F475758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 283 | 694 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0080143|Ga0501032_0080143_466_1011 |
| Length | 181 |
| Sequence | MRLSPVFAPFLKFSDNEERIIMNTKSLYQEVILDHNRKPRNYGVLEKPSHQAVGHNPLCGDHLDIALDLEGGRIDRIAFKGESCAICKASASMMTTVVKGKTRADAETLIEEFRDMAMGKLDVDGPHHLGRLTVFAGVRDLPTRVKCAILPWHTLHAALNSVTVASTEAEDDPMHAAIGDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 213 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 214 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 237 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 238 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 5.04 |
| Rhizosphere | 94.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_208097 | 2162886007 | Unclassified | 928 |
| 2 | Ga0065704_10071556 | 3300005289 | Bacteria | 10723 |
| 3 | Ga0065712_10077682 | 3300005290 | Bacteria | 3458 |
| 4 | Ga0065715_10044987 | 3300005293 | Bacteria | 1159 |
| 5 | Ga0065715_10818593 | 3300005293 | Bacteria | 594 |
| 6 | Ga0070658_10018474 | 3300005327 | Bacteria | 5583 |
| 7 | Ga0070676_10055704 | 3300005328 | Bacteria | 2334 |
| 8 | Ga0070676_10168580 | 3300005328 | Bacteria | 1414 |
| 9 | Ga0070676_10294364 | 3300005328 | Bacteria | 1098 |
| 10 | Ga0070676_10450267 | 3300005328 | Unclassified | 905 |
| 11 | Ga0070676_10641477 | 3300005328 | Bacteria | 770 |
| 12 | Ga0070683_100000620 | 3300005329 | Bacteria | 25543 |
| 13 | Ga0070690_100029641 | 3300005330 | Bacteria | 3396 |
| 14 | Ga0070690_100038356 | 3300005330 | Bacteria | 3023 |
| 15 | Ga0070690_100270012 | 3300005330 | Bacteria | 1209 |
| 16 | Ga0070690_100294952 | 3300005330 | Bacteria | 1161 |
| 17 | Ga0070670_100000425 | 3300005331 | Bacteria | 34805 |
| 18 | Ga0070670_100250503 | 3300005331 | Bacteria | 1543 |
| 19 | Ga0070670_100410736 | 3300005331 | Bacteria | 1196 |
| 20 | Ga0070677_10019840 | 3300005333 | Bacteria | 2441 |
| 21 | Ga0070677_10038317 | 3300005333 | Bacteria | 1875 |
| 22 | Ga0068869_100001424 | 3300005334 | Bacteria | 14173 |
| 23 | Ga0068869_100003052 | 3300005334 | Bacteria | 10184 |
| 24 | Ga0068869_100317271 | 3300005334 | Bacteria | 1263 |
| 25 | Ga0070666_10005432 | 3300005335 | Bacteria | 7814 |
| 26 | Ga0070680_100050071 | 3300005336 | Bacteria | 3407 |
| 27 | Ga0070680_100174528 | 3300005336 | Bacteria | 1809 |
| 28 | Ga0070680_100194408 | 3300005336 | Bacteria | 1710 |
| 29 | Ga0068868_100000145 | 3300005338 | Bacteria | 46047 |
| 30 | Ga0068868_100115383 | 3300005338 | Bacteria | 2186 |
| 31 | Ga0068868_100157105 | 3300005338 | Bacteria | 1876 |
| 32 | Ga0068868_100455482 | 3300005338 | Unclassified | 1113 |
| 33 | Ga0068868_100607902 | 3300005338 | Bacteria | 969 |
| 34 | Ga0068868_100670593 | 3300005338 | Bacteria | 925 |
| 35 | Ga0070660_100364103 | 3300005339 | Bacteria | 1192 |
| 36 | Ga0070689_100002386 | 3300005340 | Bacteria | 12246 |
| 37 | Ga0070689_100010875 | 3300005340 | Bacteria | 6503 |
| 38 | Ga0070689_100181147 | 3300005340 | Bacteria | 1711 |
| 39 | Ga0070689_100217069 | 3300005340 | Bacteria | 1567 |
| 40 | Ga0070689_100801509 | 3300005340 | Bacteria | 828 |
| 41 | Ga0070689_101490005 | 3300005340 | Bacteria | 613 |
| 42 | Ga0070691_10008905 | 3300005341 | Bacteria | 4595 |
| 43 | Ga0070687_100134323 | 3300005343 | Bacteria | 1432 |
| 44 | Ga0070687_100137429 | 3300005343 | Bacteria | 1418 |
| 45 | Ga0070687_100573961 | 3300005343 | Bacteria | 771 |
| 46 | Ga0070661_100004612 | 3300005344 | Bacteria | 9482 |
| 47 | Ga0070661_101355327 | 3300005344 | Bacteria | 598 |
| 48 | Ga0070692_10026458 | 3300005345 | Bacteria | 2868 |
| 49 | Ga0070668_100833327 | 3300005347 | Unclassified | 821 |
| 50 | Ga0070675_100001867 | 3300005354 | Bacteria | 15530 |
| 51 | Ga0070675_100038641 | 3300005354 | Bacteria | 3891 |
| 52 | Ga0070675_100655224 | 3300005354 | Bacteria | 954 |
| 53 | Ga0070675_100948594 | 3300005354 | Bacteria | 789 |
| 54 | Ga0070671_100000623 | 3300005355 | Bacteria | 25250 |
| 55 | Ga0070671_100050216 | 3300005355 | Bacteria | 3469 |
| 56 | Ga0070671_100054443 | 3300005355 | Bacteria | 3327 |
| 57 | Ga0070671_100179419 | 3300005355 | Bacteria | 1793 |
| 58 | Ga0070671_100510316 | 3300005355 | Bacteria | 1035 |
| 59 | Ga0070674_100021913 | 3300005356 | Bacteria | 4112 |
| 60 | Ga0070674_100317034 | 3300005356 | Bacteria | 1249 |
| 61 | Ga0070674_100400569 | 3300005356 | Bacteria | 1121 |
| 62 | Ga0070674_101266174 | 3300005356 | Bacteria | 657 |
| 63 | Ga0070673_100000994 | 3300005364 | Bacteria | 16078 |
| 64 | Ga0070673_100103225 | 3300005364 | Bacteria | 2352 |
| 65 | Ga0070673_100351521 | 3300005364 | Bacteria | 1308 |
| 66 | Ga0070673_100958810 | 3300005364 | Bacteria | 795 |
| 67 | Ga0070673_101692432 | 3300005364 | Bacteria | 598 |
| 68 | Ga0070688_100035047 | 3300005365 | Bacteria | 3046 |
| 69 | Ga0070659_100202170 | 3300005366 | Bacteria | 1636 |
| 70 | Ga0070659_100322272 | 3300005366 | Bacteria | 1292 |
| 71 | Ga0070659_100682621 | 3300005366 | Bacteria | 887 |
| 72 | Ga0070659_100690689 | 3300005366 | Bacteria | 882 |
| 73 | Ga0070667_100029846 | 3300005367 | Bacteria | 4546 |
| 74 | Ga0070714_100107982 | 3300005435 | Bacteria | 2460 |
| 75 | Ga0070701_10000068 | 3300005438 | Bacteria | 28103 |
| 76 | Ga0070701_10560760 | 3300005438 | Unclassified | 751 |
| 77 | Ga0070711_101545011 | 3300005439 | Bacteria | 580 |
| 78 | Ga0070705_101112233 | 3300005440 | Unclassified | 647 |
| 79 | Ga0070700_100031382 | 3300005441 | Bacteria | 3183 |
| 80 | Ga0070700_100116393 | 3300005441 | Bacteria | 1785 |
| 81 | Ga0070700_100137292 | 3300005441 | Bacteria | 1657 |
| 82 | Ga0070700_100406901 | 3300005441 | Bacteria | 1025 |
| 83 | Ga0070700_101008062 | 3300005441 | Bacteria | 685 |
| 84 | Ga0070694_100162003 | 3300005444 | Bacteria | 1642 |
| 85 | Ga0070694_100827664 | 3300005444 | Bacteria | 760 |
| 86 | Ga0070708_100179911 | 3300005445 | Bacteria | 1976 |
| 87 | Ga0070663_100086998 | 3300005455 | Bacteria | 2309 |
| 88 | Ga0070678_100000715 | 3300005456 | Bacteria | 16451 |
| 89 | Ga0070678_100228341 | 3300005456 | Bacteria | 1550 |
| 90 | Ga0070678_100285819 | 3300005456 | Bacteria | 1396 |
| 91 | Ga0070678_100735693 | 3300005456 | Bacteria | 891 |
| 92 | Ga0070678_100898497 | 3300005456 | Bacteria | 809 |
| 93 | Ga0070662_100045293 | 3300005457 | Bacteria | 3155 |
| 94 | Ga0070662_100217514 | 3300005457 | Bacteria | 1523 |
| 95 | Ga0070681_10006242 | 3300005458 | Bacteria | 11591 |
| 96 | Ga0070681_10156805 | 3300005458 | Bacteria | 2201 |
| 97 | Ga0070681_10243936 | 3300005458 | Bacteria | 1710 |
| 98 | Ga0068867_100007256 | 3300005459 | Bacteria | 7837 |
| 99 | Ga0068867_100012666 | 3300005459 | Bacteria | 5964 |
| 100 | Ga0068867_100037411 | 3300005459 | Bacteria | 3527 |
| 101 | Ga0068867_100244875 | 3300005459 | Bacteria | 1455 |
| 102 | Ga0068867_100337932 | 3300005459 | Bacteria | 1253 |
| 103 | Ga0068867_100987519 | 3300005459 | Bacteria | 763 |
| 104 | Ga0070685_10117304 | 3300005466 | Bacteria | 1648 |
| 105 | Ga0070685_10124928 | 3300005466 | Bacteria | 1602 |
| 106 | Ga0070685_10184031 | 3300005466 | Bacteria | 1347 |
| 107 | Ga0070685_10699909 | 3300005466 | Unclassified | 739 |
| 108 | Ga0070706_100243303 | 3300005467 | Bacteria | 1680 |
| 109 | Ga0070706_100546416 | 3300005467 | Bacteria | 1077 |
| 110 | Ga0070679_100074056 | 3300005530 | Bacteria | 3396 |
| 111 | Ga0070679_100115854 | 3300005530 | Bacteria | 2665 |
| 112 | Ga0070679_100586798 | 3300005530 | Bacteria | 1058 |
| 113 | Ga0070679_100643568 | 3300005530 | Unclassified | 1003 |
| 114 | Ga0070684_100030101 | 3300005535 | Bacteria | 4610 |
| 115 | Ga0070684_100445753 | 3300005535 | Bacteria | 1196 |
| 116 | Ga0070697_100185705 | 3300005536 | Bacteria | 1763 |
| 117 | Ga0068853_100538909 | 3300005539 | Bacteria | 1105 |
| 118 | Ga0070672_100000613 | 3300005543 | Bacteria | 20968 |
| 119 | Ga0070686_100001003 | 3300005544 | Bacteria | 16289 |
| 120 | Ga0070686_100283057 | 3300005544 | Bacteria | 1224 |
| 121 | Ga0070695_100022132 | 3300005545 | Bacteria | 3896 |
| 122 | Ga0070695_100139908 | 3300005545 | Unclassified | 1677 |
| 123 | Ga0070695_100144101 | 3300005545 | Bacteria | 1656 |
| 124 | Ga0070695_100853416 | 3300005545 | Bacteria | 733 |
| 125 | Ga0070696_100020029 | 3300005546 | Bacteria | 4536 |
| 126 | Ga0070696_100412136 | 3300005546 | Bacteria | 1059 |
| 127 | Ga0070693_100058698 | 3300005547 | Bacteria | 2228 |
| 128 | Ga0070693_100136915 | 3300005547 | Unclassified | 1537 |
| 129 | Ga0070665_100215780 | 3300005548 | Bacteria | 1919 |
| 130 | Ga0070665_100445654 | 3300005548 | Bacteria | 1304 |
| 131 | Ga0070704_100008155 | 3300005549 | Bacteria | 6265 |
| 132 | Ga0070704_100188779 | 3300005549 | Bacteria | 1655 |
| 133 | Ga0070704_100560737 | 3300005549 | Bacteria | 999 |
| 134 | Ga0070704_100986298 | 3300005549 | Bacteria | 761 |
| 135 | Ga0068855_100017462 | 3300005563 | Bacteria | 8631 |
| 136 | Ga0070664_100000316 | 3300005564 | Bacteria | 35228 |
| 137 | Ga0070664_100412362 | 3300005564 | Bacteria | 1236 |
| 138 | Ga0070664_101617508 | 3300005564 | Bacteria | 614 |
| 139 | Ga0068854_100006142 | 3300005578 | Bacteria | 7623 |
| 140 | Ga0068854_100349887 | 3300005578 | Bacteria | 1209 |
| 141 | Ga0068854_100905176 | 3300005578 | Bacteria | 776 |
| 142 | Ga0068856_100541867 | 3300005614 | Bacteria | 1185 |
| 143 | Ga0068856_100931596 | 3300005614 | Bacteria | 887 |
| 144 | Ga0070702_100000040 | 3300005615 | Bacteria | 35063 |
| 145 | Ga0070702_100011565 | 3300005615 | Bacteria | 4393 |
| 146 | Ga0070702_100058944 | 3300005615 | Bacteria | 2226 |
| 147 | Ga0070702_100234032 | 3300005615 | Bacteria | 1236 |
| 148 | Ga0070702_100304206 | 3300005615 | Unclassified | 1104 |
| 149 | Ga0070702_100333716 | 3300005615 | Bacteria | 1061 |
| 150 | Ga0068852_100000229 | 3300005616 | Bacteria | 38015 |
| 151 | Ga0068859_100031545 | 3300005617 | Bacteria | 5322 |
| 152 | Ga0068859_100042159 | 3300005617 | Bacteria | 4584 |
| 153 | Ga0068859_100084377 | 3300005617 | Bacteria | 3222 |
| 154 | Ga0068859_101111277 | 3300005617 | Bacteria | 869 |
| 155 | Ga0068864_100006381 | 3300005618 | Bacteria | 9665 |
| 156 | Ga0068864_100164332 | 3300005618 | Bacteria | 2020 |
| 157 | Ga0068864_100174535 | 3300005618 | Bacteria | 1961 |
| 158 | Ga0068864_100214637 | 3300005618 | Bacteria | 1773 |
| 159 | Ga0068864_101468301 | 3300005618 | Bacteria | 684 |
| 160 | Ga0068864_102437372 | 3300005618 | Unclassified | 529 |
| 161 | Ga0068866_10001473 | 3300005718 | Bacteria | 10036 |
| 162 | Ga0068866_10044262 | 3300005718 | Bacteria | 2226 |
| 163 | Ga0068861_100000658 | 3300005719 | Bacteria | 20535 |
| 164 | Ga0068861_100072633 | 3300005719 | Bacteria | 2670 |
| 165 | Ga0068861_100174398 | 3300005719 | Bacteria | 1785 |
| 166 | Ga0068851_10005187 | 3300005834 | Bacteria | 5914 |
| 167 | Ga0068870_10003999 | 3300005840 | Bacteria | 6292 |
| 168 | Ga0068870_10569075 | 3300005840 | Bacteria | 765 |
| 169 | Ga0068870_10962877 | 3300005840 | Bacteria | 606 |
| 170 | Ga0068863_100052247 | 3300005841 | Bacteria | 3873 |
| 171 | Ga0068863_100059980 | 3300005841 | Bacteria | 3599 |
| 172 | Ga0068863_100126314 | 3300005841 | Bacteria | 2440 |
| 173 | Ga0068863_100408415 | 3300005841 | Bacteria | 1329 |
| 174 | Ga0068863_100415522 | 3300005841 | Unclassified | 1317 |
| 175 | Ga0068858_100003367 | 3300005842 | Bacteria | 15912 |
| 176 | Ga0068858_100241941 | 3300005842 | Bacteria | 1712 |
| 177 | Ga0068858_100329800 | 3300005842 | Bacteria | 1459 |
| 178 | Ga0068858_100585653 | 3300005842 | Bacteria | 1081 |
| 179 | Ga0068860_100079128 | 3300005843 | Bacteria | 3126 |
| 180 | Ga0068860_100092581 | 3300005843 | Bacteria | 2880 |
| 181 | Ga0068860_100808146 | 3300005843 | Bacteria | 951 |
| 182 | Ga0068862_100242416 | 3300005844 | Bacteria | 1639 |
| 183 | Ga0068862_100470605 | 3300005844 | Bacteria | 1188 |
