria 15119
153 Ga0075428_100009795 3300006844 Bacteria 10650
154 Ga0075428_100053948 3300006844 Bacteria 4405
155 Ga0075428_100104470 3300006844 Bacteria 3089
156 Ga0075428_100416956 3300006844 Bacteria 1439
157 Ga0075428_100472880 3300006844 Bacteria 1342
158 Ga0075428_101194885 3300006844 Bacteria 802
159 Ga0075430_100013572 3300006846 Bacteria 6944
160 Ga0075430_100025133 3300006846 Bacteria 5066
161 Ga0075430_100055421 3300006846 Bacteria 3334
162 Ga0075430_100131638 3300006846 Bacteria 2084
163 Ga0075430_100140752 3300006846 Bacteria 2009
164 Ga0075430_100626954 3300006846 Bacteria 887
165 Ga0075431_100007463 3300006847 Bacteria 10889
166 Ga0075431_100019521 3300006847 Bacteria 6912
167 Ga0075431_100094906 3300006847 Bacteria 3079
168 Ga0075431_100126778 3300006847 Bacteria 2634
169 Ga0075431_100127182 3300006847 Bacteria 2629
170 Ga0075431_100145637 3300006847 Bacteria 2441
171 Ga0075431_100183686 3300006847 Bacteria 2145
172 Ga0075433_10018417 3300006852 Bacteria 5804
173 Ga0075433_10028193 3300006852 Bacteria 4773
174 Ga0075433_10103118 3300006852 Bacteria 2526
175 Ga0075433_10204355 3300006852 Bacteria 1756
176 Ga0075433_10682989 3300006852 Bacteria 900
177 Ga0075434_100007513 3300006871 Bacteria 10091
178 Ga0075434_100013968 3300006871 Bacteria 7662
179 Ga0075434_100216691 3300006871 Bacteria 1934
180 Ga0075429_100000330 3300006880 Bacteria 34237
181 Ga0075429_100000786 3300006880 Bacteria 24972
182 Ga0075429_100091766 3300006880 Bacteria 2649
183 Ga0075429_100292784 3300006880 Bacteria 1425
184 Ga0075429_100397553 3300006880 Bacteria 1207
185 Ga0068865_100003692 3300006881 Bacteria 9201
186 Ga0068865_100004558 3300006881 Bacteria 8360
187 Ga0068865_100747040 3300006881 Bacteria 840
188 Ga0075436_100007561 3300006914 Bacteria 7423
189 Ga0075436_100022992 3300006914 Bacteria 4282
190 Ga0075436_100045107 3300006914 Bacteria 3041
191 Ga0075436_100049469 3300006914 Bacteria 2901
192 Ga0075436_100071711 3300006914 Bacteria 2395
193 Ga0097620_100006944 3300006931 Bacteria 11498
194 Ga0097620_100026363 3300006931 Bacteria 5827
195 Ga0097620_100035477 3300006931 Bacteria 5004
196 Ga0097620_100549212 3300006931 Bacteria 1250
197 Ga0097620_100561403 3300006931 Bacteria 1236
198 Ga0075435_100006817 3300007076 Bacteria 8105
199 Ga0075435_100014594 3300007076 Bacteria 5879
200 Ga0099794_10002615 3300007265 Bacteria 6694
201 Ga0105250_10178058 3300009092 Bacteria 891
202 Ga0111539_10031884 3300009094 Bacteria 6402
203 Ga0111539_10032268 3300009094 Bacteria 6361
204 Ga0111539_10237281 3300009094 Bacteria 2123
205 Ga0111539_10446415 3300009094 Bacteria 1506
206 Ga0111539_10682993 3300009094 Bacteria 1195
207 Ga0111539_10804505 3300009094 Bacteria 1094
208 Ga0105245_10020049 3300009098 Bacteria 5861
209 Ga0105245_10789449 3300009098 Bacteria 987
210 Ga0105247_10590138 3300009101 Unclassified 822
211 Ga0114129_10001295 3300009147 Bacteria 33343
212 Ga0114129_10049253 3300009147 Bacteria 5920
213 Ga0114129_10084747 3300009147 Bacteria 4399
214 Ga0114129_10249259 3300009147 Bacteria 2385
215 Ga0114129_11799388 3300009147 Unclassified 745
216 Ga0105243_10002743 3300009148 Bacteria 14641
217 Ga0105243_10002765 3300009148 Bacteria 14591
218 Ga0105242_10000929 3300009176 Bacteria 22783
219 Ga0105242_10003088 3300009176 Bacteria 12997
220 Ga0105248_10341196 3300009177 Bacteria 1687
221 Ga0105248_10786498 3300009177 Bacteria 1074
222 Ga0105249_10002303 3300009553 Bacteria 16590
223 Ga0105249_10016514 3300009553 Bacteria 6548
224 Ga0105249_12738841 3300009553 Unclassified 565
225 Ga0105239_10050630 3300010375 Bacteria 4555
226 Ga0105246_10248692 3300011119 Bacteria 1410
227 Ga0157345_1007691 3300012498 Bacteria 885
228 Ga0157371_10192874 3300013102 Bacteria 1459
229 Ga0157369_10198596 3300013105 Bacteria 2105
230 Ga0157378_10013173 3300013297 Bacteria 7235
231 Ga0163162_10448525 3300013306 Bacteria 1422
232 Ga0157372_10740598 3300013307 Unclassified 1143
233 Ga0157375_10233812 3300013308 Bacteria 1997
234 Ga0157375_10633569 3300013308 Bacteria 1226
235 Ga0157380_10000622 3300014326 Bacteria 21784
236 Ga0157380_10827206 3300014326 Bacteria 945
237 Ga0157377_10194838 3300014745 Bacteria 1283
238 Ga0157377_10239682 3300014745 Bacteria 1170
239 Ga0157379_10047789 3300014968 Bacteria 3819
240 Ga0157376_10001003 3300014969 Bacteria 18413
241 Ga0157376_10320913 3300014969 Bacteria 1472
242 Ga0163161_11390540 3300017792 Bacteria 613
243 Ga0207653_10092674 3300025885 Bacteria 1060
244 Ga0207653_10102149 3300025885 Bacteria 1015
245 Ga0207692_10154105 3300025898 Bacteria 1318
246 Ga0207642_10001333 3300025899 Bacteria 7634
247 Ga0207688_10079417 3300025901 Bacteria 1871
248 Ga0207645_10095850 3300025907 Bacteria 1911
249 Ga0207645_10819197 3300025907 Bacteria 633
250 Ga0207643_10042917 3300025908 Bacteria 2551
251 Ga0207643_10198220 3300025908 Bacteria 1222
252 Ga0207707_10003530 3300025912 Bacteria 13848
253 Ga0207660_10016499 3300025917 Bacteria 4889
254 Ga0207660_10045756 3300025917 Bacteria 3084
255 Ga0207662_10000451 3300025918 Bacteria 18219
256 Ga0207662_10077895 3300025918 Bacteria 2017
257 Ga0207662_10098211 3300025918 Bacteria 1811
258 Ga0207662_10491110 3300025918 Bacteria 844
259 Ga0207662_10591022 3300025918 Bacteria 772
260 Ga0207652_10042969 3300025921 Bacteria 3848
261 Ga0207652_10297380 3300025921 Bacteria 1457
262 Ga0207681_10000304 3300025923 Bacteria 36250
263 Ga0207659_10215554 3300025926 Bacteria 1541
264 Ga0207687_10003609 3300025927 Bacteria 10421
265 Ga0207644_10132637 3300025931 Bacteria 1909
