F475759

General Info

Members Datasets Scaffolds Average Seq Length
694 256 1388 239

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0154388|Ga0501034_0154388_74_892
Length 272
Sequence MSDSTARRHDGSAGAACPTLGAQRIASDGRAAEPPSRRDFLHLALAAGPASLLAACSWDGGPLIRPKLQAMSRLNDWVGEHILQSNSRLAPVYETSARSGRMPAYHVAQSLPSLADPAAWTLRVDGLVRKPGAFTLPMLQALPRISYTVKHHCVEGWTAVASWAGVPFSALAAQVEPLPEARYVLFSSFEVDGRGVRYTNGWDMKSAMHPQTILAYAFNDRPLMPDHGAPVRLYAPIKLGYKMTKYLSQVTFTRERPGGYWEDKGYPWLAGL

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.91
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 20.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0154388 3300049571 Unclassified 2270
2 Ga0065715_10006568 3300005293 Bacteria 7085
3 Ga0070658_10217502 3300005327 Bacteria 1615
4 Ga0070658_10224450 3300005327 Unclassified 1589
5 Ga0070676_10004186 3300005328 Bacteria 7574
6 Ga0070683_100018083 3300005329 Bacteria 6237
7 Ga0070683_100045272 3300005329 Bacteria 4061
8 Ga0070690_100119834 3300005330 Bacteria 1765
9 Ga0070690_100473361 3300005330 Unclassified 933
10 Ga0070677_10004686 3300005333 Bacteria 4477
11 Ga0068869_100184213 3300005334 Bacteria 1638
12 Ga0070666_10006249 3300005335 Bacteria 7329
13 Ga0070680_100004839 3300005336 Bacteria 10141
14 Ga0070680_100007985 3300005336 Bacteria 8080
15 Ga0070680_100026976 3300005336 Bacteria 4598
16 Ga0070680_100097410 3300005336 Bacteria 2439
17 Ga0070680_100572017 3300005336 Archaea 969
18 Ga0070682_100265685 3300005337 Bacteria 1244
19 Ga0070660_100662594 3300005339 Bacteria 874
20 Ga0070691_10012430 3300005341 Bacteria 3898
21 Ga0070691_10072914 3300005341 Unclassified 1668
22 Ga0070691_10130495 3300005341 Unclassified 1273
23 Ga0070687_100293198 3300005343 Bacteria 1029
24 Ga0070692_10347660 3300005345 Bacteria 920
25 Ga0070669_100000010 3300005353 Bacteria 222186
26 Ga0070669_100112945 3300005353 Bacteria 2064
27 Ga0070675_100008353 3300005354 Bacteria 8034
28 Ga0070671_100001628 3300005355 Bacteria 16931
29 Ga0070674_100135639 3300005356 Bacteria 1840
30 Ga0070674_100251060 3300005356 Bacteria 1389
31 Ga0070673_100008600 3300005364 Bacteria 6799
32 Ga0070673_100014551 3300005364 Bacteria 5485
33 Ga0070659_100193218 3300005366 Bacteria 1673
34 Ga0070659_100229297 3300005366 Unclassified 1535
35 Ga0070667_100092080 3300005367 Bacteria 2608
36 Ga0070703_10001013 3300005406 Bacteria 8819
37 Ga0070703_10004104 3300005406 Bacteria 4111
38 Ga0070703_10005782 3300005406 Bacteria 3465
39 Ga0070709_10000047 3300005434 Bacteria 97230
40 Ga0070709_10002167 3300005434 Bacteria 10639
41 Ga0070709_10138692 3300005434 Bacteria 1668
42 Ga0070713_100195132 3300005436 Bacteria 1826
43 Ga0070713_100247419 3300005436 Bacteria 1625
44 Ga0070713_100259463 3300005436 Bacteria 1588
45 Ga0070701_10097600 3300005438 Bacteria 1621
46 Ga0070711_100004471 3300005439 Bacteria 8259
47 Ga0070705_100013865 3300005440 Bacteria 4132
48 Ga0070705_100025912 3300005440 Bacteria 3186
49 Ga0070705_100030759 3300005440 Unclassified 2966
50 Ga0070705_100034088 3300005440 Bacteria 2843
51 Ga0070700_100051428 3300005441 Unclassified 2564
52 Ga0070700_100077481 3300005441 Bacteria 2137
53 Ga0070694_100006473 3300005444 Bacteria 7113
54 Ga0070694_100009135 3300005444 Bacteria 6080
55 Ga0070694_100012129 3300005444 Bacteria 5352
56 Ga0070694_100012268 3300005444 Bacteria 5324
57 Ga0070694_100053412 3300005444 Bacteria 2734
58 Ga0070694_100080514 3300005444 Bacteria 2263
59 Ga0070694_100152319 3300005444 Bacteria 1690
60 Ga0070694_100169667 3300005444 Bacteria 1606
61 Ga0070694_100204484 3300005444 Unclassified 1473
62 Ga0070708_100024345 3300005445 Bacteria 5164
63 Ga0070708_100026425 3300005445 Unclassified 4969
64 Ga0070708_100030542 3300005445 Unclassified 4658
65 Ga0070708_100230575 3300005445 Unclassified 1737
66 Ga0070708_100269780 3300005445 Bacteria 1600
67 Ga0070708_100437200 3300005445 Bacteria 1234
68 Ga0070708_100833252 3300005445 Bacteria 867
69 Ga0070678_100025076 3300005456 Bacteria 4004
70 Ga0070678_100067026 3300005456 Bacteria 2670
71 Ga0070662_100007639 3300005457 Bacteria 7016
72 Ga0070662_100214213 3300005457 Unclassified 1534
73 Ga0070681_10110691 3300005458 Bacteria 2686
74 Ga0070681_10173432 3300005458 Bacteria 2078
75 Ga0068867_100049387 3300005459 Unclassified 3097
76 Ga0068867_100054855 3300005459 Unclassified 2945
77 Ga0070706_100005823 3300005467 Bacteria 11698
78 Ga0070706_100039725 3300005467 Unclassified 4343
79 Ga0070706_100123956 3300005467 Unclassified 2409
80 Ga0070706_100130217 3300005467 Bacteria 2348
81 Ga0070706_100243524 3300005467 Bacteria 1679
82 Ga0070706_100248963 3300005467 Bacteria 1659
83 Ga0070707_100002297 3300005468 Bacteria 18268
84 Ga0070707_100052950 3300005468 Bacteria 3891
85 Ga0070707_100058868 3300005468 Bacteria 3685
86 Ga0070707_100061087 3300005468 Bacteria 3614
87 Ga0070707_100250700 3300005468 Bacteria 1723
88 Ga0070707_100262732 3300005468 Unclassified 1679
89 Ga0070707_100310468 3300005468 Bacteria 1533
90 Ga0070707_100314698 3300005468 Bacteria 1521
91 Ga0070707_100388610 3300005468 Bacteria 1355
92 Ga0070707_100546108 3300005468 Unclassified 1121
93 Ga0070707_100578397 3300005468 Bacteria 1085
94 Ga0070698_100000036 3300005471 Bacteria 93219
95 Ga0070698_100006240 3300005471 Bacteria 12968
96 Ga0070698_100144867 3300005471 Bacteria 2326
97 Ga0070699_100001220 3300005518 Bacteria 23718
98 Ga0070699_100002677 3300005518 Bacteria 15922
99 Ga0070699_100012145 3300005518 Bacteria 7434
100 Ga0070699_100018125 3300005518 Bacteria 6048
101 Ga0070699_100046176 3300005518 Bacteria 3769
102 Ga0070699_100087485 3300005518 Unclassified 2720
103 Ga0070699_100128306 3300005518 Bacteria 2235
104 Ga0070699_100333298 3300005518 Unclassified 1365
105 Ga0070699_100340886 3300005518 Unclassified 1349
106 Ga0070699_100621194 3300005518 Bacteria 986
107 Ga0070699_100640102 3300005518 Bacteria 970
108 Ga0070699_100663176 3300005518 Unclassified 952
109 Ga0070679_100083822 3300005530 Bacteria 3176
110 Ga0070679_100666945 3300005530 Unclassified 983
111 Ga0070684_100047100 3300005535 Bacteria 3736
112 Ga0070697_100003329 3300005536 Bacteria 12345
113 Ga0070697_100003856 3300005536 Bacteria 11519
114 Ga0070697_100178056 3300005536 Bacteria 1802
115 Ga0070672_100027287 3300005543 Unclassified 4258
116 Ga0070686_100032458 3300005544 Bacteria 3202
117 Ga0070695_100019423 3300005545 Bacteria 4138
118 Ga0070695_100039965 3300005545 Bacteria 2967
119 Ga0070695_100040524 3300005545 Bacteria 2949
120 Ga0070695_100042883 3300005545 Bacteria 2874
121 Ga0070695_100063094 3300005545 Unclassified 2408