| 184 | Ga0068862_101093861 | 3300005844 | Bacteria | 792 |
| 185 | Ga0081539_10129038 | 3300005985 | Bacteria | 1244 |
| 186 | Ga0075364_10583040 | 3300006051 | Bacteria | 764 |
| 187 | Ga0075432_10109233 | 3300006058 | Bacteria | 1029 |
| 188 | Ga0070716_100241005 | 3300006173 | Unclassified | 1226 |
| 189 | Ga0097621_100001842 | 3300006237 | Bacteria | 14533 |
| 190 | Ga0097621_100003464 | 3300006237 | Bacteria | 10878 |
| 191 | Ga0097621_100161618 | 3300006237 | Bacteria | 1925 |
| 192 | Ga0097621_100207675 | 3300006237 | Bacteria | 1702 |
| 193 | Ga0097621_100313607 | 3300006237 | Bacteria | 1388 |
| 194 | Ga0068871_100000463 | 3300006358 | Bacteria | 27903 |
| 195 | Ga0068871_100043321 | 3300006358 | Bacteria | 3615 |
| 196 | Ga0068871_100320039 | 3300006358 | Bacteria | 1365 |
| 197 | Ga0075428_100195225 | 3300006844 | Bacteria | 2189 |
| 198 | Ga0075428_100382866 | 3300006844 | Bacteria | 1508 |
| 199 | Ga0075430_100054607 | 3300006846 | Bacteria | 3361 |
| 200 | Ga0075431_100000405 | 3300006847 | Bacteria | 34877 |
| 201 | Ga0075431_100703394 | 3300006847 | Bacteria | 988 |
| 202 | Ga0075433_10550132 | 3300006852 | Bacteria | 1015 |
| 203 | Ga0075433_11205073 | 3300006852 | Unclassified | 657 |
| 204 | Ga0075434_100388254 | 3300006871 | Bacteria | 1417 |
| 205 | Ga0075434_100780632 | 3300006871 | Bacteria | 972 |
| 206 | Ga0075429_100017441 | 3300006880 | Bacteria | 6208 |
| 207 | Ga0075429_100753562 | 3300006880 | Bacteria | 853 |
| 208 | Ga0075429_100909153 | 3300006880 | Bacteria | 770 |
| 209 | Ga0068865_100000529 | 3300006881 | Bacteria | 21356 |
| 210 | Ga0068865_100110321 | 3300006881 | Bacteria | 2028 |
| 211 | Ga0068865_100181633 | 3300006881 | Bacteria | 1620 |
| 212 | Ga0068865_100563197 | 3300006881 | Bacteria | 958 |
| 213 | Ga0075436_100625478 | 3300006914 | Unclassified | 794 |
| 214 | Ga0097620_100031545 | 3300006931 | Bacteria | 5322 |
| 215 | Ga0097620_100042160 | 3300006931 | Bacteria | 4584 |
| 216 | Ga0097620_100084376 | 3300006931 | Bacteria | 3222 |
| 217 | Ga0097620_101111332 | 3300006931 | Bacteria | 869 |
| 218 | Ga0105251_10347355 | 3300009011 | Bacteria | 677 |
| 219 | Ga0111539_10008285 | 3300009094 | Bacteria | 13231 |
| 220 | Ga0111539_10166798 | 3300009094 | Bacteria | 2574 |
| 221 | Ga0111539_10205558 | 3300009094 | Bacteria | 2295 |
| 222 | Ga0111539_10427340 | 3300009094 | Bacteria | 1543 |
| 223 | Ga0111539_10445061 | 3300009094 | Bacteria | 1509 |
| 224 | Ga0111539_10776304 | 3300009094 | Bacteria | 1115 |
| 225 | Ga0111539_11367727 | 3300009094 | Bacteria | 821 |
| 226 | Ga0111539_12300240 | 3300009094 | Bacteria | 625 |
| 227 | Ga0105245_10001373 | 3300009098 | Bacteria | 22028 |
| 228 | Ga0105245_10088181 | 3300009098 | Bacteria | 2849 |
| 229 | Ga0105245_10748151 | 3300009098 | Bacteria | 1013 |
| 230 | Ga0105245_11914274 | 3300009098 | Bacteria | 646 |
| 231 | Ga0105243_10000265 | 3300009148 | Bacteria | 58881 |
| 232 | Ga0105243_10046941 | 3300009148 | Bacteria | 3399 |
| 233 | Ga0105243_10130322 | 3300009148 | Bacteria | 2133 |
| 234 | Ga0105243_10146830 | 3300009148 | Bacteria | 2019 |
| 235 | Ga0105243_11484059 | 3300009148 | Unclassified | 701 |
| 236 | Ga0105241_10000819 | 3300009174 | Bacteria | 23602 |
| 237 | Ga0105242_10004037 | 3300009176 | Bacteria | 11408 |
| 238 | Ga0105242_10165022 | 3300009176 | Bacteria | 1942 |
| 239 | Ga0105242_10320105 | 3300009176 | Bacteria | 1422 |
| 240 | Ga0105242_10411928 | 3300009176 | Unclassified | 1264 |
| 241 | Ga0105242_11510324 | 3300009176 | Bacteria | 703 |
| 242 | Ga0105248_10002997 | 3300009177 | Bacteria | 18729 |
| 243 | Ga0105248_10054534 | 3300009177 | Bacteria | 4483 |
| 244 | Ga0105248_10347775 | 3300009177 | Bacteria | 1669 |
| 245 | Ga0105248_10362462 | 3300009177 | Bacteria | 1632 |
| 246 | Ga0105248_11551752 | 3300009177 | Bacteria | 750 |
| 247 | Ga0105237_10182374 | 3300009545 | Bacteria | 2099 |
| 248 | Ga0105238_10156818 | 3300009551 | Bacteria | 2251 |
| 249 | Ga0105238_10319870 | 3300009551 | Bacteria | 1537 |
| 250 | Ga0105238_10531760 | 3300009551 | Bacteria | 1179 |
| 251 | Ga0105249_10070378 | 3300009553 | Bacteria | 3229 |
| 252 | Ga0105249_10258074 | 3300009553 | Bacteria | 1731 |
| 253 | Ga0105249_11730548 | 3300009553 | Bacteria | 698 |
| 254 | Ga0105239_10179579 | 3300010375 | Bacteria | 2368 |
| 255 | Ga0105239_10332716 | 3300010375 | Bacteria | 1713 |
| 256 | Ga0105246_10211486 | 3300011119 | Bacteria | 1514 |
| 257 | Ga0105246_10412066 | 3300011119 | Bacteria | 1125 |
| 258 | Ga0105246_10431656 | 3300011119 | Bacteria | 1102 |
| 259 | Ga0157328_1003321 | 3300012478 | Bacteria | 833 |
| 260 | Ga0157371_10245366 | 3300013102 | Bacteria | 1289 |
| 261 | Ga0157370_10022519 | 3300013104 | Bacteria | 6269 |
| 262 | Ga0157374_10000860 | 3300013296 | Bacteria | 26547 |
| 263 | Ga0157374_10209813 | 3300013296 | Bacteria | 1909 |
| 264 | Ga0157374_10683187 | 3300013296 | Bacteria | 1039 |
| 265 | Ga0157378_10000478 | 3300013297 | Bacteria | 38074 |
| 266 | Ga0157378_10001726 | 3300013297 | Bacteria | 19632 |
| 267 | Ga0157378_10100198 | 3300013297 | Bacteria | 2644 |
| 268 | Ga0157378_10143942 | 3300013297 | Bacteria | 2216 |
| 269 | Ga0157378_10184725 | 3300013297 | Bacteria | 1963 |
| 270 | Ga0157378_10507743 | 3300013297 | Bacteria | 1205 |
| 271 | Ga0157378_10944521 | 3300013297 | Bacteria | 895 |
| 272 | Ga0157378_11069670 | 3300013297 | Bacteria | 843 |
| 273 | Ga0163162_10099349 | 3300013306 | Bacteria | 3001 |
| 274 | Ga0163162_10105559 | 3300013306 | Bacteria | 2912 |
| 275 | Ga0163162_12848258 | 3300013306 | Bacteria | 557 |
| 276 | Ga0157372_10413726 | 3300013307 | Bacteria | 1571 |
| 277 | Ga0157372_10704470 | 3300013307 | Unclassified | 1175 |
| 278 | Ga0157375_10000496 | 3300013308 | Bacteria | 35668 |
| 279 | Ga0157375_10115278 | 3300013308 | Bacteria | 2790 |
| 280 | Ga0157375_10164398 | 3300013308 | Bacteria | 2363 |
| 281 | Ga0157375_10200480 | 3300013308 | Bacteria | 2151 |
| 282 | Ga0163163_10295431 | 3300014325 | Bacteria | 1672 |
| 283 | Ga0157380_10040803 | 3300014326 | Bacteria | 3618 |
| 284 | Ga0157380_10335209 | 3300014326 | Bacteria | 1408 |
| 285 | Ga0157380_10658535 | 3300014326 | Bacteria | 1046 |
| 286 | Ga0157377_10138741 | 3300014745 | Bacteria | 1492 |
| 287 | Ga0157377_10161519 | 3300014745 | Bacteria | 1394 |
| 288 | Ga0157377_10649245 | 3300014745 | Bacteria | 759 |
| 289 | Ga0157379_10035557 | 3300014968 | Bacteria | 4441 |
| 290 | Ga0157379_10325220 | 3300014968 | Bacteria | 1404 |
| 291 | Ga0157379_10907862 | 3300014968 | Bacteria | 836 |
| 292 | Ga0157376_10004497 | 3300014969 | Bacteria | 9715 |
| 293 | Ga0157376_10015747 | 3300014969 | Bacteria | 5722 |
| 294 | Ga0157376_10055715 | 3300014969 | Bacteria | 3300 |
| 295 | Ga0157376_10112186 | 3300014969 | Bacteria | 2402 |
| 296 | Ga0157376_10318810 | 3300014969 | Bacteria | 1477 |
| 297 | Ga0157376_10450151 | 3300014969 | Bacteria | 1256 |
| 298 | Ga0157376_10548038 | 3300014969 | Bacteria | 1144 |
| 299 | Ga0157376_12197770 | 3300014969 | Bacteria | 591 |
| 300 | Ga0163161_10115899 | 3300017792 | Bacteria | 2008 |
| 301 | Ga0163161_10155452 | 3300017792 | Bacteria | 1741 |
| 302 | Ga0163161_10294604 | 3300017792 | Bacteria | 1276 |
| 303 | Ga0163161_10560497 | 3300017792 | Unclassified | 937 |
| 304 | Ga0207697_10011965 | 3300025315 | Bacteria | 3653 |
| 305 | Ga0207682_10001311 | 3300025893 | Bacteria | 11436 |
| 306 | Ga0207682_10129957 | 3300025893 | Unclassified | 1124 |
| 307 | Ga0207642_10001377 | 3300025899 | Bacteria | 7544 |
| 308 | Ga0207688_10296155 | 3300025901 | Bacteria | 988 |
| 309 | Ga0207680_10778225 | 3300025903 | Bacteria | 686 |
| 310 | Ga0207645_10109626 | 3300025907 | Bacteria | 1786 |
| 311 | Ga0207645_10196517 | 3300025907 | Bacteria | 1326 |
| 312 | Ga0207645_10370526 | 3300025907 | Bacteria | 960 |
| 313 | Ga0207645_10502505 | 3300025907 | Bacteria | 821 |
| 314 | Ga0207643_10004592 | 3300025908 | Bacteria | 7418 |
| 315 | Ga0207643_10086755 | 3300025908 | Bacteria | 1819 |
| 316 | Ga0207643_10104977 | 3300025908 | Bacteria | 1660 |
| 317 | Ga0207705_10063839 | 3300025909 | Bacteria | 2661 |
| 318 | Ga0207684_10713590 | 3300025910 | Bacteria | 851 |
| 319 | Ga0207654_10004525 | 3300025911 | Bacteria | 7023 |
| 320 | Ga0207707_10062251 | 3300025912 | Bacteria | 3247 |
| 321 | Ga0207671_10127258 | 3300025914 | Bacteria | 1952 |
| 322 | Ga0207660_10420022 | 3300025917 | Bacteria | 1079 |
| 323 | Ga0207662_10003156 | 3300025918 | Bacteria | 8424 |
| 324 | Ga0207662_10231946 | 3300025918 | Bacteria | 1206 |
| 325 | Ga0207657_10118627 | 3300025919 | Bacteria | 2178 |
| 326 | Ga0207657_10191585 | 3300025919 | Bacteria | 1649 |
| 327 | Ga0207649_10002082 | 3300025920 | Bacteria | 11368 |
| 328 | Ga0207652_10428048 | 3300025921 | Unclassified | 1193 |
| 329 | Ga0207652_10444171 | 3300025921 | Bacteria | 1169 |
| 330 | Ga0207652_10579944 | 3300025921 | Bacteria | 1007 |
| 331 | Ga0207646_11047749 | 3300025922 | Bacteria | 719 |
| 332 | Ga0207650_10001393 | 3300025925 | Bacteria | 17447 |
| 333 | Ga0207650_10264101 | 3300025925 | Bacteria | 1397 |
| 334 | Ga0207659_10001475 | 3300025926 | Bacteria | 14020 |
| 335 | Ga0207659_10084861 | 3300025926 | Bacteria | 2351 |
| 336 | Ga0207687_10001592 | 3300025927 | Bacteria | 15618 |
| 337 | Ga0207664_11218103 | 3300025929 | Bacteria | 671 |
| 338 | Ga0207644_10001467 | 3300025931 | Bacteria | 15206 |
| 339 | Ga0207644_10001827 | 3300025931 | Bacteria | 13817 |
| 340 | Ga0207644_10072167 | 3300025931 | Bacteria | 2528 |
| 341 | Ga0207644_10129010 | 3300025931 | Bacteria | 1933 |
| 342 | Ga0207690_10054275 | 3300025932 | Bacteria | 2694 |
| 343 | Ga0207690_10085975 | 3300025932 | Bacteria | 2209 |
| 344 | Ga0207690_10264873 | 3300025932 | Bacteria | 1333 |
| 345 | Ga0207690_10489242 | 3300025932 | Bacteria | 994 |
| 346 | Ga0207706_10152175 | 3300025933 | Bacteria | 2035 |
| 347 | Ga0207706_10153386 | 3300025933 | Bacteria | 2026 |
| 348 | Ga0207706_10233702 | 3300025933 | Bacteria | 1608 |
| 349 | Ga0207706_10353465 | 3300025933 | Bacteria | 1277 |
| 350 | Ga0207686_10000731 | 3300025934 | Bacteria | 20402 |
| 351 | Ga0207709_10007485 | 3300025935 | Bacteria | 6077 |
| 352 | Ga0207709_10474435 | 3300025935 | Bacteria | 972 |
| 353 | Ga0207670_10017647 | 3300025936 | Bacteria | 4317 |
| 354 | Ga0207670_10041057 | 3300025936 | Bacteria | 3040 |
| 355 | Ga0207670_10047175 | 3300025936 | Bacteria | 2867 |
| 356 | Ga0207669_10067408 | 3300025937 | Bacteria | 2230 |
| 357 | Ga0207669_10196988 | 3300025937 | Bacteria | 1459 |
| 358 | Ga0207669_10926075 | 3300025937 | Bacteria | 729 |
| 359 | Ga0207704_10005518 | 3300025938 | Bacteria | 5830 |
| 360 | Ga0207704_10309803 | 3300025938 | Bacteria | 1213 |
| 361 | Ga0207704_10856168 | 3300025938 | Unclassified | 762 |
| 362 | Ga0207665_10290852 | 3300025939 | Bacteria | 1218 |
| 363 | Ga0207691_10000667 | 3300025940 | Bacteria | 33915 |
| 364 | Ga0207691_10125844 | 3300025940 | Bacteria | 2268 |
| 365 | Ga0207691_10635941 | 3300025940 | Bacteria | 902 |
| 366 | Ga0207711_10043907 | 3300025941 | Bacteria | 3814 |
| 367 | Ga0207711_10259755 | 3300025941 | Unclassified | 1596 |
| 368 | Ga0207711_10395287 | 3300025941 | Bacteria | 1284 |
| 369 | Ga0207689_10001388 | 3300025942 | Bacteria | 23186 |
| 370 | Ga0207689_10013184 | 3300025942 | Bacteria | 7053 |
| 371 | Ga0207689_10118976 | 3300025942 | Bacteria | 2173 |
| 372 | Ga0207661_10000839 | 3300025944 | Bacteria | 20168 |
| 373 | Ga0207679_10000649 | 3300025945 | Bacteria | 23237 |
| 374 | Ga0207679_10096147 | 3300025945 | Bacteria | 2304 |
| 375 | Ga0207679_10199423 | 3300025945 | Bacteria | 1671 |
| 376 | Ga0207679_10439041 | 3300025945 | Bacteria | 1155 |
| 377 | Ga0207679_10445227 | 3300025945 | Bacteria | 1148 |
| 378 | Ga0207679_11999350 | 3300025945 | Unclassified | 528 |
| 379 | Ga0207651_10070595 | 3300025960 | Bacteria | 2471 |