266 Ga0207706_10191993 3300025933 Bacteria 1792
267 Ga0207706_10297859 3300025933 Bacteria 1406
268 Ga0207686_10012404 3300025934 Bacteria 4687
269 Ga0207709_10001689 3300025935 Bacteria 14842
270 Ga0207709_10008151 3300025935 Bacteria 5802
271 Ga0207670_10004486 3300025936 Bacteria 7522
272 Ga0207670_10225792 3300025936 Bacteria 1436
273 Ga0207670_10548011 3300025936 Bacteria 944
274 Ga0207669_10425372 3300025937 Bacteria 1046
275 Ga0207669_10501704 3300025937 Bacteria 971
276 Ga0207704_10006821 3300025938 Bacteria 5350
277 Ga0207704_10052344 3300025938 Bacteria 2475
278 Ga0207704_10605273 3300025938 Bacteria 898
279 Ga0207665_10145872 3300025939 Bacteria 1691
280 Ga0207691_10072707 3300025940 Bacteria 3102
281 Ga0207691_10089329 3300025940 Bacteria 2763
282 Ga0207691_10359650 3300025940 Bacteria 1245
283 Ga0207711_11039644 3300025941 Bacteria 759
284 Ga0207689_10001368 3300025942 Bacteria 23383
285 Ga0207689_10010444 3300025942 Bacteria 7994
286 Ga0207689_10158779 3300025942 Bacteria 1864
287 Ga0207689_10456402 3300025942 Bacteria 1068
288 Ga0207667_10020298 3300025949 Bacteria 7394
289 Ga0207651_10067767 3300025960 Bacteria 2513
290 Ga0207651_10687395 3300025960 Bacteria 900
291 Ga0207712_10003457 3300025961 Bacteria 9975
292 Ga0207668_10105243 3300025972 Bacteria 2105
293 Ga0207640_10009835 3300025981 Bacteria 5365
294 Ga0207640_10179792 3300025981 Bacteria 1585
295 Ga0207677_10006533 3300026023 Bacteria 6403
296 Ga0207703_10016330 3300026035 Bacteria 5787
297 Ga0207703_10920733 3300026035 Bacteria 837
298 Ga0207639_10103705 3300026041 Bacteria 2305
299 Ga0207708_10000114 3300026075 Bacteria 61971
300 Ga0207708_10000661 3300026075 Bacteria 26424
301 Ga0207708_10083280 3300026075 Bacteria 2459
302 Ga0207708_10111732 3300026075 Bacteria 2122
303 Ga0207708_10284260 3300026075 Bacteria 1341
304 Ga0207708_10349040 3300026075 Bacteria 1213
305 Ga0207702_10500807 3300026078 Bacteria 1184
306 Ga0207641_10055731 3300026088 Bacteria 3357
307 Ga0207648_10000911 3300026089 Bacteria 33297
308 Ga0207648_10003084 3300026089 Bacteria 17602
309 Ga0207648_10505725 3300026089 Bacteria 1106
310 Ga0207648_10587493 3300026089 Bacteria 1026
311 Ga0207648_10942844 3300026089 Bacteria 807
312 Ga0207676_10140851 3300026095 Bacteria 2064
313 Ga0207676_10773341 3300026095 Bacteria 935
314 Ga0207674_10250511 3300026116 Bacteria 1718
315 Ga0207674_10430488 3300026116 Bacteria 1275
316 Ga0207675_100001145 3300026118 Bacteria 26271
317 Ga0207675_100004938 3300026118 Bacteria 12854
318 Ga0207675_101392094 3300026118 Bacteria 722
319 Ga0207675_102102277 3300026118 Bacteria 581
320 Ga0207683_10284568 3300026121 Bacteria 1511
321 Ga0207698_10119248 3300026142 Bacteria 2229
322 Ga0209969_1001234 3300027360 Bacteria 3526
323 Ga0209967_1015789 3300027364 Bacteria 1082
324 Ga0209967_1019494 3300027364 Bacteria 985
325 Ga0209967_1021552 3300027364 Bacteria 943
326 Ga0209981_1002079 3300027378 Bacteria 2553
327 Ga0209981_1014624 3300027378 Bacteria 1096
328 Ga0210000_1000244 3300027462 Bacteria 7725
329 Ga0210000_1004254 3300027462 Bacteria 2071
330 Ga0210000_1005001 3300027462 Bacteria 1923
331 Ga0210000_1017074 3300027462 Bacteria 1099
332 Ga0209995_1007589 3300027471 Bacteria 1748
333 Ga0209995_1094442 3300027471 Unclassified 515
334 Ga0209968_1002186 3300027526 Bacteria 2961
335 Ga0209968_1003261 3300027526 Bacteria 2435
336 Ga0209968_1005931 3300027526 Bacteria 1838
337 Ga0209970_1002437 3300027614 Bacteria 3170
338 Ga0210002_1049511 3300027617 Bacteria 723
339 Ga0209971_1001406 3300027682 Bacteria 5985
340 Ga0209966_1005819 3300027695 Bacteria 2125
341 Ga0209966_1016231 3300027695 Bacteria 1407
342 Ga0209998_10046345 3300027717 Bacteria 997
343 Ga0209974_10021775 3300027876 Bacteria 2123
344 Ga0209974_10172153 3300027876 Bacteria 790
345 Ga0207428_10000624 3300027907 Bacteria 41590
346 Ga0207428_10066898 3300027907 Bacteria 2830
347 Ga0268265_10000291 3300028380 Bacteria 56604
348 Ga0268265_10273810 3300028380 Bacteria 1507
349 Ga0268265_10355278 3300028380 Bacteria 1339
350 Ga0268264_10005385 3300028381 Bacteria 10835
351 Ga0268264_10105768 3300028381 Bacteria 2455
352 Ga0268264_10562705 3300028381 Bacteria 1120
353 Ga0307408_100168846 3300031548 Bacteria 1745
354 Ga0307408_100358543 3300031548 Bacteria 1239
355 Ga0307408_100940327 3300031548 Bacteria 793
356 Ga0316575_10004386 3300031665 Bacteria 4963
357 Ga0316579_10011034 3300031691 Bacteria 3831
358 Ga0316578_10359380 3300031728 Bacteria 866
359 Ga0307405_10078195 3300031731 Bacteria 2152
360 Ga0307405_10333768 3300031731 Bacteria 1163
361 Ga0307405_10702021 3300031731 Bacteria 838
362 Ga0307413_11127610 3300031824 Bacteria 679
363 Ga0307406_10535828 3300031901 Bacteria 955
364 Ga0307412_10268807 3300031911 Bacteria 1333
365 Ga0307412_10476158 3300031911 Bacteria 1034
366 Ga0307409_101612622 3300031995 Bacteria 677
367 Ga0307409_101763574 3300031995 Unclassified 648
368 Ga0307416_100081283 3300032002 Bacteria 2739
369 Ga0307416_100398833 3300032002 Bacteria 1412
370 Ga0307416_100436721 3300032002 Bacteria 1358
371 Ga0307416_100492392 3300032002 Bacteria 1288
372 Ga0307416_101163176 3300032002 Bacteria 877
373 Ga0307416_101345010 3300032002 Bacteria 820
374 Ga0307416_101974128 3300032002 Bacteria 686
375 Ga0307416_102188911 3300032002 Bacteria 654
376 Ga0307411_10117798 3300032005 Bacteria 1915
377 Ga0307411_11623955 3300032005 Bacteria 597
378 Ga0316583_10060020 3300032133 Bacteria 1333
379 Ga0373930_0023007 3300034816 Bacteria 1237
380 Ga0373948_0005264 3300034817 Bacteria 2089