122 Ga0070695_100096513 3300005545 Unclassified 1983
123 Ga0070695_100121108 3300005545 Bacteria 1790
124 Ga0070696_100005519 3300005546 Bacteria 8440
125 Ga0070696_100005593 3300005546 Bacteria 8391
126 Ga0070696_100026313 3300005546 Bacteria 3958
127 Ga0070696_100028153 3300005546 Bacteria 3833
128 Ga0070696_100037116 3300005546 Bacteria 3361
129 Ga0070696_100062365 3300005546 Bacteria 2609
130 Ga0070696_100084988 3300005546 Unclassified 2246
131 Ga0070696_100097920 3300005546 Bacteria 2098
132 Ga0070696_100102493 3300005546 Unclassified 2052
133 Ga0070696_100259706 3300005546 Bacteria 1317
134 Ga0070696_100297284 3300005546 Unclassified 1235
135 Ga0070693_100209226 3300005547 Bacteria 1272
136 Ga0070665_100000688 3300005548 Bacteria 45153
137 Ga0070704_100000803 3300005549 Bacteria 15575
138 Ga0070704_100015750 3300005549 Bacteria 4760
139 Ga0070704_100017061 3300005549 Bacteria 4606
140 Ga0070704_100054022 3300005549 Bacteria 2841
141 Ga0070704_100123778 3300005549 Bacteria 1991
142 Ga0070704_100174614 3300005549 Unclassified 1712
143 Ga0070704_100619708 3300005549 Bacteria 953
144 Ga0070664_100005293 3300005564 Bacteria 10351
145 Ga0070664_100207098 3300005564 Bacteria 1752
146 Ga0070664_100432400 3300005564 Bacteria 1207
147 Ga0068857_100108122 3300005577 Bacteria 2499
148 Ga0068854_100181446 3300005578 Bacteria 1645
149 Ga0068856_100592378 3300005614 Bacteria 1130
150 Ga0070702_100035390 3300005615 Bacteria 2759
151 Ga0070702_100106672 3300005615 Bacteria 1728
152 Ga0068859_100134800 3300005617 Bacteria 2542
153 Ga0068859_100248479 3300005617 Bacteria 1869
154 Ga0068864_100027816 3300005618 Bacteria 4778
155 Ga0068864_100032970 3300005618 Bacteria 4401
156 Ga0068864_100066936 3300005618 Bacteria 3119
157 Ga0068864_100287323 3300005618 Bacteria 1537
158 Ga0068861_100048614 3300005719 Bacteria 3208
159 Ga0068870_10007113 3300005840 Bacteria 4976
160 Ga0068863_100067015 3300005841 Bacteria 3396
161 Ga0068860_100001166 3300005843 Bacteria 28780
162 Ga0068860_100288141 3300005843 Bacteria 1606
163 Ga0068860_100401240 3300005843 Archaea 1356
164 Ga0068862_100001862 3300005844 Bacteria 19121
165 Ga0081455_10032680 3300005937 Bacteria 4686
166 Ga0070717_10320009 3300006028 Bacteria 1382
167 Ga0070716_100049554 3300006173 Bacteria 2380
168 Ga0070716_100086879 3300006173 Bacteria 1882
169 Ga0070712_100202828 3300006175 Unclassified 1559
170 Ga0097621_100721171 3300006237 Unclassified 919
171 Ga0075428_100005385 3300006844 Bacteria 14225
172 Ga0075428_100011462 3300006844 Bacteria 9862
173 Ga0075428_100070108 3300006844 Bacteria 3832
174 Ga0075428_100078466 3300006844 Bacteria 3605
175 Ga0075430_100142523 3300006846 Bacteria 1996
176 Ga0075431_100002400 3300006847 Bacteria 18025
177 Ga0075431_100036906 3300006847 Bacteria 5035
178 Ga0075431_100153215 3300006847 Bacteria 2373
179 Ga0075431_100261714 3300006847 Bacteria 1755
180 Ga0075431_100935886 3300006847 Unclassified 835
181 Ga0075433_10000040 3300006852 Bacteria 52844
182 Ga0075433_10040269 3300006852 Bacteria 4044
183 Ga0075433_10057859 3300006852 Unclassified 3390
184 Ga0075433_10066567 3300006852 Bacteria 3161
185 Ga0075433_10090377 3300006852 Bacteria 2707
186 Ga0075433_10408473 3300006852 Bacteria 1198
187 Ga0075433_10427398 3300006852 Bacteria 1168
188 Ga0075433_10514093 3300006852 Bacteria 1053
189 Ga0075433_10560561 3300006852 Unclassified 1004
190 Ga0075434_100000445 3300006871 Bacteria 30783
191 Ga0075434_100006351 3300006871 Bacteria 10836
192 Ga0075434_100011238 3300006871 Bacteria 8431
193 Ga0075434_100013438 3300006871 Bacteria 7792
194 Ga0075434_100022311 3300006871 Bacteria 6167
195 Ga0075434_100091602 3300006871 Unclassified 3042
196 Ga0075434_100093465 3300006871 Bacteria 3011
197 Ga0075434_100103965 3300006871 Unclassified 2849
198 Ga0075434_100113861 3300006871 Bacteria 2717
199 Ga0075434_100145043 3300006871 Unclassified 2394
200 Ga0075434_100152881 3300006871 Bacteria 2328
201 Ga0075434_100297125 3300006871 Bacteria 1635
202 Ga0075434_100529136 3300006871 Bacteria 1199
203 Ga0075434_100720813 3300006871 Bacteria 1014
204 Ga0075434_100775314 3300006871 Bacteria 975
205 Ga0075429_100025775 3300006880 Bacteria 5106
206 Ga0075429_100047748 3300006880 Bacteria 3724
207 Ga0068865_100008151 3300006881 Bacteria 6466
208 Ga0075436_100002392 3300006914 Bacteria 12928
209 Ga0075436_100007948 3300006914 Bacteria 7263
210 Ga0075436_100012288 3300006914 Bacteria 5867
211 Ga0075436_100013497 3300006914 Bacteria 5594
212 Ga0075436_100019764 3300006914 Bacteria 4618
213 Ga0075436_100022450 3300006914 Bacteria 4334
214 Ga0075436_100028280 3300006914 Bacteria 3856
215 Ga0075436_100045268 3300006914 Bacteria 3035
216 Ga0075436_100074523 3300006914 Bacteria 2350
217 Ga0075436_100416869 3300006914 Bacteria 974
218 Ga0097620_100134800 3300006931 Bacteria 2542
219 Ga0097620_100248474 3300006931 Bacteria 1869
220 Ga0075435_100047127 3300007076 Bacteria 3460
221 Ga0075435_100051574 3300007076 Bacteria 3315
222 Ga0075435_100095570 3300007076 Unclassified 2457
223 Ga0075435_100110856 3300007076 Unclassified 2282
224 Ga0075435_100154962 3300007076 Bacteria 1927
225 Ga0075435_100155723 3300007076 Bacteria 1922
226 Ga0075435_100254541 3300007076 Unclassified 1495
227 Ga0075435_100288486 3300007076 Unclassified 1402
228 Ga0075435_100493703 3300007076 Unclassified 1058
229 Ga0075435_100524401 3300007076 Bacteria 1025
230 Ga0099794_10000261 3300007265 Bacteria 18316
231 Ga0099794_10063156 3300007265 Bacteria 1802
232 Ga0105240_10125069 3300009093 Unclassified 3091
233 Ga0105240_10149272 3300009093 Bacteria 2786
234 Ga0111539_10201270 3300009094 Bacteria 2322
235 Ga0111539_10245548 3300009094 Bacteria 2084
236 Ga0105245_11077111 3300009098 Bacteria 850
237 Ga0114129_10022357 3300009147 Bacteria 8977
238 Ga0114129_10045657 3300009147 Bacteria 6158
239 Ga0114129_10229688 3300009147 Unclassified 2500
240 Ga0114129_10250912 3300009147 Bacteria 2375
241 Ga0114129_10254545 3300009147 Bacteria 2356
242 Ga0114129_10355038 3300009147 Bacteria 1941
243 Ga0114129_10597630 3300009147 Unclassified 1430
244 Ga0114129_10877069 3300009147 Bacteria 1139
245 Ga0114129_11689354 3300009147 Unclassified 773
246 Ga0105243_10012810 3300009148 Bacteria 6335
247 Ga0105243_10313118 3300009148 Unclassified 1427
248 Ga0105243_10348020 3300009148 Unclassified 1360
249 Ga0105242_10010981 3300009176 Bacteria 6956
250 Ga0105248_10012326 3300009177 Bacteria 9431
251 Ga0105248_10369501 3300009177 Bacteria 1615
252 Ga0105248_10634673 3300009177 Unclassified 1205
253 Ga0105238_10627054 3300009551 Unclassified 1084