| 380 | Ga0207651_10926664 | 3300025960 | Bacteria | 776 |
| 381 | Ga0207651_11175755 | 3300025960 | Bacteria | 688 |
| 382 | Ga0207712_10599567 | 3300025961 | Unclassified | 953 |
| 383 | Ga0207668_10085487 | 3300025972 | Bacteria | 2302 |
| 384 | Ga0207668_10192960 | 3300025972 | Bacteria | 1616 |
| 385 | Ga0207668_10196614 | 3300025972 | Bacteria | 1603 |
| 386 | Ga0207640_10004522 | 3300025981 | Bacteria | 7548 |
| 387 | Ga0207640_10101233 | 3300025981 | Bacteria | 2021 |
| 388 | Ga0207640_11683278 | 3300025981 | Unclassified | 572 |
| 389 | Ga0207658_10016377 | 3300025986 | Bacteria | 5099 |
| 390 | Ga0207658_10193833 | 3300025986 | Bacteria | 1691 |
| 391 | Ga0207658_11051146 | 3300025986 | Bacteria | 743 |
| 392 | Ga0207677_10002637 | 3300026023 | Bacteria | 9439 |
| 393 | Ga0207677_10010843 | 3300026023 | Bacteria | 5170 |
| 394 | Ga0207677_10139271 | 3300026023 | Bacteria | 1855 |
| 395 | Ga0207677_10358060 | 3300026023 | Bacteria | 1225 |
| 396 | Ga0207677_10479944 | 3300026023 | Unclassified | 1071 |
| 397 | Ga0207703_10010025 | 3300026035 | Bacteria | 7427 |
| 398 | Ga0207703_10302758 | 3300026035 | Bacteria | 1458 |
| 399 | Ga0207703_10303459 | 3300026035 | Bacteria | 1457 |
| 400 | Ga0207703_10470146 | 3300026035 | Bacteria | 1177 |
| 401 | Ga0207639_10091566 | 3300026041 | Bacteria | 2435 |
| 402 | Ga0207708_10000129 | 3300026075 | Bacteria | 59106 |
| 403 | Ga0207708_10001911 | 3300026075 | Bacteria | 15389 |
| 404 | Ga0207708_10214475 | 3300026075 | Bacteria | 1540 |
| 405 | Ga0207708_10474039 | 3300026075 | Bacteria | 1046 |
| 406 | Ga0207708_10916452 | 3300026075 | Bacteria | 759 |
| 407 | Ga0207702_10044117 | 3300026078 | Bacteria | 3747 |
| 408 | Ga0207702_10204760 | 3300026078 | Bacteria | 1831 |
| 409 | Ga0207641_10053759 | 3300026088 | Bacteria | 3415 |
| 410 | Ga0207641_10423968 | 3300026088 | Bacteria | 1281 |
| 411 | Ga0207641_10574605 | 3300026088 | Bacteria | 1101 |
| 412 | Ga0207648_10000832 | 3300026089 | Bacteria | 34738 |
| 413 | Ga0207648_10032821 | 3300026089 | Bacteria | 4581 |
| 414 | Ga0207648_10081734 | 3300026089 | Unclassified | 2817 |
| 415 | Ga0207648_10161631 | 3300026089 | Bacteria | 1978 |
| 416 | Ga0207676_10224720 | 3300026095 | Bacteria | 1674 |
| 417 | Ga0207676_10338282 | 3300026095 | Bacteria | 1387 |
| 418 | Ga0207676_10619360 | 3300026095 | Bacteria | 1041 |
| 419 | Ga0207676_10820185 | 3300026095 | Bacteria | 908 |
| 420 | Ga0207675_100003765 | 3300026118 | Bacteria | 14780 |
| 421 | Ga0207675_100009662 | 3300026118 | Bacteria | 9027 |
| 422 | Ga0207675_100073048 | 3300026118 | Bacteria | 3209 |
| 423 | Ga0207675_100906473 | 3300026118 | Bacteria | 898 |
| 424 | Ga0207675_101575766 | 3300026118 | Bacteria | 677 |
| 425 | Ga0207683_10001353 | 3300026121 | Bacteria | 22149 |
| 426 | Ga0207683_10017181 | 3300026121 | Bacteria | 6160 |
| 427 | Ga0207683_10044602 | 3300026121 | Bacteria | 3876 |
| 428 | Ga0207683_10109333 | 3300026121 | Bacteria | 2474 |
| 429 | Ga0207683_10117033 | 3300026121 | Bacteria | 2390 |
| 430 | Ga0207698_10000201 | 3300026142 | Bacteria | 37485 |
| 431 | Ga0207698_10262088 | 3300026142 | Bacteria | 1588 |
| 432 | Ga0209969_1001193 | 3300027360 | Bacteria | 3576 |
| 433 | Ga0209969_1028386 | 3300027360 | Bacteria | 850 |
| 434 | Ga0209967_1029195 | 3300027364 | Bacteria | 823 |
| 435 | Ga0209981_1015878 | 3300027378 | Bacteria | 1056 |
| 436 | Ga0210000_1003606 | 3300027462 | Bacteria | 2233 |
| 437 | Ga0209995_1002446 | 3300027471 | Bacteria | 2933 |
| 438 | Ga0209999_1068730 | 3300027543 | Unclassified | 678 |
| 439 | Ga0210002_1031951 | 3300027617 | Bacteria | 877 |
| 440 | Ga0209983_1042994 | 3300027665 | Bacteria | 980 |
| 441 | Ga0209971_1007110 | 3300027682 | Bacteria | 2654 |
| 442 | Ga0209974_10003811 | 3300027876 | Bacteria | 5405 |
| 443 | Ga0209974_10066366 | 3300027876 | Bacteria | 1226 |
| 444 | Ga0207428_10049937 | 3300027907 | Bacteria | 3349 |
| 445 | Ga0268266_10163750 | 3300028379 | Bacteria | 2014 |
| 446 | Ga0268265_10178882 | 3300028380 | Bacteria | 1821 |
| 447 | Ga0268265_10378249 | 3300028380 | Bacteria | 1302 |
| 448 | Ga0268265_10452507 | 3300028380 | Unclassified | 1199 |
| 449 | Ga0268265_11255294 | 3300028380 | Bacteria | 740 |
| 450 | Ga0268264_10004398 | 3300028381 | Bacteria | 12023 |
| 451 | Ga0268264_10541752 | 3300028381 | Bacteria | 1140 |
| 452 | Ga0268264_11360842 | 3300028381 | Bacteria | 720 |
| 453 | Ga0265318_10004551 | 3300028577 | Bacteria | 6702 |
| 454 | Ga0265338_10212015 | 3300028800 | Bacteria | 1453 |
| 455 | Ga0265330_10117223 | 3300031235 | Bacteria | 1135 |
| 456 | Ga0265332_10002198 | 3300031238 | Bacteria | 10012 |
| 457 | Ga0265328_10003085 | 3300031239 | Bacteria | 7435 |
| 458 | Ga0265320_10159888 | 3300031240 | Bacteria | 1014 |
| 459 | Ga0265325_10098849 | 3300031241 | Bacteria | 1431 |
| 460 | Ga0265325_10118444 | 3300031241 | Bacteria | 1279 |
| 461 | Ga0265340_10415926 | 3300031247 | Unclassified | 593 |
| 462 | Ga0265339_10179697 | 3300031249 | Bacteria | 1054 |
| 463 | Ga0265331_10007426 | 3300031250 | Bacteria | 6342 |
| 464 | Ga0265331_10308283 | 3300031250 | Bacteria | 709 |
| 465 | Ga0265327_10194463 | 3300031251 | Bacteria | 922 |
| 466 | Ga0265316_10028156 | 3300031344 | Bacteria | 4638 |
| 467 | Ga0307408_100055991 | 3300031548 | Bacteria | 2858 |
| 468 | Ga0307408_100663447 | 3300031548 | Bacteria | 934 |
| 469 | Ga0316575_10000646 | 3300031665 | Bacteria | 10276 |
| 470 | Ga0265314_10000335 | 3300031711 | Bacteria | 66101 |
| 471 | Ga0265342_10006633 | 3300031712 | Bacteria | 8590 |
| 472 | Ga0307413_10567800 | 3300031824 | Bacteria | 923 |
| 473 | Ga0307410_10245418 | 3300031852 | Unclassified | 1390 |
| 474 | Ga0307406_10137741 | 3300031901 | Bacteria | 1723 |
| 475 | Ga0307407_10023684 | 3300031903 | Bacteria | 3207 |
| 476 | Ga0307407_10481316 | 3300031903 | Unclassified | 906 |
| 477 | Ga0307412_11400816 | 3300031911 | Bacteria | 633 |
| 478 | Ga0307416_100394459 | 3300032002 | Bacteria | 1419 |
| 479 | Ga0307411_10269668 | 3300032005 | Bacteria | 1349 |
| 480 | Ga0316593_10223761 | 3300032168 | Bacteria | 699 |
| 481 | Ga0373938_0155007 | 3300034957 | Unclassified | 612 |
| 482 | Ga0373961_0097381 | 3300035241 | Unclassified | 948 |
| 483 | Ga0373937_0455475 | 3300036401 | Bacteria | 1215 |
| 484 | Ga0373937_0685105 | 3300036401 | Bacteria | 971 |
| 485 | Ga0316582_0442961 | 3300036647 | Bacteria | 895 |
| 486 | Ga0395900_0073722 | 3300037418 | Bacteria | 3510 |
| 487 | Ga0395900_1601182 | 3300037418 | Bacteria | 563 |
| 488 | Ga0436364_0126953 | 3300037853 | Unclassified | 581 |
| 489 | Ga0395901_0160145 | 3300038443 | Bacteria | 2364 |
| 490 | Ga0451800_0675414 | 3300041459 | Bacteria | 923 |
| 491 | Ga0451839_1174650 | 3300041496 | Unclassified | 572 |
| 492 | Ga0451851_0448351 | 3300041507 | Bacteria | 812 |
| 493 | Ga0451853_3741827 | 3300041512 | Bacteria | 1016 |
| 494 | Ga0439441_028201 | 3300042001 | Bacteria | 1075 |
| 495 | Ga0450920_089859 | 3300042122 | Bacteria | 633 |
| 496 | Ga0439460_0107505 | 3300042461 | Unclassified | 902 |
| 497 | Ga0451577_0384248 | 3300042876 | Bacteria | 1274 |
| 498 | Ga0451577_0481347 | 3300042876 | Bacteria | 1127 |
| 499 | Ga0451577_0924007 | 3300042876 | Bacteria | 785 |
| 500 | Ga0451577_1278795 | 3300042876 | Bacteria | 653 |
| 501 | Ga0451576_0139152 | 3300045051 | Bacteria | 2532 |
| 502 | Ga0451576_0664028 | 3300045051 | Bacteria | 1095 |
| 503 | Ga0451576_1445534 | 3300045051 | Bacteria | 715 |
| 504 | Ga0451576_1661116 | 3300045051 | Bacteria | 662 |
| 505 | Ga0495598_0143007 | 3300046537 | Bacteria | 829 |
| 506 | Ga0495621_0144443 | 3300046539 | Bacteria | 933 |
| 507 | Ga0495657_0471402 | 3300046675 | Bacteria | 734 |
| 508 | Ga0495658_0415820 | 3300046683 | Bacteria | 858 |
| 509 | Ga0495669_0112754 | 3300046684 | Bacteria | 1271 |
| 510 | Ga0495674_0554905 | 3300047319 | Unclassified | 914 |
| 511 | Ga0496100_0025668 | 3300048903 | Bacteria | 3605 |
| 512 | Ga0496100_0542356 | 3300048903 | Bacteria | 899 |
| 513 | Ga0496101_0785182 | 3300048904 | Bacteria | 751 |
| 514 | Ga0496102_0352229 | 3300048905 | Bacteria | 1386 |
| 515 | Ga0496102_0563425 | 3300048905 | Bacteria | 1062 |
| 516 | Ga0496103_0578646 | 3300048906 | Bacteria | 716 |
| 517 | Ga0496106_0150399 | 3300048909 | Bacteria | 1836 |
| 518 | Ga0496106_0375385 | 3300048909 | Bacteria | 1143 |
| 519 | Ga0496106_0725224 | 3300048909 | Unclassified | 791 |
| 520 | Ga0496108_0000486 | 3300048911 | Bacteria | 31881 |
| 521 | Ga0496108_0016784 | 3300048911 | Bacteria | 5981 |
| 522 | Ga0496108_0232622 | 3300048911 | Bacteria | 1603 |
| 523 | Ga0496108_0299453 | 3300048911 | Unclassified | 1401 |
| 524 | Ga0496108_0557049 | 3300048911 | Bacteria | 1000 |
| 525 | Ga0496109_0023255 | 3300048912 | Bacteria | 5498 |
| 526 | Ga0496109_0395651 | 3300048912 | Unclassified | 1305 |
| 527 | Ga0496109_0544305 | 3300048912 | Bacteria | 1095 |
| 528 | Ga0496110_0002637 | 3300048913 | Bacteria | 13510 |
| 529 | Ga0496110_0085102 | 3300048913 | Bacteria | 2823 |
| 530 | Ga0496110_0113811 | 3300048913 | Bacteria | 2434 |
| 531 | Ga0496110_0470690 | 3300048913 | Unclassified | 1145 |
| 532 | Ga0496110_0576307 | 3300048913 | Bacteria | 1022 |
| 533 | Ga0496110_0697609 | 3300048913 | Bacteria | 916 |
| 534 | Ga0496111_0022060 | 3300048914 | Bacteria | 4454 |
| 535 | Ga0496112_0085485 | 3300048915 | Bacteria | 3121 |
| 536 | Ga0496112_0783381 | 3300048915 | Bacteria | 879 |
| 537 | Ga0496112_0797736 | 3300048915 | Bacteria | 869 |
| 538 | Ga0496113_0491388 | 3300048916 | Bacteria | 986 |
| 539 | Ga0496114_0003483 | 3300048917 | Bacteria | 12084 |
| 540 | Ga0496114_0014858 | 3300048917 | Bacteria | 6257 |
| 541 | Ga0496114_0022368 | 3300048917 | Bacteria | 5152 |
| 542 | Ga0496114_0039604 | 3300048917 | Bacteria | 3900 |
| 543 | Ga0496114_0426887 | 3300048917 | Bacteria | 1174 |
| 544 | Ga0496115_0621864 | 3300048918 | Unclassified | 857 |
| 545 | Ga0501291_036186 | 3300049514 | Unclassified | 852 |
| 546 | Ga0501292_072560 | 3300049515 | Unclassified | 642 |
| 547 | Ga0501303_016378 | 3300049526 | Unclassified | 750 |
| 548 | Ga0501031_0001740 | 3300049568 | Bacteria | 13649 |
| 549 | Ga0501031_0005296 | 3300049568 | Bacteria | 8400 |
| 550 | Ga0501031_0479581 | 3300049568 | Unclassified | 803 |
| 551 | Ga0501032_0000036 | 3300049569 | Bacteria | 117044 |
| 552 | Ga0501032_0001298 | 3300049569 | Bacteria | 20031 |
| 553 | Ga0501032_0017413 | 3300049569 | Bacteria | 5046 |
| 554 | Ga0501032_0019264 | 3300049569 | Bacteria | 4775 |
| 555 | Ga0501032_0080143 | 3300049569 | Bacteria | 2173 |
| 556 | Ga0501032_0322917 | 3300049569 | Bacteria | 996 |
| 557 | Ga0501032_0456742 | 3300049569 | Bacteria | 818 |
| 558 | Ga0501033_0000119 | 3300049570 | Bacteria | 75685 |
| 559 | Ga0501033_0001013 | 3300049570 | Bacteria | 25514 |
| 560 | Ga0501033_0028983 | 3300049570 | Bacteria | 4159 |
| 561 | Ga0501033_0173379 | 3300049570 | Bacteria | 1548 |
| 562 | Ga0501033_0629440 | 3300049570 | Bacteria | 734 |
| 563 | Ga0501034_0000271 | 3300049571 | Bacteria | 93642 |
| 564 | Ga0501034_0004822 | 3300049571 | Bacteria | 14903 |
| 565 | Ga0501034_0023031 | 3300049571 | Bacteria | 6347 |
| 566 | Ga0501034_0045048 | 3300049571 | Bacteria | 4459 |
| 567 | Ga0501034_0159642 | 3300049571 | Bacteria | 2226 |
| 568 | Ga0501036_0002016 | 3300049572 | Bacteria | 15801 |
| 569 | Ga0501036_0009002 | 3300049572 | Bacteria | 8210 |
| 570 | Ga0501036_0013778 | 3300049572 | Bacteria | 6726 |
| 571 | Ga0501036_0043956 | 3300049572 | Bacteria | 3783 |
| 572 | Ga0501036_0204056 | 3300049572 | Bacteria | 1662 |
| 573 | Ga0501036_0372287 | 3300049572 | Bacteria | 1192 |
| 574 | Ga0501036_1600796 | 3300049572 | Unclassified | 526 |
| 575 | Ga0501037_0002311 | 3300049573 | Bacteria | 13768 |
| 576 | Ga0501037_0046784 | 3300049573 | Bacteria | 3172 |