381 Ga0373950_0079926 3300034818 Bacteria 682
382 Ga0373959_0061358 3300034820 Bacteria 833
383 Ga0373938_0009141 3300034957 Bacteria 1788
384 Ga0373929_0008770 3300035085 Bacteria 1867
385 Ga0373934_0058768 3300035086 Bacteria 1530
386 Ga0373944_0007652 3300035089 Bacteria 2900
387 Ga0373949_0029819 3300035090 Bacteria 1294
388 Ga0373951_0158833 3300035091 Unclassified 638
389 Ga0373952_0005368 3300035092 Bacteria 2342
390 Ga0373923_0052221 3300035111 Bacteria 1717
391 Ga0373923_0113308 3300035111 Bacteria 1206
392 Ga0373932_0005751 3300035112 Bacteria 2918
393 Ga0373932_0046432 3300035112 Bacteria 1273
394 Ga0373939_0041137 3300035114 Bacteria 1392
395 Ga0373939_0087377 3300035114 Bacteria 1047
396 Ga0373941_0014165 3300035115 Bacteria 2125
397 Ga0373945_0099453 3300035116 Bacteria 1136
398 Ga0373953_0480036 3300035117 Unclassified 550
399 Ga0373954_0000001 3300035118 Bacteria 158201
400 Ga0373960_0114978 3300035121 Bacteria 887
401 Ga0373943_0238590 3300035170 Bacteria 1018
402 Ga0373943_0752881 3300035170 Unclassified 579
403 Ga0373955_0015957 3300035172 Bacteria 3688
404 Ga0373942_0010187 3300035207 Bacteria 2208
405 Ga0373942_0221530 3300035207 Unclassified 634
406 Ga0373961_0036023 3300035241 Bacteria 1407
407 Ga0373962_0135918 3300035242 Bacteria 795
408 Ga0316574_0039547 3300035398 Bacteria 2901
409 Ga0373924_0013134 3300035410 Bacteria 3108
410 Ga0373931_0012509 3300035691 Bacteria 4112
411 Ga0373931_0017628 3300035691 Bacteria 3535
412 Ga0373931_0041736 3300035691 Bacteria 2410
413 Ga0373931_0273563 3300035691 Bacteria 1035
414 Ga0373935_0005815 3300035692 Bacteria 7303
415 Ga0373935_0020327 3300035692 Bacteria 4055
416 Ga0373927_0019908 3300035695 Bacteria 4401
417 Ga0373933_0003292 3300035724 Bacteria 9037
418 Ga0373933_0055614 3300035724 Bacteria 2374
419 Ga0373947_0332870 3300035725 Unclassified 1017
420 Ga0373937_0002088 3300036401 Bacteria 16721
421 Ga0373937_0004036 3300036401 Bacteria 12433
422 Ga0373937_0005335 3300036401 Bacteria 10990
423 Ga0373937_0076564 3300036401 Bacteria 3090
424 Ga0373937_0577845 3300036401 Bacteria 1067
425 Ga0316582_0051328 3300036647 Bacteria 2616
426 Ga0316584_0252869 3300036712 Bacteria 1287
427 Ga0373925_0160963 3300037068 Bacteria 1768
428 Ga0373925_0291614 3300037068 Bacteria 1316
429 Ga0373925_0468725 3300037068 Bacteria 1032
430 Ga0373925_1033584 3300037068 Bacteria 676
431 Ga0316581_0033239 3300037588 Bacteria 1557
432 Ga0439453_0022092 3300041408 Bacteria 1151
433 Ga0451800_0590836 3300041459 Bacteria 1033
434 Ga0451807_0223193 3300041486 Bacteria 5144
435 Ga0451849_0236698 3300041505 Unclassified 704
436 Ga0439441_001242 3300042001 Bacteria 3261
437 Ga0439441_003060 3300042001 Bacteria 2423
438 Ga0439441_020947 3300042001 Bacteria 1202
439 Ga0439441_023293 3300042001 Bacteria 1156
440 Ga0439441_111947 3300042001 Bacteria 620
441 Ga0439451_045861 3300042009 Bacteria 875
442 Ga0450923_029590 3300042125 Bacteria 1110
443 Ga0439446_0003264 3300042156 Bacteria 4005
444 Ga0439434_0050249 3300042435 Bacteria 1291
445 Ga0439435_0004566 3300042436 Bacteria 2995
446 Ga0439435_0026517 3300042436 Bacteria 1543
447 Ga0439460_0218265 3300042461 Bacteria 653
448 Ga0451577_0491780 3300042876 Bacteria 1114
449 Ga0451577_0637814 3300042876 Bacteria 966
450 Ga0453683_0779592 3300044673 Unclassified 629
451 Ga0453683_0889080 3300044673 Unclassified 589
452 Ga0453684_0597621 3300044712 Bacteria 1210
453 Ga0466968_0110295 3300044735 Bacteria 1237
454 Ga0451576_0000220 3300045051 Bacteria 141261
455 Ga0451576_0011347 3300045051 Bacteria 10138
456 Ga0451576_0039298 3300045051 Bacteria 5008
457 Ga0451576_0055308 3300045051 Bacteria 4152
458 Ga0451576_0075761 3300045051 Bacteria 3501
459 Ga0451576_0306568 3300045051 Bacteria 1661
460 Ga0451576_0470090 3300045051 Bacteria 1320
461 Ga0451576_0515175 3300045051 Bacteria 1257
462 Ga0451576_0539559 3300045051 Bacteria 1225
463 Ga0451576_0650871 3300045051 Bacteria 1107
464 Ga0451576_2552556 3300045051 Unclassified 521
465 Ga0495592_0033193 3300046454 Bacteria 3893
466 Ga0495603_0522675 3300046455 Unclassified 680
467 Ga0495653_0127151 3300046463 Bacteria 1808
468 Ga0495582_0020920 3300046473 Bacteria 3583
469 Ga0495639_0035832 3300046475 Bacteria 2221
470 Ga0495639_0037405 3300046475 Bacteria 2175
471 Ga0495664_0334453 3300046477 Bacteria 913
472 Ga0495608_0000699 3300046511 Bacteria 23284
473 Ga0495608_0132027 3300046511 Bacteria 1598
474 Ga0495608_0482678 3300046511 Unclassified 752
475 Ga0495618_0005634 3300046514 Bacteria 7613
476 Ga0495628_0039967 3300046516 Bacteria 3750
477 Ga0495630_0020802 3300046517 Bacteria 4842
478 Ga0495630_0436660 3300046517 Bacteria 1003
479 Ga0495666_0001314 3300046526 Bacteria 12011
480 Ga0495666_0034032 3300046526 Bacteria 2487
481 Ga0495642_0031497 3300046528 Bacteria 2127
482 Ga0495652_0291781 3300046529 Bacteria 1189
483 Ga0495640_0016283 3300046533 Bacteria 5564
484 Ga0495586_0004476 3300046535 Bacteria 7462
485 Ga0495586_0049351 3300046535 Bacteria 2275
486 Ga0495587_0155924 3300046536 Bacteria 1300
487 Ga0495598_0041480 3300046537 Bacteria 1347
488 Ga0495598_0076291 3300046537 Bacteria 1066
489 Ga0495621_0053083 3300046539 Bacteria 1454
490 Ga0495621_0086504 3300046539 Bacteria 1176
491 Ga0495621_0259563 3300046539 Bacteria 711
492 Ga0495667_0015049 3300046559 Bacteria 5222
493 Ga0495667_0294983 3300046559 Bacteria 1028
494 Ga0495667_0721817 3300046559 Bacteria 617
495 Ga0495656_0131010 3300046615 Bacteria 1193
496 Ga0495634_0020503 3300046642 Bacteria 4687
497 Ga0495635_0010179 3300046663 Bacteria 6575