254 Ga0105249_10045717 3300009553 Bacteria 3982
255 Ga0105249_11143902 3300009553 Bacteria 849
256 Ga0105239_10004128 3300010375 Bacteria 17443
257 Ga0105239_10027353 3300010375 Bacteria 6278
258 Ga0157378_10001774 3300013297 Bacteria 19375
259 Ga0157378_10195925 3300013297 Bacteria 1908
260 Ga0163162_10147233 3300013306 Unclassified 2471
261 Ga0163162_10864956 3300013306 Bacteria 1019
262 Ga0157372_10062355 3300013307 Bacteria 4177
263 Ga0157375_10193983 3300013308 Bacteria 2186
264 Ga0157375_10504466 3300013308 Bacteria 1374
265 Ga0163163_10168272 3300014325 Bacteria 2238
266 Ga0163163_10215997 3300014325 Bacteria 1966
267 Ga0163163_10284674 3300014325 Unclassified 1705
268 Ga0157380_10044585 3300014326 Bacteria 3477
269 Ga0157379_10531368 3300014968 Unclassified 1093
270 Ga0157376_10240649 3300014969 Bacteria 1686
271 Ga0213875_10015946 3300021388 Bacteria 3650
272 Ga0207653_10000017 3300025885 Bacteria 142553
273 Ga0207653_10001490 3300025885 Bacteria 7591
274 Ga0207653_10004165 3300025885 Bacteria 4546
275 Ga0207682_10007194 3300025893 Bacteria 4452
276 Ga0207642_10024835 3300025899 Bacteria 2415
277 Ga0207680_10015770 3300025903 Bacteria 3951
278 Ga0207685_10166580 3300025905 Bacteria 1010
279 Ga0207699_10000056 3300025906 Bacteria 97208
280 Ga0207699_10004555 3300025906 Bacteria 6623
281 Ga0207699_10005403 3300025906 Bacteria 6120
282 Ga0207699_10044786 3300025906 Unclassified 2577
283 Ga0207699_10105619 3300025906 Bacteria 1796
284 Ga0207645_10001157 3300025907 Bacteria 21815
285 Ga0207645_10069389 3300025907 Bacteria 2255
286 Ga0207645_10098137 3300025907 Unclassified 1888
287 Ga0207643_10008835 3300025908 Bacteria 5407
288 Ga0207705_10208750 3300025909 Bacteria 1481
289 Ga0207705_10275803 3300025909 Bacteria 1286
290 Ga0207684_10007567 3300025910 Bacteria 9764
291 Ga0207684_10012595 3300025910 Bacteria 7350
292 Ga0207684_10018628 3300025910 Bacteria 5945
293 Ga0207684_10039925 3300025910 Bacteria 3978
294 Ga0207684_10695297 3300025910 Bacteria 864
295 Ga0207684_10697364 3300025910 Unclassified 863
296 Ga0207707_10012844 3300025912 Bacteria 7286
297 Ga0207695_10007698 3300025913 Bacteria 13640
298 Ga0207695_10335060 3300025913 Bacteria 1401
299 Ga0207693_10238367 3300025915 Bacteria 1428
300 Ga0207663_10000146 3300025916 Bacteria 32603
301 Ga0207660_10002976 3300025917 Bacteria 11087
302 Ga0207660_10011265 3300025917 Bacteria 5815
303 Ga0207660_10105771 3300025917 Bacteria 2109
304 Ga0207660_10523662 3300025917 Archaea 963
305 Ga0207662_10203152 3300025918 Unclassified 1284
306 Ga0207652_10103119 3300025921 Bacteria 2522
307 Ga0207646_10008600 3300025922 Bacteria 10202
308 Ga0207646_10009575 3300025922 Bacteria 9561
309 Ga0207646_10013447 3300025922 Bacteria 7827
310 Ga0207646_10045203 3300025922 Bacteria 3953
311 Ga0207646_10170873 3300025922 Bacteria 1963
312 Ga0207646_10264518 3300025922 Bacteria 1554
313 Ga0207646_10303924 3300025922 Unclassified 1441
314 Ga0207646_10338614 3300025922 Bacteria 1359
315 Ga0207646_10472780 3300025922 Bacteria 1130
316 Ga0207646_10618000 3300025922 Bacteria 972
317 Ga0207681_10000011 3300025923 Bacteria 366878
318 Ga0207681_10044782 3300025923 Unclassified 2967
319 Ga0207681_10164266 3300025923 Unclassified 1677
320 Ga0207659_10106597 3300025926 Unclassified 2122
321 Ga0207687_10450453 3300025927 Bacteria 1067
322 Ga0207644_10013288 3300025931 Bacteria 5485
323 Ga0207690_10134336 3300025932 Bacteria 1815
324 Ga0207706_10001381 3300025933 Bacteria 24255
325 Ga0207706_10041802 3300025933 Bacteria 4063
326 Ga0207706_10046171 3300025933 Bacteria 3857
327 Ga0207669_10007759 3300025937 Bacteria 4992
328 Ga0207704_10049330 3300025938 Bacteria 2531
329 Ga0207704_10588139 3300025938 Unclassified 909
330 Ga0207665_10003999 3300025939 Bacteria 9849
331 Ga0207665_10040680 3300025939 Bacteria 3102
332 Ga0207665_10104368 3300025939 Bacteria 1983
333 Ga0207691_10016055 3300025940 Bacteria 7112
334 Ga0207691_10446485 3300025940 Unclassified 1101
335 Ga0207711_10221851 3300025941 Unclassified 1729
336 Ga0207711_10231262 3300025941 Bacteria 1693
337 Ga0207689_10112493 3300025942 Bacteria 2238
338 Ga0207661_10039415 3300025944 Bacteria 3708
339 Ga0207661_10277851 3300025944 Bacteria 1496
340 Ga0207679_10174843 3300025945 Bacteria 1771
341 Ga0207651_10038304 3300025960 Unclassified 3150
342 Ga0207712_10058571 3300025961 Unclassified 2723
343 Ga0207668_10034866 3300025972 Bacteria 3346
344 Ga0207640_10334062 3300025981 Unclassified 1211
345 Ga0207640_10418625 3300025981 Unclassified 1096
346 Ga0207658_10084216 3300025986 Bacteria 2446
347 Ga0207639_10314693 3300026041 Bacteria 1388
348 Ga0207708_10014071 3300026075 Bacteria 5979
349 Ga0207708_10072784 3300026075 Unclassified 2634
350 Ga0207708_10179291 3300026075 Unclassified 1682
351 Ga0207641_10076701 3300026088 Bacteria 2890
352 Ga0207641_10224387 3300026088 Bacteria 1744
353 Ga0207648_10050724 3300026089 Bacteria 3628
354 Ga0207648_10209044 3300026089 Bacteria 1732
355 Ga0207648_10255218 3300026089 Unclassified 1564
356 Ga0207648_10642722 3300026089 Unclassified 980
357 Ga0207676_10009942 3300026095 Bacteria 6766
358 Ga0207676_10530035 3300026095 Unclassified 1122
359 Ga0207674_10019996 3300026116 Bacteria 7245
360 Ga0207674_10155725 3300026116 Bacteria 2240
361 Ga0207674_10215318 3300026116 Bacteria 1869
362 Ga0207675_100041109 3300026118 Bacteria 4318
363 Ga0207675_100086486 3300026118 Unclassified 2944
364 Ga0207675_100373895 3300026118 Bacteria 1400
365 Ga0207683_10006820 3300026121 Bacteria 9777
366 Ga0207683_10086573 3300026121 Bacteria 2786
367 Ga0209588_1000351 3300027671 Bacteria 11971
368 Ga0209588_1007492 3300027671 Bacteria 3213
369 Ga0268266_10000684 3300028379 Bacteria 45767
370 Ga0268266_10254354 3300028379 Bacteria 1626
371 Ga0268265_10001506 3300028380 Bacteria 19447
372 Ga0268264_10311786 3300028381 Bacteria 1485
373 Ga0268264_10568325 3300028381 Unclassified 1114
374 Ga0307408_100030437 3300031548 Archaea 3749
375 Ga0307408_100087916 3300031548 Bacteria 2339
376 Ga0307408_100110155 3300031548 Bacteria 2114
377 Ga0307408_100146739 3300031548 Unclassified 1858
378 Ga0307508_10048921 3300031616 Bacteria 3766
379 Ga0307405_10702272 3300031731 Bacteria 838
380 Ga0307413_10007924 3300031824 Bacteria 4972
381 Ga0307413_10109753 3300031824 Unclassified 1844
382 Ga0307410_10055967 3300031852 Bacteria 2680
383 Ga0307410_10067897 3300031852 Unclassified 2461
384 Ga0307410_10221938 3300031852 Unclassified 1454
385 Ga0307406_10020279 3300031901 Bacteria 3913
386 Ga0307406_10109116 3300031901 Bacteria 1901
387 Ga0307406_10116771 3300031901 Bacteria 1847