| 577 | Ga0501037_0123254 | 3300049573 | Bacteria | 1862 |
| 578 | Ga0501037_0448467 | 3300049573 | Bacteria | 880 |
| 579 | Ga0501038_0003772 | 3300049574 | Bacteria | 14101 |
| 580 | Ga0501038_0003881 | 3300049574 | Bacteria | 13896 |
| 581 | Ga0501038_0004679 | 3300049574 | Bacteria | 12740 |
| 582 | Ga0501038_0008180 | 3300049574 | Bacteria | 9624 |
| 583 | Ga0501038_0035791 | 3300049574 | Bacteria | 4358 |
| 584 | Ga0501038_0040968 | 3300049574 | Bacteria | 4041 |
| 585 | Ga0501038_0121712 | 3300049574 | Bacteria | 2151 |
| 586 | Ga0501038_0276371 | 3300049574 | Bacteria | 1323 |
| 587 | Ga0501038_0361900 | 3300049574 | Bacteria | 1128 |
| 588 | Ga0501038_0399187 | 3300049574 | Bacteria | 1064 |
| 589 | Ga0501039_0047756 | 3300049575 | Bacteria | 3309 |
| 590 | Ga0501039_0090357 | 3300049575 | Bacteria | 2386 |
| 591 | Ga0501039_0111413 | 3300049575 | Bacteria | 2139 |
| 592 | Ga0501039_0114331 | 3300049575 | Bacteria | 2111 |
| 593 | Ga0501039_0545614 | 3300049575 | Bacteria | 910 |
| 594 | Ga0501040_0109705 | 3300049576 | Bacteria | 1929 |
| 595 | Ga0501040_0978782 | 3300049576 | Unclassified | 613 |
| 596 | Ga0501041_0000884 | 3300049577 | Bacteria | 16204 |
| 597 | Ga0501041_0329503 | 3300049577 | Bacteria | 964 |
| 598 | Ga0501042_0000160 | 3300049578 | Bacteria | 30676 |
| 599 | Ga0501042_0012578 | 3300049578 | Bacteria | 5737 |
| 600 | Ga0501043_0001217 | 3300049579 | Bacteria | 22685 |
| 601 | Ga0501043_0002370 | 3300049579 | Bacteria | 15941 |
| 602 | Ga0501043_0027284 | 3300049579 | Bacteria | 4484 |
| 603 | Ga0501043_0192960 | 3300049579 | Bacteria | 1583 |
| 604 | Ga0501043_0278837 | 3300049579 | Bacteria | 1282 |
| 605 | Ga0501043_0312381 | 3300049579 | Bacteria | 1199 |
| 606 | Ga0501043_0393494 | 3300049579 | Bacteria | 1048 |
| 607 | Ga0501046_0001638 | 3300049580 | Bacteria | 21434 |
| 608 | Ga0501046_0013430 | 3300049580 | Bacteria | 6933 |
| 609 | Ga0501046_0102797 | 3300049580 | Bacteria | 2191 |
| 610 | Ga0501046_0153360 | 3300049580 | Bacteria | 1737 |
| 611 | Ga0501047_0001434 | 3300049581 | Bacteria | 23400 |
| 612 | Ga0501048_0018606 | 3300049582 | Bacteria | 5107 |
| 613 | Ga0501048_0053128 | 3300049582 | Bacteria | 2882 |
| 614 | Ga0501068_0001085 | 3300049584 | Bacteria | 14415 |
| 615 | Ga0501068_0003260 | 3300049584 | Bacteria | 8702 |
| 616 | Ga0501069_0004756 | 3300049585 | Bacteria | 7025 |
| 617 | Ga0501070_0007076 | 3300049586 | Bacteria | 9541 |
| 618 | Ga0501070_0096236 | 3300049586 | Unclassified | 2449 |
| 619 | Ga0501070_0178475 | 3300049586 | Unclassified | 1748 |
| 620 | Ga0501070_0387582 | 3300049586 | Bacteria | 1131 |
| 621 | Ga0501071_0004045 | 3300049587 | Bacteria | 9266 |
| 622 | Ga0501071_0032387 | 3300049587 | Bacteria | 3712 |
| 623 | Ga0501071_0118205 | 3300049587 | Bacteria | 1964 |
| 624 | Ga0501071_0376774 | 3300049587 | Bacteria | 1082 |
| 625 | Ga0501072_0001879 | 3300049588 | Bacteria | 15634 |
| 626 | Ga0501072_0023582 | 3300049588 | Bacteria | 4779 |
| 627 | Ga0501072_0039012 | 3300049588 | Bacteria | 3729 |
| 628 | Ga0501073_0064876 | 3300049589 | Bacteria | 2546 |
| 629 | Ga0501073_0227933 | 3300049589 | Bacteria | 1287 |
| 630 | Ga0501074_0051996 | 3300049590 | Bacteria | 2957 |
| 631 | Ga0501074_0110609 | 3300049590 | Bacteria | 1966 |
| 632 | Ga0501074_0984873 | 3300049590 | Bacteria | 593 |
| 633 | Ga0501074_1062785 | 3300049590 | Bacteria | 569 |
| 634 | Ga0501075_0000323 | 3300049591 | Bacteria | 26840 |
| 635 | Ga0501075_0013386 | 3300049591 | Bacteria | 5855 |
| 636 | Ga0501075_0617403 | 3300049591 | Bacteria | 827 |
| 637 | Ga0501075_0711578 | 3300049591 | Bacteria | 765 |
| 638 | Ga0501076_0002782 | 3300049592 | Bacteria | 12115 |
| 639 | Ga0501076_0010748 | 3300049592 | Bacteria | 6806 |
| 640 | Ga0501076_1487784 | 3300049592 | Unclassified | 556 |
| 641 | Ga0501077_0160270 | 3300049593 | Bacteria | 1428 |
| 642 | Ga0501077_0176033 | 3300049593 | Bacteria | 1359 |
| 643 | Ga0501079_0001098 | 3300049741 | Bacteria | 18809 |
| 644 | Ga0501079_0076947 | 3300049741 | Bacteria | 2581 |
| 645 | Ga0501079_0704951 | 3300049741 | Bacteria | 794 |
| 646 | Ga0501080_0009212 | 3300049742 | Bacteria | 8996 |
| 647 | Ga0501080_0020812 | 3300049742 | Bacteria | 6073 |
| 648 | Ga0501080_0025182 | 3300049742 | Bacteria | 5522 |
| 649 | Ga0501080_0319408 | 3300049742 | Unclassified | 1406 |
| 650 | Ga0501081_0006454 | 3300049743 | Bacteria | 7611 |
| 651 | Ga0501081_0152614 | 3300049743 | Bacteria | 1660 |
| 652 | Ga0501081_0225830 | 3300049743 | Bacteria | 1363 |
| 653 | Ga0501083_0097663 | 3300049744 | Bacteria | 1938 |
| 654 | Ga0501083_0116386 | 3300049744 | Bacteria | 1755 |
| 655 | Ga0501283_011376 | 3300049779 | Bacteria | 1323 |
| 656 | Ga0501035_0000803 | 3300049822 | Bacteria | 33453 |
| 657 | Ga0501035_0018898 | 3300049822 | Bacteria | 6350 |
| 658 | Ga0501035_0031131 | 3300049822 | Bacteria | 4859 |
| 659 | Ga0501035_0032552 | 3300049822 | Bacteria | 4742 |
| 660 | Ga0501035_0251116 | 3300049822 | Bacteria | 1502 |
| 661 | Ga0501035_0303103 | 3300049822 | Bacteria | 1346 |
| 662 | Ga0501035_0756416 | 3300049822 | Unclassified | 779 |
| 663 | Ga0501044_0000093 | 3300049823 | Bacteria | 109832 |
| 664 | Ga0501044_0000891 | 3300049823 | Bacteria | 36042 |
| 665 | Ga0501044_0054489 | 3300049823 | Bacteria | 4110 |
| 666 | Ga0501044_0117949 | 3300049823 | Bacteria | 2657 |
| 667 | Ga0501044_0180241 | 3300049823 | Bacteria | 2080 |
| 668 | Ga0501045_0003332 | 3300049824 | Bacteria | 10988 |
| 669 | Ga0501045_0006518 | 3300049824 | Bacteria | 8092 |
| 670 | Ga0501045_0027468 | 3300049824 | Bacteria | 4101 |
| 671 | Ga0501045_0148804 | 3300049824 | Bacteria | 1742 |
| 672 | nmdc:mga00v17_774946_c1 | 3300050491 | Bacteria | 612 |
| 673 | nmdc:mga09592_11799_c1 | 3300050508 | Bacteria | 6378 |
| 674 | nmdc:mga0qj67_450516_c1 | 3300050509 | Bacteria | 1037 |
| 675 | nmdc:mga06r32_20793_c1 | 3300050510 | Bacteria | 6047 |
| 676 | nmdc:mga06r32_938760_c1 | 3300050510 | Unclassified | 820 |
| 677 | nmdc:mga08y16_1182252_c1 | 3300050511 | Bacteria | 736 |
| 678 | nmdc:mga08y16_165794_c1 | 3300050511 | Bacteria | 2295 |
| 679 | nmdc:mga08y16_201860_c1 | 3300050511 | Bacteria | 2060 |
| 680 | nmdc:mga08y16_20638_c1 | 3300050511 | Bacteria | 6953 |
| 681 | nmdc:mga08y16_294486_c1 | 3300050511 | Bacteria | 1673 |
| 682 | nmdc:mga08y16_57622_c1 | 3300050511 | Bacteria | 4059 |
| 683 | nmdc:mga0n895_1379198_c1 | 3300050512 | Bacteria | 674 |
| 684 | nmdc:mga0n895_1757049_c1 | 3300050512 | Bacteria | 582 |
| 685 | nmdc:mga0n895_85304_c1 | 3300050512 | Bacteria | 3152 |
| 686 | nmdc:mga0rr50_756637_c1 | 3300050513 | Bacteria | 829 |
| 687 | nmdc:mga08x19_320660_c1 | 3300050514 | Unclassified | 1078 |
| 688 | nmdc:mga0a205_196585_c1 | 3300050515 | Bacteria | 1907 |
| 689 | Ga0501084_0002787 | 3300054114 | Bacteria | 14106 |
| 690 | Ga0501084_0301899 | 3300054114 | Bacteria | 1352 |
| 691 | Ga0501082_0015215 | 3300060353 | Bacteria | 6629 |
| 692 | Ga0530510_0001359 | 3300061734 | Bacteria | 16344 |
| 693 | Ga0530510_0220556 | 3300061734 | Bacteria | 1409 |
| 694 | Ga0530510_0626931 | 3300061734 | Bacteria | 818 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031250 | Ga0265331_10308283 | Ga0265331_103082832 | 134 |
| 2 | 3300049593 | Ga0501077_0176033 | Ga0501077_0176033_19_432 | 135 |
| 3 | 3300005340 | Ga0070689_101490005 | Ga0070689_1014900052 | 145 |
| 4 | 3300005466 | Ga0070685_10124928 | Ga0070685_101249283 | 145 |
| 5 | 3300005844 | Ga0068862_101093861 | Ga0068862_1010938612 | 145 |
| 6 | 3300006237 | Ga0097621_100313607 | Ga0097621_1003136073 | 145 |
| 7 | 3300013306 | Ga0163162_12848258 | Ga0163162_128482582 | 145 |
| 8 | 3300014326 | Ga0157380_10335209 | Ga0157380_103352092 | 145 |
| 9 | 3300014969 | Ga0157376_10548038 | Ga0157376_105480382 | 145 |
| 10 | 3300026118 | Ga0207675_100906473 | Ga0207675_1009064732 | 145 |
| 11 | 3300025933 | Ga0207706_10152175 | Ga0207706_101521753 | 146 |
| 12 | 3300042122 | Ga0450920_089859 | Ga0450920_089859_60_572 | 147 |
| 13 | 3300049571 | Ga0501034_0023031 | Ga0501034_0023031_116_559 | 147 |
| 14 | 3300049574 | Ga0501038_0003772 | Ga0501038_0003772_7563_8045 | 147 |
| 15 | 3300005343 | Ga0070687_100573961 | Ga0070687_1005739611 | 148 |
| 16 | 3300005355 | Ga0070671_100050216 | Ga0070671_1000502163 | 148 |
| 17 | 3300005439 | Ga0070711_101545011 | Ga0070711_1015450111 | 148 |
| 18 | 3300005615 | Ga0070702_100304206 | Ga0070702_1003042062 | 148 |
| 19 | 3300005841 | Ga0068863_100415522 | Ga0068863_1004155222 | 148 |
| 20 | 3300005985 | Ga0081539_10129038 | Ga0081539_101290381 | 148 |
| 21 | 3300006847 | Ga0075431_100703394 | Ga0075431_1007033941 | 148 |
| 22 | 3300025931 | Ga0207644_10001827 | Ga0207644_100018273 | 148 |
| 23 | 3300042876 | Ga0451577_0924007 | Ga0451577_0924007_321_773 | 148 |
| 24 | 3300049590 | Ga0501074_1062785 | Ga0501074_1062785_12_473 | 148 |
| 25 | 3300050510 | nmdc:mga06r32_938760_c1 | nmdc:mga06r32_938760_c1_341_790 | 148 |
| 26 | 3300005340 | Ga0070689_100801509 | Ga0070689_1008015091 | 149 |
| 27 | 3300009148 | Ga0105243_11484059 | Ga0105243_114840592 | 149 |
| 28 | 3300031241 | Ga0265325_10098849 | Ga0265325_100988492 | 149 |
| 29 | 3300031251 | Ga0265327_10194463 | Ga0265327_101944632 | 149 |
| 30 | 3300045051 | Ga0451576_1661116 | Ga0451576_1661116_22_471 | 149 |
| 31 | 3300005340 | Ga0070689_100010875 | Ga0070689_1000108754 | 150 |
| 32 | 3300005467 | Ga0070706_100243303 | Ga0070706_1002433032 | 150 |
| 33 | 3300005618 | Ga0068864_102437372 | Ga0068864_1024373721 | 150 |
| 34 | 3300005841 | Ga0068863_100052247 | Ga0068863_1000522472 | 150 |
| 35 | 3300006173 | Ga0070716_100241005 | Ga0070716_1002410052 | 150 |
| 36 | 3300006871 | Ga0075434_100388254 | Ga0075434_1003882542 | 150 |
| 37 | 3300006914 | Ga0075436_100625478 | Ga0075436_1006254781 | 150 |
| 38 | 3300009094 | Ga0111539_10166798 | Ga0111539_101667982 | 150 |
| 39 | 3300025910 | Ga0207684_10713590 | Ga0207684_107135903 | 150 |
| 40 | 3300025922 | Ga0207646_11047749 | Ga0207646_110477491 | 150 |
| 41 | 3300025936 | Ga0207670_10041057 | Ga0207670_100410572 | 150 |
| 42 | 3300025939 | Ga0207665_10290852 | Ga0207665_102908522 | 150 |
| 43 | 3300026088 | Ga0207641_10574605 | Ga0207641_105746052 | 150 |
| 44 | 3300031247 | Ga0265340_10415926 | Ga0265340_104159262 | 150 |
| 45 | 3300045051 | Ga0451576_0139152 | Ga0451576_0139152_73_531 | 150 |
| 46 | 3300045051 | Ga0451576_1445534 | Ga0451576_1445534_155_613 | 150 |
| 47 | 3300047319 | Ga0495674_0554905 | Ga0495674_0554905_33_491 | 150 |
| 48 | 3300050511 | nmdc:mga08y16_294486_c1 | nmdc:mga08y16_294486_c1_1132_1590 | 150 |
| 49 | 3300050512 | nmdc:mga0n895_1379198_c1 | nmdc:mga0n895_1379198_c1_145_603 | 150 |
| 50 | 3300050514 | nmdc:mga08x19_320660_c1 | nmdc:mga08x19_320660_c1_186_644 | 150 |
| 51 | 3300005328 | Ga0070676_10450267 | Ga0070676_104502672 | 156 |
| 52 | 3300005330 | Ga0070690_100029641 | Ga0070690_1000296413 | 156 |
| 53 | 3300005334 | Ga0068869_100003052 | Ga0068869_1000030522 | 156 |
| 54 | 3300005336 | Ga0070680_100050071 | Ga0070680_1000500713 | 156 |
| 55 | 3300005338 | Ga0068868_100157105 | Ga0068868_1001571054 | 156 |
| 56 | 3300005338 | Ga0068868_100455482 | Ga0068868_1004554822 | 156 |
| 57 | 3300005340 | Ga0070689_100002386 | Ga0070689_1000023867 | 156 |
| 58 | 3300005341 | Ga0070691_10008905 | Ga0070691_100089052 | 156 |
| 59 | 3300005345 | Ga0070692_10026458 | Ga0070692_100264582 | 156 |
| 60 | 3300005347 | Ga0070668_100833327 | Ga0070668_1008333272 | 156 |
| 61 | 3300005366 | Ga0070659_100202170 | Ga0070659_1002021702 | 156 |
| 62 | 3300005435 | Ga0070714_100107982 | Ga0070714_1001079823 | 156 |
| 63 | 3300005438 | Ga0070701_10000068 | Ga0070701_100000687 | 156 |
| 64 | 3300005441 | Ga0070700_100031382 | Ga0070700_1000313822 | 156 |
| 65 | 3300005441 | Ga0070700_100406901 | Ga0070700_1004069012 | 156 |