498 Ga0495635_0326890 3300046663 Bacteria 1026
499 Ga0495659_0150743 3300046664 Bacteria 933
500 Ga0495659_0369484 3300046664 Bacteria 615
501 Ga0495588_0011820 3300046674 Bacteria 4108
502 Ga0495657_0048356 3300046675 Bacteria 2870
503 Ga0495599_0011173 3300046678 Bacteria 5512
504 Ga0495623_0193033 3300046679 Bacteria 1175
505 Ga0495647_0000629 3300046681 Bacteria 10406
506 Ga0495658_0001812 3300046683 Bacteria 10957
507 Ga0495658_0005679 3300046683 Bacteria 6130
508 Ga0495669_0357958 3300046684 Bacteria 706
509 Ga0495613_0005871 3300046689 Bacteria 9186
510 Ga0495624_0017062 3300046690 Bacteria 4880
511 Ga0495670_0203376 3300046691 Bacteria 1049
512 Ga0495600_0002776 3300046809 Bacteria 10157
513 Ga0495604_0000911 3300047317 Bacteria 24567
514 Ga0495604_0728583 3300047317 Bacteria 628
515 Ga0495636_0002487 3300047318 Bacteria 7065
516 Ga0495636_0216178 3300047318 Bacteria 879
517 Ga0495674_0082028 3300047319 Bacteria 2765
518 Ga0495680_0001752 3300047322 Bacteria 23001
519 Ga0495684_0078488 3300047471 Bacteria 2506
520 Ga0495684_0289002 3300047471 Bacteria 1181
521 Ga0495593_0143280 3300047673 Bacteria 1210
522 Ga0496106_0106878 3300048909 Bacteria 2176
523 Ga0496107_1054682 3300048910 Bacteria 588
524 Ga0496109_0587318 3300048912 Bacteria 1050
525 Ga0501292_035619 3300049515 Bacteria 847
526 Ga0501297_017998 3300049520 Bacteria 865
527 Ga0501298_020524 3300049521 Bacteria 1232
528 Ga0501031_0042654 3300049568 Bacteria 2961
529 Ga0501032_0050512 3300049569 Bacteria 2805
530 Ga0501032_0099766 3300049569 Bacteria 1924
531 Ga0501033_0002252 3300049570 Bacteria 16527
532 Ga0501033_0098934 3300049570 Bacteria 2130
533 Ga0501036_0001390 3300049572 Bacteria 18603
534 Ga0501036_0807408 3300049572 Bacteria 772
535 Ga0501037_0058252 3300049573 Bacteria 2819
536 Ga0501037_0531696 3300049573 Unclassified 795
537 Ga0501038_0009942 3300049574 Bacteria 8711
538 Ga0501038_0040513 3300049574 Bacteria 4067
539 Ga0501038_0365110 3300049574 Bacteria 1122
540 Ga0501039_0003327 3300049575 Bacteria 12013
541 Ga0501039_0018051 3300049575 Bacteria 5412
542 Ga0501039_0119561 3300049575 Bacteria 2064
543 Ga0501040_0003272 3300049576 Bacteria 10469
544 Ga0501040_0004976 3300049576 Bacteria 8595
545 Ga0501040_0146342 3300049576 Bacteria 1665
546 Ga0501040_0159000 3300049576 Bacteria 1597
547 Ga0501041_0009597 3300049577 Bacteria 5705
548 Ga0501041_0012123 3300049577 Bacteria 5104
549 Ga0501041_0044766 3300049577 Bacteria 2689
550 Ga0501041_0097342 3300049577 Bacteria 1819
551 Ga0501042_0009785 3300049578 Bacteria 6406
552 Ga0501042_0026736 3300049578 Bacteria 4054
553 Ga0501042_0127018 3300049578 Bacteria 1836
554 Ga0501042_0576655 3300049578 Bacteria 818
555 Ga0501043_0074884 3300049579 Bacteria 2659
556 Ga0501043_0171372 3300049579 Bacteria 1693
557 Ga0501043_0905435 3300049579 Unclassified 632
558 Ga0501046_0000460 3300049580 Bacteria 40737
559 Ga0501047_0162845 3300049581 Bacteria 2102
560 Ga0501048_0004228 3300049582 Bacteria 10944
561 Ga0501048_0055119 3300049582 Bacteria 2823
562 Ga0501048_0158470 3300049582 Bacteria 1601
563 Ga0501048_0176524 3300049582 Bacteria 1514
564 Ga0501048_0244843 3300049582 Bacteria 1272
565 Ga0501067_0539965 3300049583 Unclassified 653
566 Ga0501068_0031189 3300049584 Bacteria 3165
567 Ga0501068_0057214 3300049584 Bacteria 2364
568 Ga0501069_0372789 3300049585 Bacteria 843
569 Ga0501070_0049965 3300049586 Bacteria 3472
570 Ga0501071_0003387 3300049587 Bacteria 9957
571 Ga0501071_0007694 3300049587 Bacteria 7099
572 Ga0501071_0084458 3300049587 Bacteria 2327
573 Ga0501071_0184095 3300049587 Bacteria 1565
574 Ga0501071_0199257 3300049587 Bacteria 1503
575 Ga0501071_0655366 3300049587 Bacteria 808
576 Ga0501072_0012726 3300049588 Bacteria 6433
577 Ga0501072_0013930 3300049588 Bacteria 6162
578 Ga0501072_0067174 3300049588 Bacteria 2829
579 Ga0501072_0097805 3300049588 Bacteria 2333
580 Ga0501072_0394839 3300049588 Bacteria 1097
581 Ga0501072_0396788 3300049588 Bacteria 1094
582 Ga0501073_0305291 3300049589 Bacteria 1098
583 Ga0501074_0002909 3300049590 Bacteria 12017
584 Ga0501074_0037007 3300049590 Bacteria 3537
585 Ga0501075_0001178 3300049591 Bacteria 16926
586 Ga0501075_0003062 3300049591 Bacteria 11174
587 Ga0501075_0022897 3300049591 Bacteria 4569
588 Ga0501075_0031139 3300049591 Bacteria 3958
589 Ga0501075_0347319 3300049591 Bacteria 1131
590 Ga0501076_0003990 3300049592 Bacteria 10425
591 Ga0501076_0004462 3300049592 Bacteria 9956
592 Ga0501076_0545362 3300049592 Bacteria 956
593 Ga0501077_0001059 3300049593 Bacteria 16564
594 Ga0501077_0343265 3300049593 Bacteria 952
595 Ga0501077_0514667 3300049593 Bacteria 768
596 Ga0501214_059318 3300049659 Unclassified 601
597 Ga0501216_108948 3300049660 Unclassified 620
598 Ga0501217_084770 3300049661 Bacteria 882
599 Ga0501235_144185 3300049669 Unclassified 612
600 Ga0501236_024467 3300049670 Bacteria 917
601 Ga0501253_044542 3300049683 Bacteria 908
602 Ga0501221_035611 3300049704 Bacteria 1063
603 Ga0501225_0179044 3300049705 Bacteria 662
604 Ga0501234_059962 3300049707 Unclassified 644
605 Ga0501079_0000447 3300049741 Bacteria 26895
606 Ga0501079_0012637 3300049741 Bacteria 6448
607 Ga0501079_0226377 3300049741 Bacteria 1461
608 Ga0501079_0562238 3300049741 Bacteria 897
609 Ga0501079_1072267 3300049741 Unclassified 635
610 Ga0501080_0027822 3300049742 Bacteria 5257
611 Ga0501080_0045774 3300049742 Bacteria 4073
612 Ga0501080_0227434 3300049742 Bacteria 1706
613 Ga0501080_0676695 3300049742 Bacteria 911