388 Ga0307406_10153860 3300031901 Bacteria 1644
389 Ga0307407_10020457 3300031903 Bacteria 3392
390 Ga0307407_10059762 3300031903 Unclassified 2221
391 Ga0307407_10307387 3300031903 Unclassified 1108
392 Ga0307412_10009048 3300031911 Bacteria 5706
393 Ga0307412_10548487 3300031911 Bacteria 971
394 Ga0307409_100009095 3300031995 Bacteria 6081
395 Ga0307409_100069014 3300031995 Bacteria 2798
396 Ga0307409_100120460 3300031995 Bacteria 2221
397 Ga0307409_100673442 3300031995 Bacteria 1031
398 Ga0307416_100015536 3300032002 Bacteria 5262
399 Ga0307416_100023664 3300032002 Bacteria 4463
400 Ga0307416_100236159 3300032002 Bacteria 1767
401 Ga0307416_100427052 3300032002 Bacteria 1371
402 Ga0307416_100598301 3300032002 Bacteria 1182
403 Ga0307416_100665608 3300032002 Bacteria 1127
404 Ga0307414_10024013 3300032004 Bacteria 3879
405 Ga0307414_10039670 3300032004 Bacteria 3173
406 Ga0307414_10045745 3300032004 Bacteria 3000
407 Ga0307414_10093734 3300032004 Bacteria 2239
408 Ga0307411_10030723 3300032005 Bacteria 3296
409 Ga0307411_10032514 3300032005 Bacteria 3224
410 Ga0307411_10038175 3300032005 Bacteria 3027
411 Ga0307411_10045006 3300032005 Bacteria 2836
412 Ga0307411_10098260 3300032005 Bacteria 2063
413 Ga0307411_10801347 3300032005 Unclassified 829
414 Ga0307415_100035537 3300032126 Archaea 3255
415 Ga0307415_100085588 3300032126 Bacteria 2266
416 Ga0373930_0057680 3300034816 Bacteria 860
417 Ga0373929_0000001 3300035085 Bacteria 956023
418 Ga0373940_0018215 3300035088 Bacteria 1760
419 Ga0373940_0030592 3300035088 Bacteria 1433
420 Ga0373952_0115800 3300035092 Bacteria 722
421 Ga0373961_0000551 3300035241 Bacteria 14207
422 Ga0373931_0059740 3300035691 Bacteria 2051
423 Ga0373935_0001736 3300035692 Bacteria 12216
424 Ga0373927_0010219 3300035695 Bacteria 6270
425 Ga0373933_0535255 3300035724 Unclassified 768
426 Ga0373937_0220215 3300036401 Bacteria 1787
427 Ga0395905_0311787 3300037471 Bacteria 1462
428 Ga0395905_0580193 3300037471 Bacteria 1023
429 Ga0436364_0581246 3300037853 Bacteria 34922
430 Ga0395901_0428819 3300038443 Unclassified 1355
431 Ga0242419_002780 3300038698 Bacteria 1155
432 Ga0439436_0015418 3300041404 Bacteria 2299
433 Ga0439439_0002149 3300041406 Bacteria 4131
434 Ga0451835_1251577 3300041492 Bacteria 1265
435 Ga0451853_3182840 3300041512 Unclassified 1128
436 Ga0439431_0086068 3300041997 Unclassified 852
437 Ga0439450_048409 3300042008 Unclassified 1004
438 Ga0439446_0019045 3300042156 Bacteria 1928
439 Ga0439459_0078658 3300042438 Unclassified 775
440 Ga0451577_0103244 3300042876 Bacteria 2548
441 Ga0451577_0124413 3300042876 Bacteria 2311
442 Ga0451577_0203359 3300042876 Bacteria 1788
443 Ga0451577_0455630 3300042876 Bacteria 1162
444 Ga0453683_0003120 3300044673 Bacteria 12371
445 Ga0453683_0008328 3300044673 Bacteria 6968
446 Ga0453683_0044543 3300044673 Bacteria 2784
447 Ga0453683_0115522 3300044673 Bacteria 1688
448 Ga0453683_0157957 3300044673 Bacteria 1434
449 Ga0453683_0249154 3300044673 Unclassified 1132
450 Ga0466963_0137318 3300044694 Unclassified 1692
451 Ga0453684_0014561 3300044712 Bacteria 12558
452 Ga0453684_0550733 3300044712 Bacteria 1271
453 Ga0466960_0130556 3300044901 Bacteria 1325
454 Ga0451576_0006630 3300045051 Bacteria 14141
455 Ga0451576_0094535 3300045051 Unclassified 3108
456 Ga0451576_0138617 3300045051 Unclassified 2537
457 Ga0451576_0318444 3300045051 Bacteria 1627
458 Ga0451576_0334737 3300045051 Unclassified 1584
459 Ga0451576_0490911 3300045051 Bacteria 1290
460 Ga0451576_0979082 3300045051 Unclassified 887
461 Ga0495603_0120641 3300046455 Bacteria 1528
462 Ga0495603_0125930 3300046455 Unclassified 1493
463 Ga0495651_0127651 3300046462 Bacteria 1860
464 Ga0495580_0134858 3300046472 Bacteria 1712
465 Ga0495580_0175988 3300046472 Unclassified 1478
466 Ga0495663_0039763 3300046525 Unclassified 1426
467 Ga0495642_0037696 3300046528 Bacteria 1957
468 Ga0495640_0293817 3300046533 Unclassified 1010
469 Ga0495609_0022215 3300046538 Bacteria 2924
470 Ga0495621_0130537 3300046539 Bacteria 977
471 Ga0495623_0316693 3300046679 Unclassified 858
472 Ga0495658_0262762 3300046683 Unclassified 1087
473 Ga0495674_0601494 3300047319 Bacteria 871
474 Ga0495602_0433469 3300048088 Unclassified 931
475 Ga0495615_0022583 3300048090 Bacteria 1432
476 Ga0496101_0046242 3300048904 Unclassified 3121
477 Ga0496102_0001968 3300048905 Bacteria 17728
478 Ga0496102_0070578 3300048905 Bacteria 3208
479 Ga0496102_0080369 3300048905 Bacteria 3003
480 Ga0496103_0003862 3300048906 Bacteria 9117
481 Ga0496103_0046539 3300048906 Bacteria 2679
482 Ga0496104_0028710 3300048907 Bacteria 5156
483 Ga0496104_0041600 3300048907 Bacteria 4310
484 Ga0496104_0074137 3300048907 Bacteria 3240
485 Ga0496105_0101787 3300048908 Bacteria 2372
486 Ga0496105_0156520 3300048908 Bacteria 1871
487 Ga0496106_0025817 3300048909 Unclassified 4371
488 Ga0496106_0255334 3300048909 Bacteria 1402
489 Ga0496106_0313955 3300048909 Unclassified 1258
490 Ga0496106_0394729 3300048909 Bacteria 1112
491 Ga0496107_0189452 3300048910 Bacteria 1528
492 Ga0496107_0284103 3300048910 Bacteria 1232
493 Ga0496108_0000530 3300048911 Bacteria 29778
494 Ga0496108_0005507 3300048911 Bacteria 10243
495 Ga0496108_0007543 3300048911 Bacteria 8818
496 Ga0496108_0137934 3300048911 Unclassified 2100
497 Ga0496109_0005600 3300048912 Bacteria 10512
498 Ga0496109_0027823 3300048912 Bacteria 5052
499 Ga0496109_0035428 3300048912 Bacteria 4502
500 Ga0496109_0855451 3300048912 Unclassified 847
501 Ga0496110_0012178 3300048913 Bacteria 7065
502 Ga0496110_0441854 3300048913 Bacteria 1185
503 Ga0496111_0002460 3300048914 Bacteria 11174
504 Ga0496111_0051993 3300048914 Bacteria 2958
505 Ga0496111_0234129 3300048914 Bacteria 1364
506 Ga0496112_0000343 3300048915 Bacteria 30294
507 Ga0496112_0003784 3300048915 Bacteria 12638
508 Ga0496112_0039247 3300048915 Bacteria 4626
509 Ga0496112_0187521 3300048915 Bacteria 2031
510 Ga0496112_0365368 3300048915 Unclassified 1385
511 Ga0496113_0000225 3300048916 Bacteria 26482
512 Ga0496113_0001395 3300048916 Bacteria 13437
513 Ga0496113_0368734 3300048916 Unclassified 1152
514 Ga0496114_0000060 3300048917 Bacteria 90143
515 Ga0496114_0097985 3300048917 Bacteria 2499
516 Ga0496115_0380364 3300048918 Bacteria 1148
517 Ga0501031_0196067 3300049568 Bacteria 1318
518 Ga0501031_0213643 3300049568 Bacteria 1257
519 Ga0501033_0029463 3300049570 Bacteria 4125
520 Ga0501033_0050022 3300049570 Bacteria 3102
521 Ga0501034_0022302 3300049571 Bacteria 6454
522 Ga0501034_0205117 3300049571 Unclassified 1928