| 66 | 3300005441 | Ga0070700_101008062 | Ga0070700_1010080621 | 156 |
| 67 | 3300005444 | Ga0070694_100162003 | Ga0070694_1001620031 | 156 |
| 68 | 3300005455 | Ga0070663_100086998 | Ga0070663_1000869983 | 156 |
| 69 | 3300005457 | Ga0070662_100217514 | Ga0070662_1002175142 | 156 |
| 70 | 3300005458 | Ga0070681_10156805 | Ga0070681_101568053 | 156 |
| 71 | 3300005459 | Ga0068867_100007256 | Ga0068867_1000072565 | 156 |
| 72 | 3300005466 | Ga0070685_10699909 | Ga0070685_106999092 | 156 |
| 73 | 3300005530 | Ga0070679_100074056 | Ga0070679_1000740564 | 156 |
| 74 | 3300005530 | Ga0070679_100643568 | Ga0070679_1006435681 | 156 |
| 75 | 3300005539 | Ga0068853_100538909 | Ga0068853_1005389092 | 156 |
| 76 | 3300005544 | Ga0070686_100001003 | Ga0070686_10000100313 | 156 |
| 77 | 3300005545 | Ga0070695_100022132 | Ga0070695_1000221322 | 156 |
| 78 | 3300005545 | Ga0070695_100139908 | Ga0070695_1001399082 | 156 |
| 79 | 3300005546 | Ga0070696_100020029 | Ga0070696_1000200295 | 156 |
| 80 | 3300005547 | Ga0070693_100136915 | Ga0070693_1001369152 | 156 |
| 81 | 3300005549 | Ga0070704_100008155 | Ga0070704_1000081556 | 156 |
| 82 | 3300005614 | Ga0068856_100931596 | Ga0068856_1009315962 | 156 |
| 83 | 3300005615 | Ga0070702_100000040 | Ga0070702_1000000402 | 156 |
| 84 | 3300005617 | Ga0068859_100031545 | Ga0068859_1000315454 | 156 |
| 85 | 3300005718 | Ga0068866_10001473 | Ga0068866_100014732 | 156 |
| 86 | 3300005719 | Ga0068861_100000658 | Ga0068861_10000065815 | 156 |
| 87 | 3300005840 | Ga0068870_10003999 | Ga0068870_100039996 | 156 |
| 88 | 3300005842 | Ga0068858_100003367 | Ga0068858_1000033676 | 156 |
| 89 | 3300005843 | Ga0068860_100079128 | Ga0068860_1000791283 | 156 |
| 90 | 3300006237 | Ga0097621_100003464 | Ga0097621_1000034649 | 156 |
| 91 | 3300006358 | Ga0068871_100043321 | Ga0068871_1000433214 | 156 |
| 92 | 3300006852 | Ga0075433_11205073 | Ga0075433_112050731 | 156 |
| 93 | 3300006881 | Ga0068865_100000529 | Ga0068865_10000052914 | 156 |
| 94 | 3300006931 | Ga0097620_100031545 | Ga0097620_1000315454 | 156 |
| 95 | 3300009094 | Ga0111539_10008285 | Ga0111539_1000828510 | 156 |
| 96 | 3300009094 | Ga0111539_10427340 | Ga0111539_104273402 | 156 |
| 97 | 3300009094 | Ga0111539_11367727 | Ga0111539_113677271 | 156 |
| 98 | 3300009098 | Ga0105245_10001373 | Ga0105245_100013738 | 156 |
| 99 | 3300009148 | Ga0105243_10000265 | Ga0105243_1000026550 | 156 |
| 100 | 3300009176 | Ga0105242_10004037 | Ga0105242_100040373 | 156 |
| 101 | 3300009177 | Ga0105248_10347775 | Ga0105248_103477752 | 156 |
| 102 | 3300009551 | Ga0105238_10319870 | Ga0105238_103198702 | 156 |
| 103 | 3300009553 | Ga0105249_10258074 | Ga0105249_102580742 | 156 |
| 104 | 3300011119 | Ga0105246_10431656 | Ga0105246_104316562 | 156 |
| 105 | 3300013104 | Ga0157370_10022519 | Ga0157370_100225192 | 156 |
| 106 | 3300013297 | Ga0157378_10000478 | Ga0157378_100004783 | 156 |
| 107 | 3300013306 | Ga0163162_10099349 | Ga0163162_100993495 | 156 |
| 108 | 3300013307 | Ga0157372_10413726 | Ga0157372_104137262 | 156 |
| 109 | 3300013307 | Ga0157372_10704470 | Ga0157372_107044702 | 156 |
| 110 | 3300014326 | Ga0157380_10040803 | Ga0157380_100408033 | 156 |
| 111 | 3300014968 | Ga0157379_10035557 | Ga0157379_100355573 | 156 |
| 112 | 3300014969 | Ga0157376_10055715 | Ga0157376_100557153 | 156 |
| 113 | 3300014969 | Ga0157376_10318810 | Ga0157376_103188101 | 156 |
| 114 | 3300017792 | Ga0163161_10560497 | Ga0163161_105604972 | 156 |
| 115 | 3300025899 | Ga0207642_10001377 | Ga0207642_100013772 | 156 |
| 116 | 3300025908 | Ga0207643_10086755 | Ga0207643_100867552 | 156 |
| 117 | 3300025919 | Ga0207657_10118627 | Ga0207657_101186272 | 156 |
| 118 | 3300025921 | Ga0207652_10428048 | Ga0207652_104280482 | 156 |
| 119 | 3300025927 | Ga0207687_10001592 | Ga0207687_1000159215 | 156 |
| 120 | 3300025929 | Ga0207664_11218103 | Ga0207664_112181031 | 156 |
| 121 | 3300025932 | Ga0207690_10054275 | Ga0207690_100542752 | 156 |
| 122 | 3300025933 | Ga0207706_10153386 | Ga0207706_101533862 | 156 |
| 123 | 3300025933 | Ga0207706_10353465 | Ga0207706_103534652 | 156 |
| 124 | 3300025934 | Ga0207686_10000731 | Ga0207686_100007317 | 156 |
| 125 | 3300025935 | Ga0207709_10007485 | Ga0207709_100074853 | 156 |
| 126 | 3300025936 | Ga0207670_10017647 | Ga0207670_100176472 | 156 |
| 127 | 3300025938 | Ga0207704_10005518 | Ga0207704_100055182 | 156 |
| 128 | 3300025941 | Ga0207711_10259755 | Ga0207711_102597553 | 156 |
| 129 | 3300025961 | Ga0207712_10599567 | Ga0207712_105995672 | 156 |
| 130 | 3300026023 | Ga0207677_10479944 | Ga0207677_104799442 | 156 |
| 131 | 3300026035 | Ga0207703_10010025 | Ga0207703_100100257 | 156 |
| 132 | 3300026075 | Ga0207708_10000129 | Ga0207708_1000012923 | 156 |
| 133 | 3300026075 | Ga0207708_10474039 | Ga0207708_104740392 | 156 |
| 134 | 3300026078 | Ga0207702_10204760 | Ga0207702_102047602 | 156 |
| 135 | 3300026089 | Ga0207648_10000832 | Ga0207648_1000083228 | 156 |
| 136 | 3300026118 | Ga0207675_100003765 | Ga0207675_1000037652 | 156 |
| 137 | 3300026121 | Ga0207683_10017181 | Ga0207683_100171812 | 156 |
| 138 | 3300027907 | Ga0207428_10049937 | Ga0207428_100499372 | 156 |
| 139 | 3300028380 | Ga0268265_10452507 | Ga0268265_104525072 | 156 |
| 140 | 3300028381 | Ga0268264_10004398 | Ga0268264_100043983 | 156 |
| 141 | 3300037418 | Ga0395900_0073722 | Ga0395900_0073722_447_929 | 156 |
| 142 | 3300037418 | Ga0395900_1601182 | Ga0395900_1601182_33_515 | 156 |
| 143 | 3300038443 | Ga0395901_0160145 | Ga0395901_0160145_810_1292 | 156 |
| 144 | 3300048903 | Ga0496100_0542356 | Ga0496100_0542356_247_729 | 156 |
| 145 | 3300048909 | Ga0496106_0375385 | Ga0496106_0375385_573_1055 | 156 |
| 146 | 3300048909 | Ga0496106_0725224 | Ga0496106_0725224_57_539 | 156 |
| 147 | 3300048911 | Ga0496108_0016784 | Ga0496108_0016784_4112_4594 | 156 |
| 148 | 3300048911 | Ga0496108_0557049 | Ga0496108_0557049_67_549 | 156 |
| 149 | 3300048912 | Ga0496109_0395651 | Ga0496109_0395651_698_1180 | 156 |
| 150 | 3300048912 | Ga0496109_0544305 | Ga0496109_0544305_291_773 | 156 |
| 151 | 3300048913 | Ga0496110_0085102 | Ga0496110_0085102_1347_1829 | 156 |
| 152 | 3300048915 | Ga0496112_0085485 | Ga0496112_0085485_2005_2487 | 156 |
| 153 | 3300048917 | Ga0496114_0003483 | Ga0496114_0003483_7449_7931 | 156 |
| 154 | 3300048917 | Ga0496114_0022368 | Ga0496114_0022368_806_1288 | 156 |
| 155 | 3300048918 | Ga0496115_0621864 | Ga0496115_0621864_178_660 | 156 |
| 156 | 3300049568 | Ga0501031_0001740 | Ga0501031_0001740_8897_9439 | 156 |
| 157 | 3300049568 | Ga0501031_0005296 | Ga0501031_0005296_5843_6325 | 156 |
| 158 | 3300049568 | Ga0501031_0479581 | Ga0501031_0479581_17_499 | 156 |
| 159 | 3300049569 | Ga0501032_0000036 | Ga0501032_0000036_16734_17276 | 156 |
| 160 | 3300049569 | Ga0501032_0001298 | Ga0501032_0001298_11687_12175 | 156 |
| 161 | 3300049569 | Ga0501032_0017413 | Ga0501032_0017413_3078_3560 | 156 |
| 162 | 3300049569 | Ga0501032_0019264 | Ga0501032_0019264_2394_2876 | 156 |
| 163 | 3300049569 | Ga0501032_0080143 | Ga0501032_0080143_466_1011 | 156 |
| 164 | 3300049570 | Ga0501033_0000119 | Ga0501033_0000119_18984_19466 | 156 |
| 165 | 3300049570 | Ga0501033_0001013 | Ga0501033_0001013_5139_5621 | 156 |
| 166 | 3300049570 | Ga0501033_0028983 | Ga0501033_0028983_1791_2333 | 156 |
| 167 | 3300049570 | Ga0501033_0629440 | Ga0501033_0629440_52_534 | 156 |
| 168 | 3300049571 | Ga0501034_0004822 | Ga0501034_0004822_5337_5879 | 156 |
| 169 | 3300049571 | Ga0501034_0159642 | Ga0501034_0159642_524_1006 | 156 |
| 170 | 3300049572 | Ga0501036_0002016 | Ga0501036_0002016_13246_13788 | 156 |
| 171 | 3300049572 | Ga0501036_0009002 | Ga0501036_0009002_5741_6223 | 156 |
| 172 | 3300049572 | Ga0501036_0204056 | Ga0501036_0204056_630_1112 | 156 |
| 173 | 3300049572 | Ga0501036_0372287 | Ga0501036_0372287_304_786 | 156 |
| 174 | 3300049573 | Ga0501037_0002311 | Ga0501037_0002311_11623_12165 | 156 |
| 175 | 3300049573 | Ga0501037_0123254 | Ga0501037_0123254_1218_1700 | 156 |
| 176 | 3300049574 | Ga0501038_0003881 | Ga0501038_0003881_11751_12293 | 156 |
| 177 | 3300049574 | Ga0501038_0004679 | Ga0501038_0004679_8656_9138 | 156 |
| 178 | 3300049574 | Ga0501038_0008180 | Ga0501038_0008180_5687_6229 | 156 |
| 179 | 3300049574 | Ga0501038_0035791 | Ga0501038_0035791_89_634 | 156 |
| 180 | 3300049574 | Ga0501038_0040968 | Ga0501038_0040968_2799_3281 | 156 |
| 181 | 3300049574 | Ga0501038_0361900 | Ga0501038_0361900_46_528 | 156 |
| 182 | 3300049574 | Ga0501038_0399187 | Ga0501038_0399187_368_850 | 156 |
| 183 | 3300049575 | Ga0501039_0047756 | Ga0501039_0047756_1417_1899 | 156 |
| 184 | 3300049575 | Ga0501039_0090357 | Ga0501039_0090357_1625_2107 | 156 |
| 185 | 3300049575 | Ga0501039_0114331 | Ga0501039_0114331_1076_1558 | 156 |
| 186 | 3300049575 | Ga0501039_0545614 | Ga0501039_0545614_153_632 | 156 |
| 187 | 3300049577 | Ga0501041_0329503 | Ga0501041_0329503_335_817 | 156 |
| 188 | 3300049578 | Ga0501042_0000160 | Ga0501042_0000160_11999_12541 | 156 |
| 189 | 3300049579 | Ga0501043_0001217 | Ga0501043_0001217_17662_18204 | 156 |
| 190 | 3300049579 | Ga0501043_0002370 | Ga0501043_0002370_3702_4247 | 156 |
| 191 | 3300049579 | Ga0501043_0027284 | Ga0501043_0027284_3485_3967 | 156 |
| 192 | 3300049579 | Ga0501043_0192960 | Ga0501043_0192960_83_565 | 156 |
| 193 | 3300049579 | Ga0501043_0312381 | Ga0501043_0312381_52_534 | 156 |
| 194 | 3300049580 | Ga0501046_0001638 | Ga0501046_0001638_348_890 | 156 |
| 195 | 3300049580 | Ga0501046_0013430 | Ga0501046_0013430_2627_3109 | 156 |
| 196 | 3300049581 | Ga0501047_0001434 | Ga0501047_0001434_14154_14696 | 156 |
| 197 | 3300049582 | Ga0501048_0053128 | Ga0501048_0053128_1620_2162 | 156 |
| 198 | 3300049584 | Ga0501068_0001085 | Ga0501068_0001085_6124_6666 | 156 |
| 199 | 3300049586 | Ga0501070_0178475 | Ga0501070_0178475_893_1375 | 156 |
| 200 | 3300049742 | Ga0501080_0319408 | Ga0501080_0319408_181_723 | 156 |
| 201 | 3300049822 | Ga0501035_0000803 | Ga0501035_0000803_10576_11058 | 156 |
| 202 | 3300049822 | Ga0501035_0018898 | Ga0501035_0018898_5769_6311 | 156 |
| 203 | 3300049822 | Ga0501035_0031131 | Ga0501035_0031131_1547_2089 | 156 |
| 204 | 3300049822 | Ga0501035_0032552 | Ga0501035_0032552_361_906 | 156 |
| 205 | 3300049822 | Ga0501035_0251116 | Ga0501035_0251116_480_962 | 156 |
| 206 | 3300049822 | Ga0501035_0303103 | Ga0501035_0303103_430_912 | 156 |
| 207 | 3300049822 | Ga0501035_0756416 | Ga0501035_0756416_176_667 | 156 |
| 208 | 3300049823 | Ga0501044_0000093 | Ga0501044_0000093_94224_94706 | 156 |
| 209 | 3300049823 | Ga0501044_0000891 | Ga0501044_0000891_25227_25769 | 156 |
| 210 | 3300049823 | Ga0501044_0054489 | Ga0501044_0054489_236_718 | 156 |
| 211 | 3300049823 | Ga0501044_0117949 | Ga0501044_0117949_1080_1562 | 156 |
| 212 | 3300049824 | Ga0501045_0003332 | Ga0501045_0003332_7882_8424 | 156 |
| 213 | 3300049824 | Ga0501045_0148804 | Ga0501045_0148804_1152_1634 | 156 |
| 214 | 3300050511 | nmdc:mga08y16_1182252_c1 | nmdc:mga08y16_1182252_c1_120_608 | 156 |
| 215 | 3300050511 | nmdc:mga08y16_20638_c1 | nmdc:mga08y16_20638_c1_4720_5202 | 156 |
| 216 | 3300050511 | nmdc:mga08y16_57622_c1 | nmdc:mga08y16_57622_c1_3362_3844 | 156 |
| 217 | 3300050513 | nmdc:mga0rr50_756637_c1 | nmdc:mga0rr50_756637_c1_245_733 | 156 |
| 218 | 3300005328 | Ga0070676_10055704 | Ga0070676_100557045 | 157 |
| 219 | 3300005328 | Ga0070676_10294364 | Ga0070676_102943642 | 157 |
| 220 | 3300005328 | Ga0070676_10641477 | Ga0070676_106414772 | 157 |
| 221 | 3300005330 | Ga0070690_100270012 | Ga0070690_1002700122 | 157 |
| 222 | 3300005330 | Ga0070690_100294952 | Ga0070690_1002949522 | 157 |
| 223 | 3300005331 | Ga0070670_100250503 | Ga0070670_1002505032 | 157 |
| 224 | 3300005331 | Ga0070670_100410736 | Ga0070670_1004107362 | 157 |
| 225 | 3300005334 | Ga0068869_100001424 | Ga0068869_10000142411 | 157 |