614 Ga0501081_0000171 3300049743 Bacteria 30406
615 Ga0501081_0008726 3300049743 Bacteria 6588
616 Ga0501081_0031229 3300049743 Bacteria 3610
617 Ga0501081_0166547 3300049743 Bacteria 1590
618 Ga0501083_0220642 3300049744 Bacteria 1235
619 Ga0501278_038778 3300049774 Unclassified 512
620 Ga0501035_0034591 3300049822 Bacteria 4590
621 Ga0501035_0253180 3300049822 Bacteria 1495
622 Ga0501035_0298517 3300049822 Bacteria 1358
623 Ga0501035_0517467 3300049822 Bacteria 980
624 Ga0501035_0592414 3300049822 Bacteria 904
625 Ga0501045_0000437 3300049824 Bacteria 25547
626 Ga0501045_0068280 3300049824 Bacteria 2611
627 Ga0501045_0116699 3300049824 Bacteria 1981
628 Ga0501045_0138990 3300049824 Bacteria 1806
629 Ga0501204_036073 3300049850 Bacteria 706
630 nmdc:mga05p37_164496_c1 3300050507 Bacteria 2708
631 nmdc:mga05p37_170077_c1 3300050507 Bacteria 2658
632 nmdc:mga05p37_2159_c1 3300050507 Bacteria 22932
633 nmdc:mga05p37_416_c1 3300050507 Bacteria 46050
634 nmdc:mga09592_116384_c1 3300050508 Bacteria 2294
635 nmdc:mga09592_1272_c1 3300050508 Bacteria 20245
636 nmdc:mga09592_145706_c1 3300050508 Bacteria 2042
637 nmdc:mga09592_293662_c1 3300050508 Bacteria 1409
638 nmdc:mga09592_6132_c1 3300050508 Bacteria 9792
639 nmdc:mga0qj67_25215_c1 3300050509 Bacteria 4592
640 nmdc:mga0qj67_316187_c1 3300050509 Bacteria 1264
641 nmdc:mga0qj67_347978_c1 3300050509 Bacteria 1198
642 nmdc:mga0qj67_6302_c1 3300050509 Bacteria 8708
643 nmdc:mga0qj67_73187_c1 3300050509 Bacteria 2737
644 nmdc:mga0qj67_92493_c1 3300050509 Bacteria 2432
645 nmdc:mga0qj67_96394_c1 3300050509 Bacteria 2382
646 nmdc:mga06r32_107282_c1 3300050510 Bacteria 2744
647 nmdc:mga06r32_2072_c1 3300050510 Bacteria 17946
648 nmdc:mga06r32_215181_c1 3300050510 Bacteria 1909
649 nmdc:mga06r32_288337_c1 3300050510 Bacteria 1628
650 nmdc:mga06r32_430784_c1 3300050510 Bacteria 1300
651 nmdc:mga06r32_65862_c1 3300050510 Bacteria 3495
652 nmdc:mga06r32_77595_c1 3300050510 Bacteria 3227
653 nmdc:mga08y16_106535_c1 3300050511 Bacteria 2918
654 nmdc:mga08y16_1495078_c1 3300050511 Bacteria 636
655 nmdc:mga08y16_24628_c1 3300050511 Bacteria 6352
656 nmdc:mga08y16_292331_c1 3300050511 Bacteria 1680
657 nmdc:mga08y16_350298_c1 3300050511 Bacteria 1517
658 nmdc:mga08y16_46985_c1 3300050511 Bacteria 4519
659 nmdc:mga08y16_6286_c1 3300050511 Bacteria 12456
660 nmdc:mga0n895_23459_c1 3300050512 Bacteria 5799
661 nmdc:mga0n895_317732_c1 3300050512 Bacteria 1578
662 nmdc:mga0n895_47771_c1 3300050512 Bacteria 4187
663 nmdc:mga0n895_78702_c1 3300050512 Bacteria 3282
664 nmdc:mga0rr50_1038185_c1 3300050513 Bacteria 698
665 nmdc:mga0rr50_233165_c1 3300050513 Bacteria 1524
666 nmdc:mga0rr50_23609_c1 3300050513 Bacteria 4244
667 nmdc:mga0rr50_487322_c1 3300050513 Bacteria 1047
668 nmdc:mga0rr50_6074_c1 3300050513 Bacteria 7300
669 nmdc:mga0rr50_678953_c1 3300050513 Bacteria 879
670 nmdc:mga0rr50_7453_c1 3300050513 Bacteria 6751
671 nmdc:mga0rr50_87094_c1 3300050513 Bacteria 2424
672 nmdc:mga08x19_156038_c1 3300050514 Bacteria 1548
673 nmdc:mga08x19_29693_c1 3300050514 Bacteria 3430
674 nmdc:mga08x19_503570_c1 3300050514 Bacteria 855
675 nmdc:mga08x19_79622_c1 3300050514 Bacteria 2149
676 nmdc:mga08x19_8685_c1 3300050514 Bacteria 6058
677 nmdc:mga0a205_28096_c1 3300050515 Bacteria 5376
678 nmdc:mga0a205_28999_c1 3300050515 Bacteria 5294
679 nmdc:mga0a205_349355_c1 3300050515 Bacteria 1346
680 nmdc:mga0a205_73230_c1 3300050515 Bacteria 3310
681 nmdc:mga0a205_8025_c1 3300050515 Bacteria 5997
682 Ga0495601_0021631 3300053077 Bacteria 3940
683 Ga0501084_0002871 3300054114 Bacteria 13935
684 Ga0501084_0005864 3300054114 Bacteria 10110
685 Ga0501084_0077948 3300054114 Bacteria 2778
686 Ga0501084_0652256 3300054114 Bacteria 889
687 Ga0501082_0002464 3300060353 Bacteria 16242
688 Ga0501082_0008621 3300060353 Bacteria 8793
689 Ga0501082_0147747 3300060353 Bacteria 2041
690 Ga0501082_0359850 3300060353 Bacteria 1269
691 Ga0501082_0500381 3300060353 Bacteria 1062
692 Ga0530510_0000149 3300061734 Bacteria 41720
693 Ga0530510_0002725 3300061734 Bacteria 12166
694 Ga0530510_0108706 3300061734 Bacteria 2030
695 Ga0530510_0815946 3300061734 Bacteria 712
696 Ga0075430_100852375
697 rootH2_10230354
698 JGI26137J50245_102323
699 Ga0065707_10164752
700 Ga0065707_10196211
701 Ga0065707_10569465
702 Ga0065707_10831756
703 Ga0070676_10157479
704 Ga0070676_10590518
705 Ga0070683_101179282
706 Ga0070690_100003369
707 Ga0070690_100007967
708 Ga0068869_100006668
709 Ga0068869_101098611
710 Ga0070680_100003555
711 Ga0070680_100229525
712 Ga0070680_100802288
713 Ga0070682_100007277
714 Ga0070682_100361278
715 Ga0068868_100010982
716 Ga0068868_100096516
717 Ga0070689_100002360
718 Ga0070689_100300647
719 Ga0070691_10016362
720 Ga0070691_10035993
721 Ga0070691_10144010
722 Ga0070687_100001773
723 Ga0070687_100754957
724 Ga0070692_10011998
725 Ga0070692_10015417
726 Ga0070692_10400736
727 Ga0070669_100001963
728 Ga0070675_100338299
729 Ga0070675_100929062
730 Ga0070671_100185815
731 Ga0070674_100084697
732 Ga0070674_100450511
733 Ga0070673_100045204
734 Ga0070673_100421331
735 Ga0070688_100459025
736 Ga0070688_100531981
737 Ga0070703_10290726
738 Ga0070709_10771266
739 Ga0070713_100097027
740 Ga0070701_10003296
741 Ga0070701_10224539
742 Ga0070701_10224579
743 Ga0070701_10226281
744 Ga0070705_100007453
745 Ga0070705_100097802
746 Ga0070705_100400242
747 Ga0070700_100002410
748 Ga0070700_100010066
749 Ga0070700_100093839
750 Ga0070700_100108041
751 Ga0070700_100191954
752 Ga0070700_100551194
753 Ga0070694_100016546
754 Ga0070694_100019205