523 Ga0501036_0065194 3300049572 Bacteria 3083
524 Ga0501036_0074175 3300049572 Bacteria 2877
525 Ga0501036_0146222 3300049572 Bacteria 1994
526 Ga0501036_0214526 3300049572 Unclassified 1617
527 Ga0501036_0239802 3300049572 Bacteria 1521
528 Ga0501037_0052195 3300049573 Bacteria 2991
529 Ga0501037_0406509 3300049573 Unclassified 933
530 Ga0501038_0067873 3300049574 Bacteria 3033
531 Ga0501038_0199357 3300049574 Unclassified 1607
532 Ga0501038_0259264 3300049574 Unclassified 1375
533 Ga0501038_0354052 3300049574 Unclassified 1143
534 Ga0501039_0027263 3300049575 Bacteria 4392
535 Ga0501039_0047503 3300049575 Unclassified 3318
536 Ga0501039_0067372 3300049575 Bacteria 2780
537 Ga0501039_0227124 3300049575 Bacteria 1467
538 Ga0501040_0040920 3300049576 Bacteria 3156
539 Ga0501040_0114252 3300049576 Unclassified 1890
540 Ga0501040_0252955 3300049576 Unclassified 1257
541 Ga0501040_0351190 3300049576 Unclassified 1056
542 Ga0501041_0036632 3300049577 Bacteria 2972
543 Ga0501041_0036686 3300049577 Bacteria 2969
544 Ga0501041_0120242 3300049577 Bacteria 1632
545 Ga0501042_0043909 3300049578 Bacteria 3184
546 Ga0501042_0273362 3300049578 Unclassified 1220
547 Ga0501042_0281229 3300049578 Bacteria 1202
548 Ga0501042_0401153 3300049578 Unclassified 993
549 Ga0501046_0019398 3300049580 Bacteria 5642
550 Ga0501046_0058723 3300049580 Bacteria 3015
551 Ga0501046_0062146 3300049580 Bacteria 2919
552 Ga0501046_0088462 3300049580 Bacteria 2385
553 Ga0501046_0295382 3300049580 Unclassified 1184
554 Ga0501048_0067212 3300049582 Bacteria 2534
555 Ga0501048_0068432 3300049582 Bacteria 2508
556 Ga0501067_0009422 3300049583 Bacteria 5410
557 Ga0501067_0020034 3300049583 Bacteria 3701
558 Ga0501067_0028087 3300049583 Bacteria 3117
559 Ga0501067_0123055 3300049583 Bacteria 1444
560 Ga0501067_0168323 3300049583 Bacteria 1220
561 Ga0501068_0000674 3300049584 Bacteria 17465
562 Ga0501068_0057852 3300049584 Bacteria 2351
563 Ga0501068_0530127 3300049584 Bacteria 765
564 Ga0501069_0000791 3300049585 Bacteria 14879
565 Ga0501069_0012218 3300049585 Bacteria 4562
566 Ga0501069_0169643 3300049585 Bacteria 1258
567 Ga0501070_0044349 3300049586 Bacteria 3701
568 Ga0501070_0090898 3300049586 Bacteria 2526
569 Ga0501070_0146263 3300049586 Bacteria 1951
570 Ga0501070_0163732 3300049586 Bacteria 1833
571 Ga0501070_0235424 3300049586 Bacteria 1500
572 Ga0501070_0636200 3300049586 Unclassified 848
573 Ga0501071_0020837 3300049587 Bacteria 4560
574 Ga0501071_0026080 3300049587 Bacteria 4099
575 Ga0501071_0109270 3300049587 Unclassified 2043
576 Ga0501071_0252867 3300049587 Unclassified 1330
577 Ga0501072_0002245 3300049588 Bacteria 14422
578 Ga0501072_0019830 3300049588 Bacteria 5203
579 Ga0501072_0031992 3300049588 Bacteria 4118
580 Ga0501073_0006597 3300049589 Bacteria 8638
581 Ga0501073_0032797 3300049589 Bacteria 3701
582 Ga0501073_0069458 3300049589 Bacteria 2454
583 Ga0501074_0001695 3300049590 Bacteria 15007
584 Ga0501074_0006415 3300049590 Bacteria 8497
585 Ga0501074_0111693 3300049590 Bacteria 1955
586 Ga0501074_0113749 3300049590 Bacteria 1936
587 Ga0501074_0234482 3300049590 Unclassified 1306
588 Ga0501075_0001676 3300049591 Bacteria 14530
589 Ga0501075_0012966 3300049591 Bacteria 5939
590 Ga0501075_0017953 3300049591 Bacteria 5113
591 Ga0501075_0292008 3300049591 Bacteria 1242
592 Ga0501075_0306813 3300049591 Unclassified 1209
593 Ga0501076_0012647 3300049592 Bacteria 6317
594 Ga0501076_0023882 3300049592 Bacteria 4717
595 Ga0501076_0288343 3300049592 Bacteria 1345
596 Ga0501076_0531514 3300049592 Unclassified 969
597 Ga0501076_0550093 3300049592 Bacteria 952
598 Ga0501077_0000260 3300049593 Bacteria 31177
599 Ga0501077_0003261 3300049593 Bacteria 9776
600 Ga0501077_0009246 3300049593 Bacteria 6119
601 Ga0501077_0091433 3300049593 Bacteria 1928
602 Ga0501077_0137152 3300049593 Unclassified 1551
603 Ga0501079_0024801 3300049741 Bacteria 4601
604 Ga0501079_0092663 3300049741 Bacteria 2341
605 Ga0501079_0094658 3300049741 Bacteria 2314
606 Ga0501079_0144565 3300049741 Unclassified 1853
607 Ga0501080_0003112 3300049742 Bacteria 14638
608 Ga0501080_0038328 3300049742 Bacteria 4475
609 Ga0501080_0041632 3300049742 Bacteria 4279
610 Ga0501080_0064420 3300049742 Bacteria 3409
611 Ga0501080_0068095 3300049742 Bacteria 3311
612 Ga0501081_0003202 3300049743 Bacteria 10400
613 Ga0501081_0012620 3300049743 Bacteria 5555
614 Ga0501081_0029248 3300049743 Bacteria 3723
615 Ga0501081_0057239 3300049743 Bacteria 2695
616 Ga0501081_0078725 3300049743 Bacteria 2305
617 Ga0501081_0093814 3300049743 Bacteria 2114
618 Ga0501083_0020722 3300049744 Bacteria 4571
619 Ga0501083_0100018 3300049744 Bacteria 1912
620 Ga0501083_0401099 3300049744 Bacteria 892
621 Ga0501035_0554401 3300049822 Unclassified 941
622 Ga0501045_0042467 3300049824 Bacteria 3309
623 Ga0501045_0049482 3300049824 Bacteria 3064
624 Ga0501045_0238442 3300049824 Bacteria 1354
625 nmdc:mga05p37_124325_c1 3300050507 Bacteria 3169
626 nmdc:mga05p37_308867_c1 3300050507 Bacteria 1875
627 nmdc:mga05p37_41469_c1 3300050507 Bacteria 5651
628 nmdc:mga09592_50856_c1 3300050508 Bacteria 3495
629 nmdc:mga0qj67_26268_c1 3300050509 Bacteria 4507
630 nmdc:mga06r32_19693_c1 3300050510 Bacteria 6199
631 nmdc:mga06r32_9875_c1 3300050510 Bacteria 6599
632 nmdc:mga08y16_143391_c1 3300050511 Bacteria 2483
633 nmdc:mga08y16_191337_c1 3300050511 Bacteria 2122
634 nmdc:mga0n895_13535_c1 3300050512 Bacteria 7367
635 nmdc:mga0n895_15843_c1 3300050512 Bacteria 6893
636 nmdc:mga0n895_1642_c2 3300050512 Bacteria 6188
637 nmdc:mga0n895_169139_c1 3300050512 Bacteria 2218
638 nmdc:mga0n895_20325_c1 3300050512 Bacteria 6190
639 nmdc:mga0n895_213907_c1 3300050512 Bacteria 1957
640 nmdc:mga0n895_217318_c1 3300050512 Bacteria 1941
641 nmdc:mga0n895_305515_c1 3300050512 Bacteria 1613
642 nmdc:mga0n895_336544_c1 3300050512 Bacteria 1529
643 nmdc:mga0n895_376594_c1 3300050512 Bacteria 1437
644 nmdc:mga0n895_43207_c1 3300050512 Bacteria 4391
645 nmdc:mga0n895_523335_c1 3300050512 Bacteria 1193
646 nmdc:mga0n895_52537_c1 3300050512 Bacteria 4001
647 nmdc:mga0n895_64645_c1 3300050512 Bacteria 3619
648 nmdc:mga0n895_748077_c1 3300050512 Bacteria 971
649 nmdc:mga0n895_90988_c1 3300050512 Unclassified 3053
650 nmdc:mga0rr50_107765_c1 3300050513 Bacteria 2200
651 nmdc:mga0rr50_174271_c1 3300050513 Bacteria 1755
652 nmdc:mga0rr50_31239_c1 3300050513 Bacteria 3781
653 nmdc:mga0rr50_601555_c1 3300050513 Bacteria 937
654 nmdc:mga0rr50_61708_c1 3300050513 Bacteria 2825
655 nmdc:mga0rr50_746238_c1 3300050513 Bacteria 835
656 nmdc:mga08x19_11765_c1 3300050514 Bacteria 5269