| 226 | 3300005336 | Ga0070680_100174528 | Ga0070680_1001745282 | 157 |
| 227 | 3300005336 | Ga0070680_100194408 | Ga0070680_1001944081 | 157 |
| 228 | 3300005338 | Ga0068868_100607902 | Ga0068868_1006079022 | 157 |
| 229 | 3300005338 | Ga0068868_100670593 | Ga0068868_1006705932 | 157 |
| 230 | 3300005340 | Ga0070689_100181147 | Ga0070689_1001811471 | 157 |
| 231 | 3300005343 | Ga0070687_100134323 | Ga0070687_1001343232 | 157 |
| 232 | 3300005354 | Ga0070675_100038641 | Ga0070675_1000386414 | 157 |
| 233 | 3300005354 | Ga0070675_100948594 | Ga0070675_1009485942 | 157 |
| 234 | 3300005355 | Ga0070671_100179419 | Ga0070671_1001794194 | 157 |
| 235 | 3300005355 | Ga0070671_100510316 | Ga0070671_1005103162 | 157 |
| 236 | 3300005356 | Ga0070674_100317034 | Ga0070674_1003170342 | 157 |
| 237 | 3300005356 | Ga0070674_100400569 | Ga0070674_1004005692 | 157 |
| 238 | 3300005356 | Ga0070674_101266174 | Ga0070674_1012661742 | 157 |
| 239 | 3300005364 | Ga0070673_100103225 | Ga0070673_1001032252 | 157 |
| 240 | 3300005364 | Ga0070673_100351521 | Ga0070673_1003515212 | 157 |
| 241 | 3300005366 | Ga0070659_100322272 | Ga0070659_1003222722 | 157 |
| 242 | 3300005366 | Ga0070659_100682621 | Ga0070659_1006826211 | 157 |
| 243 | 3300005438 | Ga0070701_10560760 | Ga0070701_105607602 | 157 |
| 244 | 3300005440 | Ga0070705_101112233 | Ga0070705_1011122332 | 157 |
| 245 | 3300005441 | Ga0070700_100116393 | Ga0070700_1001163932 | 157 |
| 246 | 3300005444 | Ga0070694_100827664 | Ga0070694_1008276641 | 157 |
| 247 | 3300005445 | Ga0070708_100179911 | Ga0070708_1001799112 | 157 |
| 248 | 3300005456 | Ga0070678_100285819 | Ga0070678_1002858191 | 157 |
| 249 | 3300005456 | Ga0070678_100735693 | Ga0070678_1007356932 | 157 |
| 250 | 3300005456 | Ga0070678_100898497 | Ga0070678_1008984971 | 157 |
| 251 | 3300005458 | Ga0070681_10006242 | Ga0070681_100062423 | 157 |
| 252 | 3300005459 | Ga0068867_100037411 | Ga0068867_1000374111 | 157 |
| 253 | 3300005459 | Ga0068867_100244875 | Ga0068867_1002448752 | 157 |
| 254 | 3300005459 | Ga0068867_100337932 | Ga0068867_1003379322 | 157 |
| 255 | 3300005467 | Ga0070706_100546416 | Ga0070706_1005464162 | 157 |
| 256 | 3300005530 | Ga0070679_100115854 | Ga0070679_1001158543 | 157 |
| 257 | 3300005536 | Ga0070697_100185705 | Ga0070697_1001857052 | 157 |
| 258 | 3300005545 | Ga0070695_100144101 | Ga0070695_1001441012 | 157 |
| 259 | 3300005545 | Ga0070695_100853416 | Ga0070695_1008534162 | 157 |
| 260 | 3300005546 | Ga0070696_100412136 | Ga0070696_1004121362 | 157 |
| 261 | 3300005547 | Ga0070693_100058698 | Ga0070693_1000586982 | 157 |
| 262 | 3300005548 | Ga0070665_100445654 | Ga0070665_1004456542 | 157 |
| 263 | 3300005549 | Ga0070704_100560737 | Ga0070704_1005607371 | 157 |
| 264 | 3300005549 | Ga0070704_100986298 | Ga0070704_1009862982 | 157 |
| 265 | 3300005563 | Ga0068855_100017462 | Ga0068855_1000174627 | 157 |
| 266 | 3300005564 | Ga0070664_100412362 | Ga0070664_1004123622 | 157 |
| 267 | 3300005578 | Ga0068854_100349887 | Ga0068854_1003498872 | 157 |
| 268 | 3300005614 | Ga0068856_100541867 | Ga0068856_1005418672 | 157 |
| 269 | 3300005615 | Ga0070702_100234032 | Ga0070702_1002340321 | 157 |
| 270 | 3300005615 | Ga0070702_100333716 | Ga0070702_1003337161 | 157 |
| 271 | 3300005617 | Ga0068859_100042159 | Ga0068859_1000421592 | 157 |
| 272 | 3300005617 | Ga0068859_100084377 | Ga0068859_1000843774 | 157 |
| 273 | 3300005618 | Ga0068864_100164332 | Ga0068864_1001643321 | 157 |
| 274 | 3300005618 | Ga0068864_100214637 | Ga0068864_1002146372 | 157 |
| 275 | 3300005719 | Ga0068861_100174398 | Ga0068861_1001743982 | 157 |
| 276 | 3300005841 | Ga0068863_100408415 | Ga0068863_1004084152 | 157 |
| 277 | 3300005842 | Ga0068858_100241941 | Ga0068858_1002419412 | 157 |
| 278 | 3300005842 | Ga0068858_100329800 | Ga0068858_1003298002 | 157 |
| 279 | 3300005842 | Ga0068858_100585653 | Ga0068858_1005856532 | 157 |
| 280 | 3300005843 | Ga0068860_100092581 | Ga0068860_1000925812 | 157 |
| 281 | 3300005843 | Ga0068860_100808146 | Ga0068860_1008081462 | 157 |
| 282 | 3300005844 | Ga0068862_100470605 | Ga0068862_1004706052 | 157 |
| 283 | 3300006058 | Ga0075432_10109233 | Ga0075432_101092332 | 157 |
| 284 | 3300006846 | Ga0075430_100054607 | Ga0075430_1000546072 | 157 |
| 285 | 3300006847 | Ga0075431_100000405 | Ga0075431_10000040512 | 157 |
| 286 | 3300006852 | Ga0075433_10550132 | Ga0075433_105501322 | 157 |
| 287 | 3300006871 | Ga0075434_100780632 | Ga0075434_1007806322 | 157 |
| 288 | 3300006880 | Ga0075429_100017441 | Ga0075429_1000174419 | 157 |
| 289 | 3300006881 | Ga0068865_100181633 | Ga0068865_1001816332 | 157 |
| 290 | 3300006931 | Ga0097620_100042160 | Ga0097620_1000421605 | 157 |
| 291 | 3300006931 | Ga0097620_100084376 | Ga0097620_1000843764 | 157 |
| 292 | 3300009094 | Ga0111539_12300240 | Ga0111539_123002401 | 157 |
| 293 | 3300009098 | Ga0105245_10088181 | Ga0105245_100881814 | 157 |
| 294 | 3300009098 | Ga0105245_10748151 | Ga0105245_107481511 | 157 |
| 295 | 3300009148 | Ga0105243_10046941 | Ga0105243_100469413 | 157 |
| 296 | 3300009148 | Ga0105243_10146830 | Ga0105243_101468303 | 157 |
| 297 | 3300009174 | Ga0105241_10000819 | Ga0105241_1000081913 | 157 |
| 298 | 3300009176 | Ga0105242_10165022 | Ga0105242_101650222 | 157 |
| 299 | 3300009176 | Ga0105242_10411928 | Ga0105242_104119282 | 157 |
| 300 | 3300009177 | Ga0105248_10002997 | Ga0105248_1000299716 | 157 |
| 301 | 3300009545 | Ga0105237_10182374 | Ga0105237_101823742 | 157 |
| 302 | 3300009551 | Ga0105238_10156818 | Ga0105238_101568182 | 157 |
| 303 | 3300009553 | Ga0105249_11730548 | Ga0105249_117305482 | 157 |
| 304 | 3300010375 | Ga0105239_10179579 | Ga0105239_101795792 | 157 |
| 305 | 3300010375 | Ga0105239_10332716 | Ga0105239_103327163 | 157 |
| 306 | 3300011119 | Ga0105246_10211486 | Ga0105246_102114862 | 157 |
| 307 | 3300011119 | Ga0105246_10412066 | Ga0105246_104120662 | 157 |
| 308 | 3300012478 | Ga0157328_1003321 | Ga0157328_10033212 | 157 |
| 309 | 3300013102 | Ga0157371_10245366 | Ga0157371_102453662 | 157 |
| 310 | 3300013296 | Ga0157374_10683187 | Ga0157374_106831872 | 157 |
| 311 | 3300013297 | Ga0157378_10143942 | Ga0157378_101439425 | 157 |
| 312 | 3300013297 | Ga0157378_10184725 | Ga0157378_101847252 | 157 |
| 313 | 3300013297 | Ga0157378_10507743 | Ga0157378_105077432 | 157 |
| 314 | 3300013297 | Ga0157378_10944521 | Ga0157378_109445212 | 157 |
| 315 | 3300013297 | Ga0157378_11069670 | Ga0157378_110696702 | 157 |
| 316 | 3300013308 | Ga0157375_10115278 | Ga0157375_101152782 | 157 |
| 317 | 3300013308 | Ga0157375_10200480 | Ga0157375_102004802 | 157 |
| 318 | 3300014326 | Ga0157380_10658535 | Ga0157380_106585352 | 157 |
| 319 | 3300014745 | Ga0157377_10649245 | Ga0157377_106492452 | 157 |
| 320 | 3300014968 | Ga0157379_10907862 | Ga0157379_109078621 | 157 |
| 321 | 3300014969 | Ga0157376_10004497 | Ga0157376_1000449710 | 157 |
| 322 | 3300014969 | Ga0157376_12197770 | Ga0157376_121977701 | 157 |
| 323 | 3300017792 | Ga0163161_10294604 | Ga0163161_102946042 | 157 |
| 324 | 3300025903 | Ga0207680_10778225 | Ga0207680_107782251 | 157 |
| 325 | 3300025907 | Ga0207645_10109626 | Ga0207645_101096262 | 157 |
| 326 | 3300025907 | Ga0207645_10370526 | Ga0207645_103705262 | 157 |
| 327 | 3300025907 | Ga0207645_10502505 | Ga0207645_105025052 | 157 |
| 328 | 3300025908 | Ga0207643_10104977 | Ga0207643_101049773 | 157 |
| 329 | 3300025911 | Ga0207654_10004525 | Ga0207654_100045252 | 157 |
| 330 | 3300025912 | Ga0207707_10062251 | Ga0207707_100622513 | 157 |
| 331 | 3300025914 | Ga0207671_10127258 | Ga0207671_101272584 | 157 |
| 332 | 3300025917 | Ga0207660_10420022 | Ga0207660_104200222 | 157 |
| 333 | 3300025918 | Ga0207662_10231946 | Ga0207662_102319462 | 157 |
| 334 | 3300025921 | Ga0207652_10444171 | Ga0207652_104441712 | 157 |
| 335 | 3300025926 | Ga0207659_10084861 | Ga0207659_100848612 | 157 |
| 336 | 3300025931 | Ga0207644_10072167 | Ga0207644_100721671 | 157 |
| 337 | 3300025932 | Ga0207690_10085975 | Ga0207690_100859752 | 157 |
| 338 | 3300025932 | Ga0207690_10489242 | Ga0207690_104892422 | 157 |
| 339 | 3300025937 | Ga0207669_10196988 | Ga0207669_101969883 | 157 |
| 340 | 3300025937 | Ga0207669_10926075 | Ga0207669_109260752 | 157 |
| 341 | 3300025938 | Ga0207704_10856168 | Ga0207704_108561682 | 157 |
| 342 | 3300025940 | Ga0207691_10635941 | Ga0207691_106359412 | 157 |
| 343 | 3300025941 | Ga0207711_10043907 | Ga0207711_100439073 | 157 |
| 344 | 3300025942 | Ga0207689_10001388 | Ga0207689_100013885 | 157 |
| 345 | 3300025942 | Ga0207689_10118976 | Ga0207689_101189763 | 157 |
| 346 | 3300025945 | Ga0207679_10096147 | Ga0207679_100961473 | 157 |
| 347 | 3300025945 | Ga0207679_10439041 | Ga0207679_104390412 | 157 |
| 348 | 3300025945 | Ga0207679_11999350 | Ga0207679_119993501 | 157 |
| 349 | 3300025960 | Ga0207651_11175755 | Ga0207651_111757551 | 157 |
| 350 | 3300025972 | Ga0207668_10192960 | Ga0207668_101929603 | 157 |
| 351 | 3300025972 | Ga0207668_10196614 | Ga0207668_101966142 | 157 |
| 352 | 3300025981 | Ga0207640_11683278 | Ga0207640_116832781 | 157 |
| 353 | 3300025986 | Ga0207658_11051146 | Ga0207658_110511462 | 157 |
| 354 | 3300026023 | Ga0207677_10010843 | Ga0207677_100108432 | 157 |
| 355 | 3300026023 | Ga0207677_10358060 | Ga0207677_103580602 | 157 |
| 356 | 3300026035 | Ga0207703_10302758 | Ga0207703_103027582 | 157 |
| 357 | 3300026035 | Ga0207703_10303459 | Ga0207703_103034592 | 157 |
| 358 | 3300026035 | Ga0207703_10470146 | Ga0207703_104701462 | 157 |
| 359 | 3300026041 | Ga0207639_10091566 | Ga0207639_100915665 | 157 |
| 360 | 3300026075 | Ga0207708_10214475 | Ga0207708_102144752 | 157 |
| 361 | 3300026075 | Ga0207708_10916452 | Ga0207708_109164521 | 157 |
| 362 | 3300026078 | Ga0207702_10044117 | Ga0207702_100441175 | 157 |
| 363 | 3300026089 | Ga0207648_10081734 | Ga0207648_100817344 | 157 |
| 364 | 3300026089 | Ga0207648_10161631 | Ga0207648_101616314 | 157 |
| 365 | 3300026095 | Ga0207676_10820185 | Ga0207676_108201851 | 157 |
| 366 | 3300026118 | Ga0207675_100073048 | Ga0207675_1000730483 | 157 |
| 367 | 3300026118 | Ga0207675_101575766 | Ga0207675_1015757662 | 157 |
| 368 | 3300026121 | Ga0207683_10109333 | Ga0207683_101093332 | 157 |
| 369 | 3300026121 | Ga0207683_10117033 | Ga0207683_101170332 | 157 |
| 370 | 3300027543 | Ga0209999_1068730 | Ga0209999_10687301 | 157 |
| 371 | 3300028379 | Ga0268266_10163750 | Ga0268266_101637503 | 157 |
| 372 | 3300028380 | Ga0268265_10378249 | Ga0268265_103782492 | 157 |
| 373 | 3300028381 | Ga0268264_10541752 | Ga0268264_105417522 | 157 |
| 374 | 3300031548 | Ga0307408_100663447 | Ga0307408_1006634472 | 157 |
| 375 | 3300032002 | Ga0307416_100394459 | Ga0307416_1003944591 | 157 |
| 376 | 3300034957 | Ga0373938_0155007 | Ga0373938_0155007_67_555 | 157 |
| 377 | 3300035241 | Ga0373961_0097381 | Ga0373961_0097381_404_883 | 157 |
| 378 | 3300036401 | Ga0373937_0455475 | Ga0373937_0455475_34_522 | 157 |
| 379 | 3300041496 | Ga0451839_1174650 | Ga0451839_1174650_56_535 | 157 |
| 380 | 3300042001 | Ga0439441_028201 | Ga0439441_028201_24_509 | 157 |
| 381 | 3300048905 | Ga0496102_0352229 | Ga0496102_0352229_298_792 | 157 |
| 382 | 3300048905 | Ga0496102_0563425 | Ga0496102_0563425_380_874 | 157 |
| 383 | 3300048906 | Ga0496103_0578646 | Ga0496103_0578646_188_682 | 157 |
| 384 | 3300048909 | Ga0496106_0150399 | Ga0496106_0150399_701_1195 | 157 |
| 385 | 3300048913 | Ga0496110_0113811 | Ga0496110_0113811_1704_2198 | 157 |
| 386 | 3300048913 | Ga0496110_0697609 | Ga0496110_0697609_283_768 | 157 |
| 387 | 3300048915 | Ga0496112_0783381 | Ga0496112_0783381_330_824 | 157 |
| 388 | 3300049569 | Ga0501032_0456742 | Ga0501032_0456742_276_755 | 157 |
| 389 | 3300049570 | Ga0501033_0173379 | Ga0501033_0173379_700_1191 | 157 |
| 390 | 3300049571 | Ga0501034_0000271 | Ga0501034_0000271_31061_31540 | 157 |