755 Ga0070694_100058698
756 Ga0070694_100404411
757 Ga0070694_100572502
758 Ga0070708_100445743
759 Ga0070678_100033174
760 Ga0070662_100143691
761 Ga0070662_100926234
762 Ga0070681_10013546
763 Ga0068867_100000347
764 Ga0068867_100009496
765 Ga0068867_100412685
766 Ga0068867_100593690
767 Ga0068867_101345142
768 Ga0070685_10490130
769 Ga0070685_10842349
770 Ga0070707_100912174
771 Ga0070699_100027635
772 Ga0070699_100088027
773 Ga0070699_100734215
774 Ga0070699_101012634
775 Ga0070679_100191382
776 Ga0070679_100387003
777 Ga0070684_100017611
778 Ga0070697_100182203
779 Ga0068853_100053794
780 Ga0068853_101652479
781 Ga0070672_100482971
782 Ga0070672_100837468
783 Ga0070672_101660971
784 Ga0070686_100005616
785 Ga0070686_100083373
786 Ga0070686_100138232
787 Ga0070686_100482220
788 Ga0070686_100689286
789 Ga0070695_100009100
790 Ga0070695_100033512
791 Ga0070695_100102722
792 Ga0070695_100125666
793 Ga0070695_100546878
794 Ga0070696_100001380
795 Ga0070696_100006062
796 Ga0070696_100007654
797 Ga0070696_100013721
798 Ga0070696_100116374
799 Ga0070696_101497186
800 Ga0070693_100000208
801 Ga0070693_100165314
802 Ga0070704_100001465
803 Ga0070704_100052015
804 Ga0070704_100329519
805 Ga0068855_100015728
806 Ga0068857_100648242
807 Ga0068854_100272752
808 Ga0068854_100317691
809 Ga0068856_100036287
810 Ga0068856_100809283
811 Ga0070702_100004253
812 Ga0070702_100029298
813 Ga0070702_100283838
814 Ga0070702_100552093
815 Ga0070702_100915334
816 Ga0068852_100134813
817 Ga0068859_100006943
818 Ga0068859_100026359
819 Ga0068859_100035478
820 Ga0068859_100549284
821 Ga0068859_100561406
822 Ga0068864_100187639
823 Ga0068864_100947360
824 Ga0068866_10003990
825 Ga0068866_10502358
826 Ga0068861_100000215
827 Ga0068861_100065877
828 Ga0068861_100367623
829 Ga0068861_100884424
830 Ga0068870_10192142
831 Ga0068870_10571114
832 Ga0068863_100627644
833 Ga0068863_100697944
834 Ga0068858_100003477
835 Ga0068858_100527912
836 Ga0068858_100992089
837 Ga0068860_100006430
838 Ga0068860_100982381
839 Ga0068862_100002007
840 Ga0068862_100007738
841 Ga0070712_100325443
842 Ga0097621_100001643
843 Ga0097621_100006336
844 Ga0097621_101057203
845 Ga0068871_100000860
846 Ga0068871_100001672
847 Ga0075428_100004699
848 Ga0075428_100009795
849 Ga0075428_100053948
850 Ga0075428_100104470
851 Ga0075428_100416956
852 Ga0075428_100472880
853 Ga0075428_101194885
854 Ga0075430_100013572
855 Ga0075430_100025133
856 Ga0075430_100055421
857 Ga0075430_100131638
858 Ga0075430_100140752
859 Ga0075430_100626954
860 Ga0075431_100007463
861 Ga0075431_100019521
862 Ga0075431_100094906
863 Ga0075431_100126778
864 Ga0075431_100127182
865 Ga0075431_100145637
866 Ga0075431_100183686
867 Ga0075433_10018417
868 Ga0075433_10028193
869 Ga0075433_10103118
870 Ga0075433_10204355
871 Ga0075433_10682989
872 Ga0075434_100007513
873 Ga0075434_100013968
874 Ga0075434_100216691
875 Ga0075429_100000330
876 Ga0075429_100000786
877 Ga0075429_100091766
878 Ga0075429_100292784
879 Ga0075429_100397553
880 Ga0068865_100003692
881 Ga0068865_100004558
882 Ga0068865_100747040
883 Ga0075436_100007561
884 Ga0075436_100022992
885 Ga0075436_100045107
886 Ga0075436_100049469
887 Ga0075436_100071711
888 Ga0097620_100006944
889 Ga0097620_100026363
890 Ga0097620_100035477
891 Ga0097620_100549212
892 Ga0097620_100561403
893 Ga0075435_100006817
894 Ga0075435_100014594
895 Ga0099794_10002615
896 Ga0105250_10178058
897 Ga0111539_10031884
898 Ga0111539_10032268
899 Ga0111539_10237281
900 Ga0111539_10446415
901 Ga0111539_10682993
902 Ga0111539_10804505
903 Ga0105245_10020049
904 Ga0105245_10789449
905 Ga0105247_10590138
906 Ga0114129_10001295
907 Ga0114129_10049253
908 Ga0114129_10084747
909 Ga0114129_10249259
910 Ga0114129_11799388
911 Ga0105243_10002743
912 Ga0105243_10002765
913 Ga0105242_10000929
914 Ga0105242_10003088
915 Ga0105248_10341196
916 Ga0105248_10786498
917 Ga0105249_10002303
918 Ga0105249_10016514
919 Ga0105249_12738841
920 Ga0105239_10050630
921 Ga0105246_10248692
922 Ga0157345_1007691
923 Ga0157371_10192874
924 Ga0157369_10198596
925 Ga0157378_10013173
926 Ga0163162_10448525
927 Ga0157372_10740598
928 Ga0157375_10233812
929 Ga0157375_10633569
930 Ga0157380_10000622
931 Ga0157380_10827206
932 Ga0157377_10194838
933 Ga0157377_10239682
934 Ga0157379_10047789
935 Ga0157376_10001003
936 Ga0157376_10320913
937 Ga0163161_11390540
938 Ga0207653_10092674
939 Ga0207653_10102149
940 Ga0207692_10154105
941 Ga0207642_10001333
942 Ga0207688_10079417
943 Ga0207645_10095850
944 Ga0207645_10819197
945 Ga0207643_10042917
946 Ga0207643_10198220
947 Ga0207707_10003530
948 Ga0207660_10016499
949 Ga0207660_10045756
950 Ga0207662_10000451
951 Ga0207662_10077895
952 Ga0207662_10098211
953 Ga0207662_10491110
954 Ga0207662_10591022
955 Ga0207652_10042969
956 Ga0207652_10297380
957 Ga0207681_10000304
958 Ga0207659_10215554
959 Ga0207687_10003609
960 Ga0207644_10132637
961 Ga0207706_10191993
962 Ga0207706_10297859
963 Ga0207686_10012404
964 Ga0207709_10001689
965 Ga0207709_10008151
966 Ga0207670_10004486
967 Ga0207670_10225792
968 Ga0207670_10548011
969 Ga0207669_10425372
970 Ga0207669_10501704
971 Ga0207704_10006821
972 Ga0207704_10052344
973 Ga0207704_10605273
974 Ga0207665_10145872
975 Ga0207691_10072707
976 Ga0207691_10089329
977 Ga0207691_10359650
978 Ga0207711_11039644
979 Ga0207689_10001368
980 Ga0207689_10010444
981 Ga0207689_10158779
982 Ga0207689_10456402
983 Ga0207667_10020298
984 Ga0207651_10067767
985 Ga0207651_10687395
986 Ga0207712_10003457
987 Ga0207668_10105243