657 nmdc:mga08x19_133325_c1 3300050514 Bacteria 1673
658 nmdc:mga08x19_237829_c1 3300050514 Unclassified 1255
659 nmdc:mga08x19_285265_c1 3300050514 Bacteria 1145
660 nmdc:mga08x19_29925_c1 3300050514 Bacteria 3418
661 nmdc:mga08x19_36506_c1 3300050514 Unclassified 3113
662 nmdc:mga08x19_420_c1 3300050514 Bacteria 29486
663 nmdc:mga08x19_429586_c1 3300050514 Bacteria 928
664 nmdc:mga08x19_499144_c1 3300050514 Bacteria 859
665 nmdc:mga08x19_7147_c1 3300050514 Bacteria 6630
666 nmdc:mga08x19_71934_c1 3300050514 Unclassified 2255
667 nmdc:mga0a205_102831_c1 3300050515 Unclassified 2755
668 nmdc:mga0a205_296418_c1 3300050515 Bacteria 1491
669 nmdc:mga0a205_2979_c1 3300050515 Bacteria 15023
670 nmdc:mga0a205_316619_c1 3300050515 Bacteria 1432
671 nmdc:mga0a205_320368_c1 3300050515 Unclassified 1421
672 nmdc:mga0a205_568194_c1 3300050515 Unclassified 989
673 nmdc:mga0a205_57825_c1 3300050515 Bacteria 3745
674 nmdc:mga0a205_889_c1 3300050515 Bacteria 24552
675 Ga0501084_0001693 3300054114 Bacteria 17520
676 Ga0501084_0010009 3300054114 Bacteria 7833
677 Ga0501084_0019868 3300054114 Bacteria 5598
678 Ga0501084_0022947 3300054114 Bacteria 5208
679 Ga0501084_0045918 3300054114 Bacteria 3657
680 Ga0501084_0079904 3300054114 Bacteria 2742
681 Ga0501084_0159260 3300054114 Bacteria 1904
682 Ga0501084_0471119 3300054114 Bacteria 1062
683 Ga0501084_0515769 3300054114 Bacteria 1010
684 Ga0590071_005679 3300059421 Bacteria 2994
685 Ga0590071_009360 3300059421 Bacteria 2301
686 Ga0590074_003754 3300059423 Bacteria 2516
687 Ga0501082_0000228 3300060353 Bacteria 49003
688 Ga0501082_0010643 3300060353 Bacteria 7919
689 Ga0501082_0014227 3300060353 Bacteria 6848
690 Ga0501082_0031155 3300060353 Bacteria 4596
691 Ga0501082_0168246 3300060353 Unclassified 1905
692 Ga0501082_0431369 3300060353 Bacteria 1151
693 Ga0530510_0192911 3300061734 Unclassified 1512
694 Ga0530510_0216001 3300061734 Unclassified 1425
695 Ga0501034_0154388
696 Ga0065715_10006568
697 Ga0070658_10217502
698 Ga0070658_10224450
699 Ga0070676_10004186
700 Ga0070683_100018083
701 Ga0070683_100045272
702 Ga0070690_100119834
703 Ga0070690_100473361
704 Ga0070677_10004686
705 Ga0068869_100184213
706 Ga0070666_10006249
707 Ga0070680_100004839
708 Ga0070680_100007985
709 Ga0070680_100026976
710 Ga0070680_100097410
711 Ga0070680_100572017
712 Ga0070682_100265685
713 Ga0070660_100662594
714 Ga0070691_10012430
715 Ga0070691_10072914
716 Ga0070691_10130495
717 Ga0070687_100293198
718 Ga0070692_10347660
719 Ga0070669_100000010
720 Ga0070669_100112945
721 Ga0070675_100008353
722 Ga0070671_100001628
723 Ga0070674_100135639
724 Ga0070674_100251060
725 Ga0070673_100008600
726 Ga0070673_100014551
727 Ga0070659_100193218
728 Ga0070659_100229297
729 Ga0070667_100092080
730 Ga0070703_10001013
731 Ga0070703_10004104
732 Ga0070703_10005782
733 Ga0070709_10000047
734 Ga0070709_10002167
735 Ga0070709_10138692
736 Ga0070713_100195132
737 Ga0070713_100247419
738 Ga0070713_100259463
739 Ga0070701_10097600
740 Ga0070711_100004471
741 Ga0070705_100013865
742 Ga0070705_100025912
743 Ga0070705_100030759
744 Ga0070705_100034088
745 Ga0070700_100051428
746 Ga0070700_100077481
747 Ga0070694_100006473
748 Ga0070694_100009135
749 Ga0070694_100012129
750 Ga0070694_100012268
751 Ga0070694_100053412
752 Ga0070694_100080514
753 Ga0070694_100152319
754 Ga0070694_100169667
755 Ga0070694_100204484
756 Ga0070708_100024345
757 Ga0070708_100026425
758 Ga0070708_100030542
759 Ga0070708_100230575
760 Ga0070708_100269780
761 Ga0070708_100437200
762 Ga0070708_100833252
763 Ga0070678_100025076
764 Ga0070678_100067026
765 Ga0070662_100007639
766 Ga0070662_100214213
767 Ga0070681_10110691
768 Ga0070681_10173432
769 Ga0068867_100049387
770 Ga0068867_100054855
771 Ga0070706_100005823
772 Ga0070706_100039725
773 Ga0070706_100123956
774 Ga0070706_100130217
775 Ga0070706_100243524
776 Ga0070706_100248963
777 Ga0070707_100002297
778 Ga0070707_100052950
779 Ga0070707_100058868
780 Ga0070707_100061087
781 Ga0070707_100250700
782 Ga0070707_100262732
783 Ga0070707_100310468
784 Ga0070707_100314698
785 Ga0070707_100388610
786 Ga0070707_100546108
787 Ga0070707_100578397
788 Ga0070698_100000036
789 Ga0070698_100006240
790 Ga0070698_100144867
791 Ga0070699_100001220
792 Ga0070699_100002677
793 Ga0070699_100012145
794 Ga0070699_100018125
795 Ga0070699_100046176
796 Ga0070699_100087485
797 Ga0070699_100128306
798 Ga0070699_100333298
799 Ga0070699_100340886
800 Ga0070699_100621194
801 Ga0070699_100640102
802 Ga0070699_100663176
803 Ga0070679_100083822
804 Ga0070679_100666945
805 Ga0070684_100047100
806 Ga0070697_100003329
807 Ga0070697_100003856
808 Ga0070697_100178056
809 Ga0070672_100027287
810 Ga0070686_100032458
811 Ga0070695_100019423
812 Ga0070695_100039965
813 Ga0070695_100040524
814 Ga0070695_100042883
815 Ga0070695_100063094
816 Ga0070695_100096513
817 Ga0070695_100121108
818 Ga0070696_100005519
819 Ga0070696_100005593
820 Ga0070696_100026313
821 Ga0070696_100028153
822 Ga0070696_100037116
823 Ga0070696_100062365
824 Ga0070696_100084988
825 Ga0070696_100097920
826 Ga0070696_100102493
827 Ga0070696_100259706
828 Ga0070696_100297284
829 Ga0070693_100209226
830 Ga0070665_100000688
831 Ga0070704_100000803
832 Ga0070704_100015750
833 Ga0070704_100017061
834 Ga0070704_100054022
835 Ga0070704_100123778
836 Ga0070704_100174614
837 Ga0070704_100619708
838 Ga0070664_100005293
839 Ga0070664_100207098
840 Ga0070664_100432400
841 Ga0068857_100108122
842 Ga0068854_100181446
843 Ga0068856_100592378
844 Ga0070702_100035390
845 Ga0070702_100106672
846 Ga0068859_100134800
847 Ga0068859_100248479
848 Ga0068864_100027816
849 Ga0068864_100032970
850 Ga0068864_100066936
851 Ga0068864_100287323
852 Ga0068861_100048614
853 Ga0068870_10007113
854 Ga0068863_100067015
855 Ga0068860_100001166
856 Ga0068860_100288141
857 Ga0068860_100401240
858 Ga0068862_100001862
859 Ga0081455_10032680
860 Ga0070717_10320009
861 Ga0070716_100049554
862 Ga0070716_100086879
863 Ga0070712_100202828
864 Ga0097621_100721171
865 Ga0075428_100005385
866 Ga0075428_100011462
867 Ga0075428_100070108
868 Ga0075428_100078466
869 Ga0075430_100142523
870 Ga0075431_100002400
871 Ga0075431_100036906
872 Ga0075431_100153215
873 Ga0075431_100261714
874 Ga0075431_100935886
875 Ga0075433_10000040
876 Ga0075433_10040269
877 Ga0075433_10057859
878 Ga0075433_10066567
879 Ga0075433_10090377
880 Ga0075433_10408473
881 Ga0075433_10427398
882 Ga0075433_10514093
883 Ga0075433_10560561
884 Ga0075434_100000445
885 Ga0075434_100006351
886 Ga0075434_100011238
887 Ga0075434_100013438
888 Ga0075434_100022311