| 391 | 3300049571 | Ga0501034_0045048 | Ga0501034_0045048_3454_3933 | 157 |
| 392 | 3300049572 | Ga0501036_0013778 | Ga0501036_0013778_1300_1779 | 157 |
| 393 | 3300049572 | Ga0501036_0043956 | Ga0501036_0043956_607_1098 | 157 |
| 394 | 3300049572 | Ga0501036_1600796 | Ga0501036_1600796_27_512 | 157 |
| 395 | 3300049573 | Ga0501037_0046784 | Ga0501037_0046784_1878_2369 | 157 |
| 396 | 3300049574 | Ga0501038_0121712 | Ga0501038_0121712_94_573 | 157 |
| 397 | 3300049574 | Ga0501038_0276371 | Ga0501038_0276371_598_1089 | 157 |
| 398 | 3300049575 | Ga0501039_0111413 | Ga0501039_0111413_655_1146 | 157 |
| 399 | 3300049576 | Ga0501040_0109705 | Ga0501040_0109705_560_1039 | 157 |
| 400 | 3300049577 | Ga0501041_0000884 | Ga0501041_0000884_2748_3239 | 157 |
| 401 | 3300049578 | Ga0501042_0012578 | Ga0501042_0012578_3846_4325 | 157 |
| 402 | 3300049579 | Ga0501043_0278837 | Ga0501043_0278837_217_708 | 157 |
| 403 | 3300049579 | Ga0501043_0393494 | Ga0501043_0393494_100_579 | 157 |
| 404 | 3300049580 | Ga0501046_0102797 | Ga0501046_0102797_755_1234 | 157 |
| 405 | 3300049580 | Ga0501046_0153360 | Ga0501046_0153360_772_1263 | 157 |
| 406 | 3300049582 | Ga0501048_0018606 | Ga0501048_0018606_2827_3306 | 157 |
| 407 | 3300049584 | Ga0501068_0003260 | Ga0501068_0003260_1397_1876 | 157 |
| 408 | 3300049586 | Ga0501070_0387582 | Ga0501070_0387582_240_719 | 157 |
| 409 | 3300049587 | Ga0501071_0004045 | Ga0501071_0004045_3875_4354 | 157 |
| 410 | 3300049587 | Ga0501071_0032387 | Ga0501071_0032387_127_618 | 157 |
| 411 | 3300049587 | Ga0501071_0118205 | Ga0501071_0118205_952_1437 | 157 |
| 412 | 3300049587 | Ga0501071_0376774 | Ga0501071_0376774_566_1045 | 157 |
| 413 | 3300049588 | Ga0501072_0001879 | Ga0501072_0001879_9453_9932 | 157 |
| 414 | 3300049588 | Ga0501072_0023582 | Ga0501072_0023582_4201_4680 | 157 |
| 415 | 3300049588 | Ga0501072_0039012 | Ga0501072_0039012_2750_3241 | 157 |
| 416 | 3300049589 | Ga0501073_0064876 | Ga0501073_0064876_933_1412 | 157 |
| 417 | 3300049589 | Ga0501073_0227933 | Ga0501073_0227933_140_619 | 157 |
| 418 | 3300049590 | Ga0501074_0110609 | Ga0501074_0110609_874_1353 | 157 |
| 419 | 3300049590 | Ga0501074_0984873 | Ga0501074_0984873_13_498 | 157 |
| 420 | 3300049591 | Ga0501075_0000323 | Ga0501075_0000323_7983_8462 | 157 |
| 421 | 3300049591 | Ga0501075_0013386 | Ga0501075_0013386_3488_3979 | 157 |
| 422 | 3300049591 | Ga0501075_0617403 | Ga0501075_0617403_146_637 | 157 |
| 423 | 3300049591 | Ga0501075_0711578 | Ga0501075_0711578_253_744 | 157 |
| 424 | 3300049592 | Ga0501076_0002782 | Ga0501076_0002782_8505_8984 | 157 |
| 425 | 3300049592 | Ga0501076_0010748 | Ga0501076_0010748_2322_2813 | 157 |
| 426 | 3300049592 | Ga0501076_1487784 | Ga0501076_1487784_57_536 | 157 |
| 427 | 3300049593 | Ga0501077_0160270 | Ga0501077_0160270_625_1116 | 157 |
| 428 | 3300049741 | Ga0501079_0001098 | Ga0501079_0001098_4029_4508 | 157 |
| 429 | 3300049741 | Ga0501079_0076947 | Ga0501079_0076947_451_942 | 157 |
| 430 | 3300049741 | Ga0501079_0704951 | Ga0501079_0704951_61_552 | 157 |
| 431 | 3300049742 | Ga0501080_0009212 | Ga0501080_0009212_7144_7623 | 157 |
| 432 | 3300049742 | Ga0501080_0020812 | Ga0501080_0020812_787_1278 | 157 |
| 433 | 3300049742 | Ga0501080_0025182 | Ga0501080_0025182_4094_4573 | 157 |
| 434 | 3300049743 | Ga0501081_0006454 | Ga0501081_0006454_3900_4391 | 157 |
| 435 | 3300049743 | Ga0501081_0152614 | Ga0501081_0152614_261_740 | 157 |
| 436 | 3300049743 | Ga0501081_0225830 | Ga0501081_0225830_163_654 | 157 |
| 437 | 3300049744 | Ga0501083_0097663 | Ga0501083_0097663_543_1022 | 157 |
| 438 | 3300049744 | Ga0501083_0116386 | Ga0501083_0116386_172_663 | 157 |
| 439 | 3300049824 | Ga0501045_0006518 | Ga0501045_0006518_5485_5964 | 157 |
| 440 | 3300049824 | Ga0501045_0027468 | Ga0501045_0027468_2833_3324 | 157 |
| 441 | 3300050508 | nmdc:mga09592_11799_c1 | nmdc:mga09592_11799_c1_618_1109 | 157 |
| 442 | 3300050509 | nmdc:mga0qj67_450516_c1 | nmdc:mga0qj67_450516_c1_121_612 | 157 |
| 443 | 3300050510 | nmdc:mga06r32_20793_c1 | nmdc:mga06r32_20793_c1_756_1247 | 157 |
| 444 | 3300050512 | nmdc:mga0n895_1757049_c1 | nmdc:mga0n895_1757049_c1_66_557 | 157 |
| 445 | 3300050512 | nmdc:mga0n895_85304_c1 | nmdc:mga0n895_85304_c1_187_681 | 157 |
| 446 | 3300050515 | nmdc:mga0a205_196585_c1 | nmdc:mga0a205_196585_c1_41_526 | 157 |
| 447 | 3300054114 | Ga0501084_0002787 | Ga0501084_0002787_102_581 | 157 |
| 448 | 3300054114 | Ga0501084_0301899 | Ga0501084_0301899_626_1105 | 157 |
| 449 | 3300060353 | Ga0501082_0015215 | Ga0501082_0015215_4699_5190 | 157 |
| 450 | 3300061734 | Ga0530510_0001359 | Ga0530510_0001359_12248_12727 | 157 |
| 451 | 3300061734 | Ga0530510_0220556 | Ga0530510_0220556_334_825 | 157 |
| 452 | 3300005290 | Ga0065712_10077682 | Ga0065712_100776823 | 158 |
| 453 | 3300005293 | Ga0065715_10044987 | Ga0065715_100449872 | 158 |
| 454 | 3300005293 | Ga0065715_10818593 | Ga0065715_108185931 | 158 |
| 455 | 3300005327 | Ga0070658_10018474 | Ga0070658_100184743 | 158 |
| 456 | 3300005328 | Ga0070676_10168580 | Ga0070676_101685802 | 158 |
| 457 | 3300005329 | Ga0070683_100000620 | Ga0070683_1000006207 | 158 |
| 458 | 3300005330 | Ga0070690_100038356 | Ga0070690_1000383561 | 158 |
| 459 | 3300005331 | Ga0070670_100000425 | Ga0070670_10000042513 | 158 |
| 460 | 3300005333 | Ga0070677_10019840 | Ga0070677_100198404 | 158 |
| 461 | 3300005333 | Ga0070677_10038317 | Ga0070677_100383172 | 158 |
| 462 | 3300005334 | Ga0068869_100317271 | Ga0068869_1003172711 | 158 |
| 463 | 3300005335 | Ga0070666_10005432 | Ga0070666_100054323 | 158 |
| 464 | 3300005338 | Ga0068868_100000145 | Ga0068868_10000014521 | 158 |
| 465 | 3300005338 | Ga0068868_100115383 | Ga0068868_1001153832 | 158 |
| 466 | 3300005339 | Ga0070660_100364103 | Ga0070660_1003641032 | 158 |
| 467 | 3300005340 | Ga0070689_100217069 | Ga0070689_1002170692 | 158 |
| 468 | 3300005343 | Ga0070687_100137429 | Ga0070687_1001374292 | 158 |
| 469 | 3300005344 | Ga0070661_100004612 | Ga0070661_1000046125 | 158 |
| 470 | 3300005344 | Ga0070661_101355327 | Ga0070661_1013553271 | 158 |
| 471 | 3300005354 | Ga0070675_100001867 | Ga0070675_1000018678 | 158 |
| 472 | 3300005354 | Ga0070675_100655224 | Ga0070675_1006552242 | 158 |
| 473 | 3300005355 | Ga0070671_100000623 | Ga0070671_10000062315 | 158 |
| 474 | 3300005355 | Ga0070671_100054443 | Ga0070671_1000544432 | 158 |
| 475 | 3300005356 | Ga0070674_100021913 | Ga0070674_1000219132 | 158 |
| 476 | 3300005364 | Ga0070673_100000994 | Ga0070673_10000099410 | 158 |
| 477 | 3300005364 | Ga0070673_100958810 | Ga0070673_1009588101 | 158 |
| 478 | 3300005364 | Ga0070673_101692432 | Ga0070673_1016924321 | 158 |
| 479 | 3300005365 | Ga0070688_100035047 | Ga0070688_1000350473 | 158 |
| 480 | 3300005366 | Ga0070659_100690689 | Ga0070659_1006906892 | 158 |
| 481 | 3300005367 | Ga0070667_100029846 | Ga0070667_1000298462 | 158 |
| 482 | 3300005441 | Ga0070700_100137292 | Ga0070700_1001372922 | 158 |
| 483 | 3300005456 | Ga0070678_100000715 | Ga0070678_10000071513 | 158 |
| 484 | 3300005456 | Ga0070678_100228341 | Ga0070678_1002283412 | 158 |
| 485 | 3300005457 | Ga0070662_100045293 | Ga0070662_1000452931 | 158 |
| 486 | 3300005458 | Ga0070681_10243936 | Ga0070681_102439362 | 158 |
| 487 | 3300005459 | Ga0068867_100012666 | Ga0068867_1000126665 | 158 |
| 488 | 3300005459 | Ga0068867_100987519 | Ga0068867_1009875192 | 158 |
| 489 | 3300005466 | Ga0070685_10117304 | Ga0070685_101173042 | 158 |
| 490 | 3300005466 | Ga0070685_10184031 | Ga0070685_101840312 | 158 |
| 491 | 3300005530 | Ga0070679_100586798 | Ga0070679_1005867981 | 158 |
| 492 | 3300005535 | Ga0070684_100030101 | Ga0070684_1000301015 | 158 |
| 493 | 3300005535 | Ga0070684_100445753 | Ga0070684_1004457532 | 158 |
| 494 | 3300005543 | Ga0070672_100000613 | Ga0070672_1000006136 | 158 |
| 495 | 3300005544 | Ga0070686_100283057 | Ga0070686_1002830572 | 158 |
| 496 | 3300005548 | Ga0070665_100215780 | Ga0070665_1002157802 | 158 |
| 497 | 3300005549 | Ga0070704_100188779 | Ga0070704_1001887791 | 158 |
| 498 | 3300005564 | Ga0070664_100000316 | Ga0070664_10000031613 | 158 |
| 499 | 3300005564 | Ga0070664_101617508 | Ga0070664_1016175081 | 158 |
| 500 | 3300005578 | Ga0068854_100006142 | Ga0068854_1000061422 | 158 |
| 501 | 3300005578 | Ga0068854_100905176 | Ga0068854_1009051762 | 158 |
| 502 | 3300005615 | Ga0070702_100011565 | Ga0070702_1000115652 | 158 |
| 503 | 3300005615 | Ga0070702_100058944 | Ga0070702_1000589443 | 158 |
| 504 | 3300005616 | Ga0068852_100000229 | Ga0068852_10000022921 | 158 |
| 505 | 3300005617 | Ga0068859_101111277 | Ga0068859_1011112772 | 158 |
| 506 | 3300005618 | Ga0068864_100006381 | Ga0068864_10000638110 | 158 |
| 507 | 3300005618 | Ga0068864_100174535 | Ga0068864_1001745352 | 158 |
| 508 | 3300005618 | Ga0068864_101468301 | Ga0068864_1014683012 | 158 |
| 509 | 3300005718 | Ga0068866_10044262 | Ga0068866_100442623 | 158 |
| 510 | 3300005719 | Ga0068861_100072633 | Ga0068861_1000726333 | 158 |
| 511 | 3300005834 | Ga0068851_10005187 | Ga0068851_100051873 | 158 |
| 512 | 3300005840 | Ga0068870_10569075 | Ga0068870_105690751 | 158 |
| 513 | 3300005840 | Ga0068870_10962877 | Ga0068870_109628771 | 158 |
| 514 | 3300005841 | Ga0068863_100059980 | Ga0068863_1000599805 | 158 |
| 515 | 3300005841 | Ga0068863_100126314 | Ga0068863_1001263143 | 158 |
| 516 | 3300005844 | Ga0068862_100242416 | Ga0068862_1002424162 | 158 |
| 517 | 3300006051 | Ga0075364_10583040 | Ga0075364_105830402 | 158 |
| 518 | 3300006237 | Ga0097621_100001842 | Ga0097621_10000184211 | 158 |
| 519 | 3300006237 | Ga0097621_100161618 | Ga0097621_1001616182 | 158 |
| 520 | 3300006237 | Ga0097621_100207675 | Ga0097621_1002076753 | 158 |
| 521 | 3300006358 | Ga0068871_100000463 | Ga0068871_10000046310 | 158 |
| 522 | 3300006358 | Ga0068871_100320039 | Ga0068871_1003200392 | 158 |
| 523 | 3300006844 | Ga0075428_100195225 | Ga0075428_1001952252 | 158 |
| 524 | 3300006844 | Ga0075428_100382866 | Ga0075428_1003828662 | 158 |
| 525 | 3300006880 | Ga0075429_100753562 | Ga0075429_1007535621 | 158 |
| 526 | 3300006880 | Ga0075429_100909153 | Ga0075429_1009091531 | 158 |
| 527 | 3300006881 | Ga0068865_100110321 | Ga0068865_1001103213 | 158 |
| 528 | 3300006881 | Ga0068865_100563197 | Ga0068865_1005631972 | 158 |
| 529 | 3300006931 | Ga0097620_101111332 | Ga0097620_1011113322 | 158 |
| 530 | 3300009011 | Ga0105251_10347355 | Ga0105251_103473552 | 158 |
| 531 | 3300009094 | Ga0111539_10205558 | Ga0111539_102055582 | 158 |
| 532 | 3300009094 | Ga0111539_10445061 | Ga0111539_104450612 | 158 |
| 533 | 3300009094 | Ga0111539_10776304 | Ga0111539_107763042 | 158 |
| 534 | 3300009098 | Ga0105245_11914274 | Ga0105245_119142742 | 158 |
| 535 | 3300009148 | Ga0105243_10130322 | Ga0105243_101303221 | 158 |
| 536 | 3300009176 | Ga0105242_10320105 | Ga0105242_103201052 | 158 |
| 537 | 3300009176 | Ga0105242_11510324 | Ga0105242_115103242 | 158 |
| 538 | 3300009177 | Ga0105248_10054534 | Ga0105248_100545345 | 158 |
| 539 | 3300009177 | Ga0105248_10362462 | Ga0105248_103624622 | 158 |
| 540 | 3300009177 | Ga0105248_11551752 | Ga0105248_115517521 | 158 |
| 541 | 3300009551 | Ga0105238_10531760 | Ga0105238_105317602 | 158 |
| 542 | 3300009553 | Ga0105249_10070378 | Ga0105249_100703782 | 158 |
| 543 | 3300013296 | Ga0157374_10000860 | Ga0157374_1000086012 | 158 |
| 544 | 3300013296 | Ga0157374_10209813 | Ga0157374_102098132 | 158 |
| 545 | 3300013297 | Ga0157378_10001726 | Ga0157378_100017268 | 158 |
| 546 | 3300013297 | Ga0157378_10100198 | Ga0157378_101001983 | 158 |
| 547 | 3300013306 | Ga0163162_10105559 | Ga0163162_101055592 | 158 |
| 548 | 3300013308 | Ga0157375_10000496 | Ga0157375_100004962 | 158 |
| 549 | 3300013308 | Ga0157375_10164398 | Ga0157375_101643982 | 158 |
| 550 | 3300014325 | Ga0163163_10295431 | Ga0163163_102954313 | 158 |
| 551 | 3300014745 | Ga0157377_10138741 | Ga0157377_101387413 | 158 |