988 Ga0207640_10009835
989 Ga0207640_10179792
990 Ga0207677_10006533
991 Ga0207703_10016330
992 Ga0207703_10920733
993 Ga0207639_10103705
994 Ga0207708_10000114
995 Ga0207708_10000661
996 Ga0207708_10083280
997 Ga0207708_10111732
998 Ga0207708_10284260
999 Ga0207708_10349040
1000 Ga0207702_10500807
1001 Ga0207641_10055731
1002 Ga0207648_10000911
1003 Ga0207648_10003084
1004 Ga0207648_10505725
1005 Ga0207648_10587493
1006 Ga0207648_10942844
1007 Ga0207676_10140851
1008 Ga0207676_10773341
1009 Ga0207674_10250511
1010 Ga0207674_10430488
1011 Ga0207675_100001145
1012 Ga0207675_100004938
1013 Ga0207675_101392094
1014 Ga0207675_102102277
1015 Ga0207683_10284568
1016 Ga0207698_10119248
1017 Ga0209969_1001234
1018 Ga0209967_1015789
1019 Ga0209967_1019494
1020 Ga0209967_1021552
1021 Ga0209981_1002079
1022 Ga0209981_1014624
1023 Ga0210000_1000244
1024 Ga0210000_1004254
1025 Ga0210000_1005001
1026 Ga0210000_1017074
1027 Ga0209995_1007589
1028 Ga0209995_1094442
1029 Ga0209968_1002186
1030 Ga0209968_1003261
1031 Ga0209968_1005931
1032 Ga0209970_1002437
1033 Ga0210002_1049511
1034 Ga0209971_1001406
1035 Ga0209966_1005819
1036 Ga0209966_1016231
1037 Ga0209998_10046345
1038 Ga0209974_10021775
1039 Ga0209974_10172153
1040 Ga0207428_10000624
1041 Ga0207428_10066898
1042 Ga0268265_10000291
1043 Ga0268265_10273810
1044 Ga0268265_10355278
1045 Ga0268264_10005385
1046 Ga0268264_10105768
1047 Ga0268264_10562705
1048 Ga0307408_100168846
1049 Ga0307408_100358543
1050 Ga0307408_100940327
1051 Ga0316575_10004386
1052 Ga0316579_10011034
1053 Ga0316578_10359380
1054 Ga0307405_10078195
1055 Ga0307405_10333768
1056 Ga0307405_10702021
1057 Ga0307413_11127610
1058 Ga0307406_10535828
1059 Ga0307412_10268807
1060 Ga0307412_10476158
1061 Ga0307409_101612622
1062 Ga0307409_101763574
1063 Ga0307416_100081283
1064 Ga0307416_100398833
1065 Ga0307416_100436721
1066 Ga0307416_100492392
1067 Ga0307416_101163176
1068 Ga0307416_101345010
1069 Ga0307416_101974128
1070 Ga0307416_102188911
1071 Ga0307411_10117798
1072 Ga0307411_11623955
1073 Ga0316583_10060020
1074 Ga0373930_0023007
1075 Ga0373948_0005264
1076 Ga0373950_0079926
1077 Ga0373959_0061358
1078 Ga0373938_0009141
1079 Ga0373929_0008770
1080 Ga0373934_0058768
1081 Ga0373944_0007652
1082 Ga0373949_0029819
1083 Ga0373951_0158833
1084 Ga0373952_0005368
1085 Ga0373923_0052221
1086 Ga0373923_0113308
1087 Ga0373932_0005751
1088 Ga0373932_0046432
1089 Ga0373939_0041137
1090 Ga0373939_0087377
1091 Ga0373941_0014165
1092 Ga0373945_0099453
1093 Ga0373953_0480036
1094 Ga0373954_0000001
1095 Ga0373960_0114978
1096 Ga0373943_0238590
1097 Ga0373943_0752881
1098 Ga0373955_0015957
1099 Ga0373942_0010187
1100 Ga0373942_0221530
1101 Ga0373961_0036023
1102 Ga0373962_0135918
1103 Ga0316574_0039547
1104 Ga0373924_0013134
1105 Ga0373931_0012509
1106 Ga0373931_0017628
1107 Ga0373931_0041736
1108 Ga0373931_0273563
1109 Ga0373935_0005815
1110 Ga0373935_0020327
1111 Ga0373927_0019908
1112 Ga0373933_0003292
1113 Ga0373933_0055614
1114 Ga0373947_0332870
1115 Ga0373937_0002088
1116 Ga0373937_0004036
1117 Ga0373937_0005335
1118 Ga0373937_0076564
1119 Ga0373937_0577845
1120 Ga0316582_0051328
1121 Ga0316584_0252869
1122 Ga0373925_0160963
1123 Ga0373925_0291614
1124 Ga0373925_0468725
1125 Ga0373925_1033584
1126 Ga0316581_0033239
1127 Ga0439453_0022092
1128 Ga0451800_0590836
1129 Ga0451807_0223193
1130 Ga0451849_0236698
1131 Ga0439441_001242
1132 Ga0439441_003060
1133 Ga0439441_020947
1134 Ga0439441_023293
1135 Ga0439441_111947
1136 Ga0439451_045861
1137 Ga0450923_029590
1138 Ga0439446_0003264
1139 Ga0439434_0050249
1140 Ga0439435_0004566
1141 Ga0439435_0026517
1142 Ga0439460_0218265
1143 Ga0451577_0491780
1144 Ga0451577_0637814
1145 Ga0453683_0779592
1146 Ga0453683_0889080
1147 Ga0453684_0597621
1148 Ga0466968_0110295
1149 Ga0451576_0000220
1150 Ga0451576_0011347
1151 Ga0451576_0039298
1152 Ga0451576_0055308
1153 Ga0451576_0075761
1154 Ga0451576_0306568
1155 Ga0451576_0470090
1156 Ga0451576_0515175
1157 Ga0451576_0539559
1158 Ga0451576_0650871
1159 Ga0451576_2552556
1160 Ga0495592_0033193
1161 Ga0495603_0522675
1162 Ga0495653_0127151
1163 Ga0495582_0020920
1164 Ga0495639_0035832
1165 Ga0495639_0037405
1166 Ga0495664_0334453
1167 Ga0495608_0000699
1168 Ga0495608_0132027
1169 Ga0495608_0482678
1170 Ga0495618_0005634
1171 Ga0495628_0039967
1172 Ga0495630_0020802
1173 Ga0495630_0436660
1174 Ga0495666_0001314
1175 Ga0495666_0034032
1176 Ga0495642_0031497
1177 Ga0495652_0291781
1178 Ga0495640_0016283
1179 Ga0495586_0004476
1180 Ga0495586_0049351
1181 Ga0495587_0155924
1182 Ga0495598_0041480
1183 Ga0495598_0076291
1184 Ga0495621_0053083
1185 Ga0495621_0086504
1186 Ga0495621_0259563
1187 Ga0495667_0015049
1188 Ga0495667_0294983
1189 Ga0495667_0721817
1190 Ga0495656_0131010
1191 Ga0495634_0020503
1192 Ga0495635_0010179
1193 Ga0495635_0326890
1194 Ga0495659_0150743
1195 Ga0495659_0369484
1196 Ga0495588_0011820
1197 Ga0495657_0048356
1198 Ga0495599_0011173
1199 Ga0495623_0193033
1200 Ga0495647_0000629
1201 Ga0495658_0001812
1202 Ga0495658_0005679
1203 Ga0495669_0357958
1204 Ga0495613_0005871
1205 Ga0495624_0017062
1206 Ga0495670_0203376
1207 Ga0495600_0002776
1208 Ga0495604_0000911
1209 Ga0495604_0728583
1210 Ga0495636_0002487
1211 Ga0495636_0216178
1212 Ga0495674_0082028
1213 Ga0495680_0001752
1214 Ga0495684_0078488
1215 Ga0495684_0289002
1216 Ga0495593_0143280
1217 Ga0496106_0106878
1218 Ga0496107_1054682
1219 Ga0496109_0587318
1220 Ga0501292_035619
1221 Ga0501297_017998
1222 Ga0501298_020524
1223 Ga0501031_0042654
1224 Ga0501032_0050512
1225 Ga0501032_0099766
1226 Ga0501033_0002252
1227 Ga0501033_0098934
1228 Ga0501036_0001390
1229 Ga0501036_0807408
1230 Ga0501037_0058252
1231 Ga0501037_0531696
1232 Ga0501038_0009942
1233 Ga0501038_0040513
1234 Ga0501038_0365110
1235 Ga0501039_0003327
1236 Ga0501039_0018051
1237 Ga0501039_0119561
1238 Ga0501040_0003272
1239 Ga0501040_0004976
1240 Ga0501040_0146342
1241 Ga0501040_0159000
1242 Ga0501041_0009597
1243 Ga0501041_0012123
1244 Ga0501041_0044766
1245 Ga0501041_0097342
1246 Ga0501042_0009785
1247 Ga0501042_0026736
1248 Ga0501042_0127018
1249 Ga0501042_0576655
1250 Ga0501043_0074884
1251 Ga0501043_0171372
1252 Ga0501043_0905435
1253 Ga0501046_0000460
1254 Ga0501047_0162845
1255 Ga0501048_0004228
1256 Ga0501048_0055119
1257 Ga0501048_0158470
1258 Ga0501048_0176524
1259 Ga0501048_0244843
1260 Ga0501067_0539965
1261 Ga0501068_0031189
1262 Ga0501068_0057214
1263 Ga0501069_0372789
1264 Ga0501070_0049965
1265 Ga0501071_0003387
1266 Ga0501071_0007694
1267 Ga0501071_0084458
1268 Ga0501071_0184095
1269 Ga0501071_0199257
1270 Ga0501071_0655366
1271 Ga0501072_0012726
1272 Ga0501072_0013930
1273 Ga0501072_0067174
1274 Ga0501072_0097805
1275 Ga0501072_0394839
1276 Ga0501072_0396788
1277 Ga0501073_0305291
1278 Ga0501074_0002909
1279 Ga0501074_0037007
1280 Ga0501075_0001178
1281 Ga0501075_0003062
1282 Ga0501075_0022897
1283 Ga0501075_0031139
1284 Ga0501075_0347319
1285 Ga0501076_0003990
1286 Ga0501076_0004462
1287 Ga0501076_0545362
1288 Ga0501077_0001059
1289 Ga0501077_0343265
1290 Ga0501077_0514667
1291 Ga0501214_059318
1292 Ga0501216_108948
1293 Ga0501217_084770
1294 Ga0501235_144185
1295 Ga0501236_024467
1296 Ga0501253_044542
1297 Ga0501221_035611
1298 Ga0501225_0179044
1299 Ga0501234_059962
1300 Ga0501079_0000447
1301 Ga0501079_0012637
1302 Ga0501079_0226377
1303 Ga0501079_0562238
1304 Ga0501079_1072267
1305 Ga0501080_0027822
1306 Ga0501080_0045774
1307 Ga0501080_0227434
1308 Ga0501080_0676695
1309 Ga0501081_0000171
1310 Ga0501081_0008726
1311 Ga0501081_0031229
1312 Ga0501081_0166547
1313 Ga0501083_0220642
1314 Ga0501278_038778
1315 Ga0501035_0034591
1316 Ga0501035_0253180
1317 Ga0501035_0298517
1318 Ga0501035_0517467
1319 Ga0501035_0592414
1320 Ga0501045_0000437
1321 Ga0501045_0068280
1322 Ga0501045_0116699
1323 Ga0501045_0138990
1324 Ga0501204_036073
1325 nmdc:mga05p37_164496_c1
1326 nmdc:mga05p37_170077_c1
1327 nmdc:mga05p37_2159_c1
1328 nmdc:mga05p37_416_c1
1329 nmdc:mga09592_116384_c1
1330 nmdc:mga09592_1272_c1
1331 nmdc:mga09592_145706_c1
1332 nmdc:mga09592_293662_c1
1333 nmdc:mga09592_6132_c1
1334 nmdc:mga0qj67_25215_c1
1335 nmdc:mga0qj67_316187_c1
1336 nmdc:mga0qj67_347978_c1
1337 nmdc:mga0qj67_6302_c1
1338 nmdc:mga0qj67_73187_c1
1339 nmdc:mga0qj67_92493_c1
1340 nmdc:mga0qj67_96394_c1
1341 nmdc:mga06r32_107282_c1
1342 nmdc:mga06r32_2072_c1
1343 nmdc:mga06r32_215181_c1
1344 nmdc:mga06r32_288337_c1
1345 nmdc:mga06r32_430784_c1
1346 nmdc:mga06r32_65862_c1
1347 nmdc:mga06r32_77595_c1
1348 nmdc:mga08y16_106535_c1
1349 nmdc:mga08y16_1495078_c1
1350 nmdc:mga08y16_24628_c1
1351 nmdc:mga08y16_292331_c1
1352 nmdc:mga08y16_350298_c1
1353 nmdc:mga08y16_46985_c1
1354 nmdc:mga08y16_6286_c1
1355 nmdc:mga0n895_23459_c1
1356 nmdc:mga0n895_317732_c1
1357 nmdc:mga0n895_47771_c1
1358 nmdc:mga0n895_78702_c1
1359 nmdc:mga0rr50_1038185_c1
1360 nmdc:mga0rr50_233165_c1
1361 nmdc:mga0rr50_23609_c1
1362 nmdc:mga0rr50_487322_c1
1363 nmdc:mga0rr50_6074_c1
1364 nmdc:mga0rr50_678953_c1
1365 nmdc:mga0rr50_7453_c1
1366 nmdc:mga0rr50_87094_c1
1367 nmdc:mga08x19_156038_c1
1368 nmdc:mga08x19_29693_c1
1369 nmdc:mga08x19_503570_c1
1370 nmdc:mga08x19_79622_c1
1371 nmdc:mga08x19_8685_c1
1372 nmdc:mga0a205_28096_c1
1373 nmdc:mga0a205_28999_c1
1374 nmdc:mga0a205_349355_c1
1375 nmdc:mga0a205_73230_c1
1376 nmdc:mga0a205_8025_c1
1377 Ga0495601_0021631
1378 Ga0501084_0002871
1379 Ga0501084_0005864
1380 Ga0501084_0077948
1381 Ga0501084_0652256
1382 Ga0501082_0002464
1383 Ga0501082_0008621
1384 Ga0501082_0147747
1385 Ga0501082_0359850
1386 Ga0501082_0500381
1387 Ga0530510_0000149
1388 Ga0530510_0002725
1389 Ga0530510_0108706
1390 Ga0530510_0815946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

30

123

0.95

PF13883

Pyrid_oxidase_2

Pyridoxamine 5'-phosphate oxidase

26

171

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vna-assembly1.cif.gz_C pden_1323 0.8979 1 147
6vna-assembly1.cif.gz_C pden_1323 0.8837 1 147
6vna-assembly2.cif.gz_B-2 pden_1323 0.8826 1 147
2arz-assembly1.cif.gz_A crystal structure of protein of unknown function from pseudomonas aeruginosa 0.8681 2 144
6vna-assembly1.cif.gz_A pden_1323 0.8678 1 147
ID Description Score Start End Superfamily
2arzB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8651 3 147 2.30.110.10
af_I1KGP8_130_285_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8633 5 148 2.30.110.10
5bncB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8623 5 147 2.30.110.10
af_Q67VB8_43_206_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.858 4 149 2.30.110.10
3gasD02 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8428 9 143 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A0S8BBR9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9791 1 111
AF-A0A1F4F2C2-F1-model_v4 Pyridoxamine 5'-phosphate oxidase putative domain-containing protein 0.9722 1 149
AF-A0A7Y4VSG9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9618 1 151
AF-A0A2A4MX74-F1-model_v4 Uncharacterized protein 0.9547 1 151
AF-A0A2N2MCX3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9517 1 151

Map