889 Ga0075434_100091602
890 Ga0075434_100093465
891 Ga0075434_100103965
892 Ga0075434_100113861
893 Ga0075434_100145043
894 Ga0075434_100152881
895 Ga0075434_100297125
896 Ga0075434_100529136
897 Ga0075434_100720813
898 Ga0075434_100775314
899 Ga0075429_100025775
900 Ga0075429_100047748
901 Ga0068865_100008151
902 Ga0075436_100002392
903 Ga0075436_100007948
904 Ga0075436_100012288
905 Ga0075436_100013497
906 Ga0075436_100019764
907 Ga0075436_100022450
908 Ga0075436_100028280
909 Ga0075436_100045268
910 Ga0075436_100074523
911 Ga0075436_100416869
912 Ga0097620_100134800
913 Ga0097620_100248474
914 Ga0075435_100047127
915 Ga0075435_100051574
916 Ga0075435_100095570
917 Ga0075435_100110856
918 Ga0075435_100154962
919 Ga0075435_100155723
920 Ga0075435_100254541
921 Ga0075435_100288486
922 Ga0075435_100493703
923 Ga0075435_100524401
924 Ga0099794_10000261
925 Ga0099794_10063156
926 Ga0105240_10125069
927 Ga0105240_10149272
928 Ga0111539_10201270
929 Ga0111539_10245548
930 Ga0105245_11077111
931 Ga0114129_10022357
932 Ga0114129_10045657
933 Ga0114129_10229688
934 Ga0114129_10250912
935 Ga0114129_10254545
936 Ga0114129_10355038
937 Ga0114129_10597630
938 Ga0114129_10877069
939 Ga0114129_11689354
940 Ga0105243_10012810
941 Ga0105243_10313118
942 Ga0105243_10348020
943 Ga0105242_10010981
944 Ga0105248_10012326
945 Ga0105248_10369501
946 Ga0105248_10634673
947 Ga0105238_10627054
948 Ga0105249_10045717
949 Ga0105249_11143902
950 Ga0105239_10004128
951 Ga0105239_10027353
952 Ga0157378_10001774
953 Ga0157378_10195925
954 Ga0163162_10147233
955 Ga0163162_10864956
956 Ga0157372_10062355
957 Ga0157375_10193983
958 Ga0157375_10504466
959 Ga0163163_10168272
960 Ga0163163_10215997
961 Ga0163163_10284674
962 Ga0157380_10044585
963 Ga0157379_10531368
964 Ga0157376_10240649
965 Ga0213875_10015946
966 Ga0207653_10000017
967 Ga0207653_10001490
968 Ga0207653_10004165
969 Ga0207682_10007194
970 Ga0207642_10024835
971 Ga0207680_10015770
972 Ga0207685_10166580
973 Ga0207699_10000056
974 Ga0207699_10004555
975 Ga0207699_10005403
976 Ga0207699_10044786
977 Ga0207699_10105619
978 Ga0207645_10001157
979 Ga0207645_10069389
980 Ga0207645_10098137
981 Ga0207643_10008835
982 Ga0207705_10208750
983 Ga0207705_10275803
984 Ga0207684_10007567
985 Ga0207684_10012595
986 Ga0207684_10018628
987 Ga0207684_10039925
988 Ga0207684_10695297
989 Ga0207684_10697364
990 Ga0207707_10012844
991 Ga0207695_10007698
992 Ga0207695_10335060
993 Ga0207693_10238367
994 Ga0207663_10000146
995 Ga0207660_10002976
996 Ga0207660_10011265
997 Ga0207660_10105771
998 Ga0207660_10523662
999 Ga0207662_10203152
1000 Ga0207652_10103119
1001 Ga0207646_10008600
1002 Ga0207646_10009575
1003 Ga0207646_10013447
1004 Ga0207646_10045203
1005 Ga0207646_10170873
1006 Ga0207646_10264518
1007 Ga0207646_10303924
1008 Ga0207646_10338614
1009 Ga0207646_10472780
1010 Ga0207646_10618000
1011 Ga0207681_10000011
1012 Ga0207681_10044782
1013 Ga0207681_10164266
1014 Ga0207659_10106597
1015 Ga0207687_10450453
1016 Ga0207644_10013288
1017 Ga0207690_10134336
1018 Ga0207706_10001381
1019 Ga0207706_10041802
1020 Ga0207706_10046171
1021 Ga0207669_10007759
1022 Ga0207704_10049330
1023 Ga0207704_10588139
1024 Ga0207665_10003999
1025 Ga0207665_10040680
1026 Ga0207665_10104368
1027 Ga0207691_10016055
1028 Ga0207691_10446485
1029 Ga0207711_10221851
1030 Ga0207711_10231262
1031 Ga0207689_10112493
1032 Ga0207661_10039415
1033 Ga0207661_10277851
1034 Ga0207679_10174843
1035 Ga0207651_10038304
1036 Ga0207712_10058571
1037 Ga0207668_10034866
1038 Ga0207640_10334062
1039 Ga0207640_10418625
1040 Ga0207658_10084216
1041 Ga0207639_10314693
1042 Ga0207708_10014071
1043 Ga0207708_10072784
1044 Ga0207708_10179291
1045 Ga0207641_10076701
1046 Ga0207641_10224387
1047 Ga0207648_10050724
1048 Ga0207648_10209044
1049 Ga0207648_10255218
1050 Ga0207648_10642722
1051 Ga0207676_10009942
1052 Ga0207676_10530035
1053 Ga0207674_10019996
1054 Ga0207674_10155725
1055 Ga0207674_10215318
1056 Ga0207675_100041109
1057 Ga0207675_100086486
1058 Ga0207675_100373895
1059 Ga0207683_10006820
1060 Ga0207683_10086573
1061 Ga0209588_1000351
1062 Ga0209588_1007492
1063 Ga0268266_10000684
1064 Ga0268266_10254354
1065 Ga0268265_10001506
1066 Ga0268264_10311786
1067 Ga0268264_10568325
1068 Ga0307408_100030437
1069 Ga0307408_100087916
1070 Ga0307408_100110155
1071 Ga0307408_100146739
1072 Ga0307508_10048921
1073 Ga0307405_10702272
1074 Ga0307413_10007924
1075 Ga0307413_10109753
1076 Ga0307410_10055967
1077 Ga0307410_10067897
1078 Ga0307410_10221938
1079 Ga0307406_10020279
1080 Ga0307406_10109116
1081 Ga0307406_10116771
1082 Ga0307406_10153860
1083 Ga0307407_10020457
1084 Ga0307407_10059762
1085 Ga0307407_10307387
1086 Ga0307412_10009048
1087 Ga0307412_10548487
1088 Ga0307409_100009095
1089 Ga0307409_100069014
1090 Ga0307409_100120460
1091 Ga0307409_100673442
1092 Ga0307416_100015536
1093 Ga0307416_100023664
1094 Ga0307416_100236159
1095 Ga0307416_100427052
1096 Ga0307416_100598301
1097 Ga0307416_100665608
1098 Ga0307414_10024013
1099 Ga0307414_10039670
1100 Ga0307414_10045745
1101 Ga0307414_10093734
1102 Ga0307411_10030723
1103 Ga0307411_10032514
1104 Ga0307411_10038175
1105 Ga0307411_10045006
1106 Ga0307411_10098260
1107 Ga0307411_10801347
1108 Ga0307415_100035537
1109 Ga0307415_100085588
1110 Ga0373930_0057680
1111 Ga0373929_0000001
1112 Ga0373940_0018215
1113 Ga0373940_0030592
1114 Ga0373952_0115800
1115 Ga0373961_0000551
1116 Ga0373931_0059740
1117 Ga0373935_0001736
1118 Ga0373927_0010219
1119 Ga0373933_0535255
1120 Ga0373937_0220215
1121 Ga0395905_0311787
1122 Ga0395905_0580193
1123 Ga0436364_0581246
1124 Ga0395901_0428819
1125 Ga0242419_002780
1126 Ga0439436_0015418
1127 Ga0439439_0002149
1128 Ga0451835_1251577
1129 Ga0451853_3182840
1130 Ga0439431_0086068
1131 Ga0439450_048409
1132 Ga0439446_0019045
1133 Ga0439459_0078658
1134 Ga0451577_0103244
1135 Ga0451577_0124413
1136 Ga0451577_0203359
1137 Ga0451577_0455630
1138 Ga0453683_0003120
1139 Ga0453683_0008328
1140 Ga0453683_0044543
1141 Ga0453683_0115522
1142 Ga0453683_0157957
1143 Ga0453683_0249154
1144 Ga0466963_0137318
1145 Ga0453684_0014561
1146 Ga0453684_0550733
1147 Ga0466960_0130556
1148 Ga0451576_0006630
1149 Ga0451576_0094535
1150 Ga0451576_0138617
1151 Ga0451576_0318444
1152 Ga0451576_0334737
1153 Ga0451576_0490911
1154 Ga0451576_0979082
1155 Ga0495603_0120641
1156 Ga0495603_0125930
1157 Ga0495651_0127651
1158 Ga0495580_0134858
1159 Ga0495580_0175988
1160 Ga0495663_0039763
1161 Ga0495642_0037696
1162 Ga0495640_0293817
1163 Ga0495609_0022215
1164 Ga0495621_0130537
1165 Ga0495623_0316693
1166 Ga0495658_0262762
1167 Ga0495674_0601494
1168 Ga0495602_0433469
1169 Ga0495615_0022583
1170 Ga0496101_0046242
1171 Ga0496102_0001968
1172 Ga0496102_0070578
1173 Ga0496102_0080369
1174 Ga0496103_0003862
1175 Ga0496103_0046539
1176 Ga0496104_0028710
1177 Ga0496104_0041600
1178 Ga0496104_0074137
1179 Ga0496105_0101787
1180 Ga0496105_0156520
1181 Ga0496106_0025817
1182 Ga0496106_0255334
1183 Ga0496106_0313955
1184 Ga0496106_0394729
1185 Ga0496107_0189452
1186 Ga0496107_0284103
1187 Ga0496108_0000530
1188 Ga0496108_0005507
1189 Ga0496108_0007543
1190 Ga0496108_0137934
1191 Ga0496109_0005600
1192 Ga0496109_0027823
1193 Ga0496109_0035428
1194 Ga0496109_0855451
1195 Ga0496110_0012178
1196 Ga0496110_0441854
1197 Ga0496111_0002460
1198 Ga0496111_0051993
1199 Ga0496111_0234129
1200 Ga0496112_0000343
1201 Ga0496112_0003784
1202 Ga0496112_0039247
1203 Ga0496112_0187521
1204 Ga0496112_0365368
1205 Ga0496113_0000225
1206 Ga0496113_0001395
1207 Ga0496113_0368734
1208 Ga0496114_0000060
1209 Ga0496114_0097985
1210 Ga0496115_0380364
1211 Ga0501031_0196067
1212 Ga0501031_0213643
1213 Ga0501033_0029463
1214 Ga0501033_0050022
1215 Ga0501034_0022302
1216 Ga0501034_0205117
1217 Ga0501036_0065194
1218 Ga0501036_0074175
1219 Ga0501036_0146222
1220 Ga0501036_0214526
1221 Ga0501036_0239802
1222 Ga0501037_0052195
1223 Ga0501037_0406509
1224 Ga0501038_0067873
1225 Ga0501038_0199357
1226 Ga0501038_0259264
1227 Ga0501038_0354052
1228 Ga0501039_0027263
1229 Ga0501039_0047503
1230 Ga0501039_0067372
1231 Ga0501039_0227124
1232 Ga0501040_0040920
1233 Ga0501040_0114252
1234 Ga0501040_0252955
1235 Ga0501040_0351190
1236 Ga0501041_0036632
1237 Ga0501041_0036686
1238 Ga0501041_0120242
1239 Ga0501042_0043909
1240 Ga0501042_0273362
1241 Ga0501042_0281229
1242 Ga0501042_0401153
1243 Ga0501046_0019398
1244 Ga0501046_0058723
1245 Ga0501046_0062146
1246 Ga0501046_0088462
1247 Ga0501046_0295382
1248 Ga0501048_0067212
1249 Ga0501048_0068432
1250 Ga0501067_0009422
1251 Ga0501067_0020034
1252 Ga0501067_0028087
1253 Ga0501067_0123055
1254 Ga0501067_0168323
1255 Ga0501068_0000674
1256 Ga0501068_0057852
1257 Ga0501068_0530127
1258 Ga0501069_0000791
1259 Ga0501069_0012218
1260 Ga0501069_0169643
1261 Ga0501070_0044349
1262 Ga0501070_0090898
1263 Ga0501070_0146263
1264 Ga0501070_0163732
1265 Ga0501070_0235424
1266 Ga0501070_0636200
1267 Ga0501071_0020837
1268 Ga0501071_0026080
1269 Ga0501071_0109270
1270 Ga0501071_0252867
1271 Ga0501072_0002245
1272 Ga0501072_0019830
1273 Ga0501072_0031992
1274 Ga0501073_0006597
1275 Ga0501073_0032797
1276 Ga0501073_0069458
1277 Ga0501074_0001695
1278 Ga0501074_0006415
1279 Ga0501074_0111693
1280 Ga0501074_0113749
1281 Ga0501074_0234482
1282 Ga0501075_0001676
1283 Ga0501075_0012966
1284 Ga0501075_0017953
1285 Ga0501075_0292008
1286 Ga0501075_0306813
1287 Ga0501076_0012647
1288 Ga0501076_0023882
1289 Ga0501076_0288343
1290 Ga0501076_0531514
1291 Ga0501076_0550093
1292 Ga0501077_0000260
1293 Ga0501077_0003261
1294 Ga0501077_0009246
1295 Ga0501077_0091433
1296 Ga0501077_0137152
1297 Ga0501079_0024801
1298 Ga0501079_0092663
1299 Ga0501079_0094658
1300 Ga0501079_0144565
1301 Ga0501080_0003112
1302 Ga0501080_0038328
1303 Ga0501080_0041632
1304 Ga0501080_0064420
1305 Ga0501080_0068095
1306 Ga0501081_0003202
1307 Ga0501081_0012620
1308 Ga0501081_0029248
1309 Ga0501081_0057239
1310 Ga0501081_0078725
1311 Ga0501081_0093814
1312 Ga0501083_0020722
1313 Ga0501083_0100018
1314 Ga0501083_0401099
1315 Ga0501035_0554401
1316 Ga0501045_0042467
1317 Ga0501045_0049482
1318 Ga0501045_0238442
1319 nmdc:mga05p37_124325_c1
1320 nmdc:mga05p37_308867_c1
1321 nmdc:mga05p37_41469_c1
1322 nmdc:mga09592_50856_c1
1323 nmdc:mga0qj67_26268_c1
1324 nmdc:mga06r32_19693_c1
1325 nmdc:mga06r32_9875_c1
1326 nmdc:mga08y16_143391_c1
1327 nmdc:mga08y16_191337_c1
1328 nmdc:mga0n895_13535_c1
1329 nmdc:mga0n895_15843_c1
1330 nmdc:mga0n895_1642_c2
1331 nmdc:mga0n895_169139_c1
1332 nmdc:mga0n895_20325_c1
1333 nmdc:mga0n895_213907_c1
1334 nmdc:mga0n895_217318_c1
1335 nmdc:mga0n895_305515_c1
1336 nmdc:mga0n895_336544_c1
1337 nmdc:mga0n895_376594_c1
1338 nmdc:mga0n895_43207_c1
1339 nmdc:mga0n895_523335_c1
1340 nmdc:mga0n895_52537_c1
1341 nmdc:mga0n895_64645_c1
1342 nmdc:mga0n895_748077_c1
1343 nmdc:mga0n895_90988_c1
1344 nmdc:mga0rr50_107765_c1
1345 nmdc:mga0rr50_174271_c1
1346 nmdc:mga0rr50_31239_c1
1347 nmdc:mga0rr50_601555_c1
1348 nmdc:mga0rr50_61708_c1
1349 nmdc:mga0rr50_746238_c1
1350 nmdc:mga08x19_11765_c1
1351 nmdc:mga08x19_133325_c1
1352 nmdc:mga08x19_237829_c1
1353 nmdc:mga08x19_285265_c1
1354 nmdc:mga08x19_29925_c1
1355 nmdc:mga08x19_36506_c1
1356 nmdc:mga08x19_420_c1
1357 nmdc:mga08x19_429586_c1
1358 nmdc:mga08x19_499144_c1
1359 nmdc:mga08x19_7147_c1
1360 nmdc:mga08x19_71934_c1
1361 nmdc:mga0a205_102831_c1
1362 nmdc:mga0a205_296418_c1
1363 nmdc:mga0a205_2979_c1
1364 nmdc:mga0a205_316619_c1
1365 nmdc:mga0a205_320368_c1
1366 nmdc:mga0a205_568194_c1
1367 nmdc:mga0a205_57825_c1
1368 nmdc:mga0a205_889_c1
1369 Ga0501084_0001693
1370 Ga0501084_0010009
1371 Ga0501084_0019868
1372 Ga0501084_0022947
1373 Ga0501084_0045918
1374 Ga0501084_0079904
1375 Ga0501084_0159260
1376 Ga0501084_0471119
1377 Ga0501084_0515769
1378 Ga0590071_005679
1379 Ga0590071_009360
1380 Ga0590074_003754
1381 Ga0501082_0000228
1382 Ga0501082_0010643
1383 Ga0501082_0014227
1384 Ga0501082_0031155
1385 Ga0501082_0168246
1386 Ga0501082_0431369
1387 Ga0530510_0192911
1388 Ga0530510_0216001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

108

261

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.937 80 224
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.9362 84 215
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.916 76 225
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.915 80 224
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9025 76 220
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9371 80 224 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.935 84 215 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9022 84 214 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8949 85 225 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8863 74 220 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7C7FY88-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9703 127 225
AF-A0A7X8KVW6-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9662 84 212 GO:0006790
GO:0008482
GO:0020037
GO:0043546
AF-A0A6J7TS42-F1-model_v4 Unannotated protein 0.9625 84 225
AF-A0A538HGG2-F1-model_v4 Oxidoreductase 0.961 91 225
AF-A0A7C3LWH1-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.958 83 225

Map