| 552 | 3300014745 | Ga0157377_10161519 | Ga0157377_101615192 | 158 |
| 553 | 3300014968 | Ga0157379_10325220 | Ga0157379_103252202 | 158 |
| 554 | 3300014969 | Ga0157376_10015747 | Ga0157376_100157475 | 158 |
| 555 | 3300014969 | Ga0157376_10112186 | Ga0157376_101121862 | 158 |
| 556 | 3300014969 | Ga0157376_10450151 | Ga0157376_104501512 | 158 |
| 557 | 3300017792 | Ga0163161_10115899 | Ga0163161_101158993 | 158 |
| 558 | 3300017792 | Ga0163161_10155452 | Ga0163161_101554522 | 158 |
| 559 | 3300025315 | Ga0207697_10011965 | Ga0207697_100119653 | 158 |
| 560 | 3300025893 | Ga0207682_10001311 | Ga0207682_100013113 | 158 |
| 561 | 3300025893 | Ga0207682_10129957 | Ga0207682_101299571 | 158 |
| 562 | 3300025901 | Ga0207688_10296155 | Ga0207688_102961552 | 158 |
| 563 | 3300025907 | Ga0207645_10196517 | Ga0207645_101965172 | 158 |
| 564 | 3300025908 | Ga0207643_10004592 | Ga0207643_100045927 | 158 |
| 565 | 3300025909 | Ga0207705_10063839 | Ga0207705_100638392 | 158 |
| 566 | 3300025918 | Ga0207662_10003156 | Ga0207662_100031568 | 158 |
| 567 | 3300025919 | Ga0207657_10191585 | Ga0207657_101915852 | 158 |
| 568 | 3300025920 | Ga0207649_10002082 | Ga0207649_100020826 | 158 |
| 569 | 3300025921 | Ga0207652_10579944 | Ga0207652_105799442 | 158 |
| 570 | 3300025925 | Ga0207650_10001393 | Ga0207650_100013936 | 158 |
| 571 | 3300025925 | Ga0207650_10264101 | Ga0207650_102641012 | 158 |
| 572 | 3300025926 | Ga0207659_10001475 | Ga0207659_100014756 | 158 |
| 573 | 3300025931 | Ga0207644_10001467 | Ga0207644_100014677 | 158 |
| 574 | 3300025931 | Ga0207644_10129010 | Ga0207644_101290103 | 158 |
| 575 | 3300025932 | Ga0207690_10264873 | Ga0207690_102648732 | 158 |
| 576 | 3300025933 | Ga0207706_10233702 | Ga0207706_102337021 | 158 |
| 577 | 3300025935 | Ga0207709_10474435 | Ga0207709_104744352 | 158 |
| 578 | 3300025936 | Ga0207670_10047175 | Ga0207670_100471753 | 158 |
| 579 | 3300025937 | Ga0207669_10067408 | Ga0207669_100674082 | 158 |
| 580 | 3300025938 | Ga0207704_10309803 | Ga0207704_103098032 | 158 |
| 581 | 3300025940 | Ga0207691_10000667 | Ga0207691_1000066714 | 158 |
| 582 | 3300025940 | Ga0207691_10125844 | Ga0207691_101258442 | 158 |
| 583 | 3300025941 | Ga0207711_10395287 | Ga0207711_103952872 | 158 |
| 584 | 3300025942 | Ga0207689_10013184 | Ga0207689_100131846 | 158 |
| 585 | 3300025944 | Ga0207661_10000839 | Ga0207661_100008397 | 158 |
| 586 | 3300025945 | Ga0207679_10000649 | Ga0207679_1000064911 | 158 |
| 587 | 3300025945 | Ga0207679_10199423 | Ga0207679_101994232 | 158 |
| 588 | 3300025945 | Ga0207679_10445227 | Ga0207679_104452272 | 158 |
| 589 | 3300025960 | Ga0207651_10070595 | Ga0207651_100705953 | 158 |
| 590 | 3300025960 | Ga0207651_10926664 | Ga0207651_109266641 | 158 |
| 591 | 3300025972 | Ga0207668_10085487 | Ga0207668_100854872 | 158 |
| 592 | 3300025981 | Ga0207640_10004522 | Ga0207640_100045222 | 158 |
| 593 | 3300025981 | Ga0207640_10101233 | Ga0207640_101012332 | 158 |
| 594 | 3300025986 | Ga0207658_10016377 | Ga0207658_100163772 | 158 |
| 595 | 3300025986 | Ga0207658_10193833 | Ga0207658_101938332 | 158 |
| 596 | 3300026023 | Ga0207677_10002637 | Ga0207677_100026376 | 158 |
| 597 | 3300026023 | Ga0207677_10139271 | Ga0207677_101392712 | 158 |
| 598 | 3300026075 | Ga0207708_10001911 | Ga0207708_100019114 | 158 |
| 599 | 3300026088 | Ga0207641_10053759 | Ga0207641_100537593 | 158 |
| 600 | 3300026088 | Ga0207641_10423968 | Ga0207641_104239682 | 158 |
| 601 | 3300026089 | Ga0207648_10032821 | Ga0207648_100328215 | 158 |
| 602 | 3300026095 | Ga0207676_10224720 | Ga0207676_102247202 | 158 |
| 603 | 3300026095 | Ga0207676_10338282 | Ga0207676_103382822 | 158 |
| 604 | 3300026095 | Ga0207676_10619360 | Ga0207676_106193602 | 158 |
| 605 | 3300026118 | Ga0207675_100009662 | Ga0207675_1000096627 | 158 |
| 606 | 3300026121 | Ga0207683_10001353 | Ga0207683_1000135315 | 158 |
| 607 | 3300026121 | Ga0207683_10044602 | Ga0207683_100446024 | 158 |
| 608 | 3300026142 | Ga0207698_10000201 | Ga0207698_1000020112 | 158 |
| 609 | 3300026142 | Ga0207698_10262088 | Ga0207698_102620882 | 158 |
| 610 | 3300027360 | Ga0209969_1001193 | Ga0209969_10011932 | 158 |
| 611 | 3300027360 | Ga0209969_1028386 | Ga0209969_10283861 | 158 |
| 612 | 3300027364 | Ga0209967_1029195 | Ga0209967_10291951 | 158 |
| 613 | 3300027378 | Ga0209981_1015878 | Ga0209981_10158782 | 158 |
| 614 | 3300027462 | Ga0210000_1003606 | Ga0210000_10036063 | 158 |
| 615 | 3300027471 | Ga0209995_1002446 | Ga0209995_10024464 | 158 |
| 616 | 3300027617 | Ga0210002_1031951 | Ga0210002_10319512 | 158 |
| 617 | 3300027665 | Ga0209983_1042994 | Ga0209983_10429942 | 158 |
| 618 | 3300027682 | Ga0209971_1007110 | Ga0209971_10071102 | 158 |
| 619 | 3300027876 | Ga0209974_10003811 | Ga0209974_100038113 | 158 |
| 620 | 3300027876 | Ga0209974_10066366 | Ga0209974_100663662 | 158 |
| 621 | 3300028380 | Ga0268265_10178882 | Ga0268265_101788823 | 158 |
| 622 | 3300028380 | Ga0268265_11255294 | Ga0268265_112552941 | 158 |
| 623 | 3300028381 | Ga0268264_11360842 | Ga0268264_113608421 | 158 |
| 624 | 3300028577 | Ga0265318_10004551 | Ga0265318_100045513 | 158 |
| 625 | 3300028800 | Ga0265338_10212015 | Ga0265338_102120152 | 158 |
| 626 | 3300031235 | Ga0265330_10117223 | Ga0265330_101172232 | 158 |
| 627 | 3300031238 | Ga0265332_10002198 | Ga0265332_100021985 | 158 |
| 628 | 3300031239 | Ga0265328_10003085 | Ga0265328_100030854 | 158 |
| 629 | 3300031240 | Ga0265320_10159888 | Ga0265320_101598881 | 158 |
| 630 | 3300031241 | Ga0265325_10118444 | Ga0265325_101184442 | 158 |
| 631 | 3300031249 | Ga0265339_10179697 | Ga0265339_101796972 | 158 |
| 632 | 3300031250 | Ga0265331_10007426 | Ga0265331_100074267 | 158 |
| 633 | 3300031344 | Ga0265316_10028156 | Ga0265316_100281562 | 158 |
| 634 | 3300031548 | Ga0307408_100055991 | Ga0307408_1000559914 | 158 |
| 635 | 3300031665 | Ga0316575_10000646 | Ga0316575_100006465 | 158 |
| 636 | 3300031711 | Ga0265314_10000335 | Ga0265314_1000033545 | 158 |
| 637 | 3300031712 | Ga0265342_10006633 | Ga0265342_100066333 | 158 |
| 638 | 3300031824 | Ga0307413_10567800 | Ga0307413_105678002 | 158 |
| 639 | 3300031852 | Ga0307410_10245418 | Ga0307410_102454182 | 158 |
| 640 | 3300031901 | Ga0307406_10137741 | Ga0307406_101377412 | 158 |
| 641 | 3300031903 | Ga0307407_10023684 | Ga0307407_100236842 | 158 |
| 642 | 3300031903 | Ga0307407_10481316 | Ga0307407_104813162 | 158 |
| 643 | 3300031911 | Ga0307412_11400816 | Ga0307412_114008162 | 158 |
| 644 | 3300032005 | Ga0307411_10269668 | Ga0307411_102696682 | 158 |
| 645 | 3300032168 | Ga0316593_10223761 | Ga0316593_102237611 | 158 |
| 646 | 3300036401 | Ga0373937_0685105 | Ga0373937_0685105_279_767 | 158 |
| 647 | 3300036647 | Ga0316582_0442961 | Ga0316582_0442961_338_826 | 158 |
| 648 | 3300037853 | Ga0436364_0126953 | Ga0436364_0126953_35_529 | 158 |
| 649 | 3300041459 | Ga0451800_0675414 | Ga0451800_0675414_350_838 | 158 |
| 650 | 3300041507 | Ga0451851_0448351 | Ga0451851_0448351_131_619 | 158 |
| 651 | 3300041512 | Ga0451853_3741827 | Ga0451853_3741827_466_954 | 158 |
| 652 | 3300042461 | Ga0439460_0107505 | Ga0439460_0107505_347_823 | 158 |
| 653 | 3300042876 | Ga0451577_0384248 | Ga0451577_0384248_637_1125 | 158 |
| 654 | 3300042876 | Ga0451577_0481347 | Ga0451577_0481347_498_986 | 158 |
| 655 | 3300042876 | Ga0451577_1278795 | Ga0451577_1278795_79_567 | 158 |
| 656 | 3300045051 | Ga0451576_0664028 | Ga0451576_0664028_387_944 | 158 |
| 657 | 3300046537 | Ga0495598_0143007 | Ga0495598_0143007_236_724 | 158 |
| 658 | 3300046539 | Ga0495621_0144443 | Ga0495621_0144443_247_735 | 158 |
| 659 | 3300046675 | Ga0495657_0471402 | Ga0495657_0471402_58_546 | 158 |
| 660 | 3300046683 | Ga0495658_0415820 | Ga0495658_0415820_271_759 | 158 |
| 661 | 3300046684 | Ga0495669_0112754 | Ga0495669_0112754_642_1130 | 158 |
| 662 | 3300048903 | Ga0496100_0025668 | Ga0496100_0025668_2193_2681 | 158 |
| 663 | 3300048904 | Ga0496101_0785182 | Ga0496101_0785182_228_716 | 158 |
| 664 | 3300048911 | Ga0496108_0000486 | Ga0496108_0000486_2819_3307 | 158 |
| 665 | 3300048911 | Ga0496108_0232622 | Ga0496108_0232622_969_1457 | 158 |
| 666 | 3300048911 | Ga0496108_0299453 | Ga0496108_0299453_747_1241 | 158 |
| 667 | 3300048912 | Ga0496109_0023255 | Ga0496109_0023255_260_748 | 158 |
| 668 | 3300048913 | Ga0496110_0002637 | Ga0496110_0002637_6696_7184 | 158 |
| 669 | 3300048913 | Ga0496110_0470690 | Ga0496110_0470690_41_535 | 158 |
| 670 | 3300048913 | Ga0496110_0576307 | Ga0496110_0576307_123_611 | 158 |
| 671 | 3300048914 | Ga0496111_0022060 | Ga0496111_0022060_2967_3455 | 158 |
| 672 | 3300048915 | Ga0496112_0797736 | Ga0496112_0797736_79_567 | 158 |
| 673 | 3300048916 | Ga0496113_0491388 | Ga0496113_0491388_413_901 | 158 |
| 674 | 3300048917 | Ga0496114_0014858 | Ga0496114_0014858_4805_5293 | 158 |
| 675 | 3300048917 | Ga0496114_0039604 | Ga0496114_0039604_1924_2418 | 158 |
| 676 | 3300048917 | Ga0496114_0426887 | Ga0496114_0426887_440_928 | 158 |
| 677 | 3300049514 | Ga0501291_036186 | Ga0501291_036186_331_825 | 158 |
| 678 | 3300049515 | Ga0501292_072560 | Ga0501292_072560_133_621 | 158 |
| 679 | 3300049526 | Ga0501303_016378 | Ga0501303_016378_74_562 | 158 |
| 680 | 3300049569 | Ga0501032_0322917 | Ga0501032_0322917_343_822 | 158 |
| 681 | 3300049573 | Ga0501037_0448467 | Ga0501037_0448467_228_707 | 158 |
| 682 | 3300049576 | Ga0501040_0978782 | Ga0501040_0978782_102_596 | 158 |
| 683 | 3300049585 | Ga0501069_0004756 | Ga0501069_0004756_594_1085 | 158 |
| 684 | 3300049586 | Ga0501070_0007076 | Ga0501070_0007076_6178_6669 | 158 |
| 685 | 3300049586 | Ga0501070_0096236 | Ga0501070_0096236_26_517 | 158 |
| 686 | 3300049590 | Ga0501074_0051996 | Ga0501074_0051996_766_1257 | 158 |
| 687 | 3300049779 | Ga0501283_011376 | Ga0501283_011376_308_796 | 158 |
| 688 | 3300049823 | Ga0501044_0180241 | Ga0501044_0180241_354_833 | 158 |
| 689 | 3300050491 | nmdc:mga00v17_774946_c1 | nmdc:mga00v17_774946_c1_21_542 | 158 |
| 690 | 3300050511 | nmdc:mga08y16_165794_c1 | nmdc:mga08y16_165794_c1_1279_1773 | 158 |
| 691 | 3300050511 | nmdc:mga08y16_201860_c1 | nmdc:mga08y16_201860_c1_1353_1841 | 158 |
| 692 | 3300061734 | Ga0530510_0626931 | Ga0530510_0626931_39_533 | 158 |
| 693 | 2162886007 | SwRhRL2b_contig_208097 | SwRhRL2b_0012.00007630 | 161 |
| 694 | 3300005289 | Ga0065704_10071556 | Ga0065704_100715562 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9252 | 4 | 139 |
| 6jzv-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis | 0.9238 | 6 | 141 |
| 2qq4-assembly2.cif.gz_D | crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 | 0.9213 | 5 | 139 |
| 6jzw-assembly2.cif.gz_B | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9197 | 4 | 139 |
| 6a6g-assembly1.cif.gz_C | crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 | 0.9166 | 8 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9189 | 5 | 140 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.912 | 8 | 139 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8938 | 5 | 142 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8872 | 5 | 140 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8681 | 8 | 139 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6PMU2-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.968 | 10 | 89 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A3D6EIP0-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9624 | 1 | 149 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2H0MZJ3-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9577 | 1 | 149 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A3D6EIP0-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9561 | 1 | 149 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7C5ZN38-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9551 | 23 | 144 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar