F475758

General Info

Members Datasets Scaffolds Average Seq Length
694 283 694 161

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0080143|Ga0501032_0080143_466_1011
Length 181
Sequence MRLSPVFAPFLKFSDNEERIIMNTKSLYQEVILDHNRKPRNYGVLEKPSHQAVGHNPLCGDHLDIALDLEGGRIDRIAFKGESCAICKASASMMTTVVKGKTRADAETLIEEFRDMAMGKLDVDGPHHLGRLTVFAGVRDLPTRVKCAILPWHTLHAALNSVTVASTEAEDDPMHAAIGDA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 5.04
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_208097 2162886007 Unclassified 928
2 Ga0065704_10071556 3300005289 Bacteria 10723
3 Ga0065712_10077682 3300005290 Bacteria 3458
4 Ga0065715_10044987 3300005293 Bacteria 1159
5 Ga0065715_10818593 3300005293 Bacteria 594
6 Ga0070658_10018474 3300005327 Bacteria 5583
7 Ga0070676_10055704 3300005328 Bacteria 2334
8 Ga0070676_10168580 3300005328 Bacteria 1414
9 Ga0070676_10294364 3300005328 Bacteria 1098
10 Ga0070676_10450267 3300005328 Unclassified 905
11 Ga0070676_10641477 3300005328 Bacteria 770
12 Ga0070683_100000620 3300005329 Bacteria 25543
13 Ga0070690_100029641 3300005330 Bacteria 3396
14 Ga0070690_100038356 3300005330 Bacteria 3023
15 Ga0070690_100270012 3300005330 Bacteria 1209
16 Ga0070690_100294952 3300005330 Bacteria 1161
17 Ga0070670_100000425 3300005331 Bacteria 34805
18 Ga0070670_100250503 3300005331 Bacteria 1543
19 Ga0070670_100410736 3300005331 Bacteria 1196
20 Ga0070677_10019840 3300005333 Bacteria 2441
21 Ga0070677_10038317 3300005333 Bacteria 1875
22 Ga0068869_100001424 3300005334 Bacteria 14173
23 Ga0068869_100003052 3300005334 Bacteria 10184
24 Ga0068869_100317271 3300005334 Bacteria 1263
25 Ga0070666_10005432 3300005335 Bacteria 7814
26 Ga0070680_100050071 3300005336 Bacteria 3407
27 Ga0070680_100174528 3300005336 Bacteria 1809
28 Ga0070680_100194408 3300005336 Bacteria 1710
29 Ga0068868_100000145 3300005338 Bacteria 46047
30 Ga0068868_100115383 3300005338 Bacteria 2186
31 Ga0068868_100157105 3300005338 Bacteria 1876
32 Ga0068868_100455482 3300005338 Unclassified 1113
33 Ga0068868_100607902 3300005338 Bacteria 969
34 Ga0068868_100670593 3300005338 Bacteria 925
35 Ga0070660_100364103 3300005339 Bacteria 1192
36 Ga0070689_100002386 3300005340 Bacteria 12246
37 Ga0070689_100010875 3300005340 Bacteria 6503
38 Ga0070689_100181147 3300005340 Bacteria 1711
39 Ga0070689_100217069 3300005340 Bacteria 1567
40 Ga0070689_100801509 3300005340 Bacteria 828
41 Ga0070689_101490005 3300005340 Bacteria 613
42 Ga0070691_10008905 3300005341 Bacteria 4595
43 Ga0070687_100134323 3300005343 Bacteria 1432
44 Ga0070687_100137429 3300005343 Bacteria 1418
45 Ga0070687_100573961 3300005343 Bacteria 771
46 Ga0070661_100004612 3300005344 Bacteria 9482
47 Ga0070661_101355327 3300005344 Bacteria 598
48 Ga0070692_10026458 3300005345 Bacteria 2868
49 Ga0070668_100833327 3300005347 Unclassified 821
50 Ga0070675_100001867 3300005354 Bacteria 15530
51 Ga0070675_100038641 3300005354 Bacteria 3891
52 Ga0070675_100655224 3300005354 Bacteria 954
53 Ga0070675_100948594 3300005354 Bacteria 789
54 Ga0070671_100000623 3300005355 Bacteria 25250
55 Ga0070671_100050216 3300005355 Bacteria 3469
56 Ga0070671_100054443 3300005355 Bacteria 3327
57 Ga0070671_100179419 3300005355 Bacteria 1793
58 Ga0070671_100510316 3300005355 Bacteria 1035
59 Ga0070674_100021913 3300005356 Bacteria 4112
60 Ga0070674_100317034 3300005356 Bacteria 1249
61 Ga0070674_100400569 3300005356 Bacteria 1121
62 Ga0070674_101266174 3300005356 Bacteria 657
63 Ga0070673_100000994 3300005364 Bacteria 16078
64 Ga0070673_100103225 3300005364 Bacteria 2352
65 Ga0070673_100351521 3300005364 Bacteria 1308
66 Ga0070673_100958810 3300005364 Bacteria 795
67 Ga0070673_101692432 3300005364 Bacteria 598
68 Ga0070688_100035047 3300005365 Bacteria 3046
69 Ga0070659_100202170 3300005366 Bacteria 1636
70 Ga0070659_100322272 3300005366 Bacteria 1292
71 Ga0070659_100682621 3300005366 Bacteria 887
72 Ga0070659_100690689 3300005366 Bacteria 882
73 Ga0070667_100029846 3300005367 Bacteria 4546
74 Ga0070714_100107982 3300005435 Bacteria 2460
75 Ga0070701_10000068 3300005438 Bacteria 28103
76 Ga0070701_10560760 3300005438 Unclassified 751
77 Ga0070711_101545011 3300005439 Bacteria 580
78 Ga0070705_101112233 3300005440 Unclassified 647
79 Ga0070700_100031382 3300005441 Bacteria 3183
80 Ga0070700_100116393 3300005441 Bacteria 1785
81 Ga0070700_100137292 3300005441 Bacteria 1657
82 Ga0070700_100406901 3300005441 Bacteria 1025
83 Ga0070700_101008062 3300005441 Bacteria 685
84 Ga0070694_100162003 3300005444 Bacteria 1642
85 Ga0070694_100827664 3300005444 Bacteria 760
86 Ga0070708_100179911 3300005445 Bacteria 1976
87 Ga0070663_100086998 3300005455 Bacteria 2309
88 Ga0070678_100000715 3300005456 Bacteria 16451
89 Ga0070678_100228341 3300005456 Bacteria 1550
90 Ga0070678_100285819 3300005456 Bacteria 1396
91 Ga0070678_100735693 3300005456 Bacteria 891
92 Ga0070678_100898497 3300005456 Bacteria 809
93 Ga0070662_100045293 3300005457 Bacteria 3155
94 Ga0070662_100217514 3300005457 Bacteria 1523
95 Ga0070681_10006242 3300005458 Bacteria 11591
96 Ga0070681_10156805 3300005458 Bacteria 2201
97 Ga0070681_10243936 3300005458 Bacteria 1710
98 Ga0068867_100007256 3300005459 Bacteria 7837
99 Ga0068867_100012666 3300005459 Bacteria 5964
100 Ga0068867_100037411 3300005459 Bacteria 3527
101 Ga0068867_100244875 3300005459 Bacteria 1455
102 Ga0068867_100337932 3300005459 Bacteria 1253
103 Ga0068867_100987519 3300005459 Bacteria 763
104 Ga0070685_10117304 3300005466 Bacteria 1648
105 Ga0070685_10124928 3300005466 Bacteria 1602
106 Ga0070685_10184031 3300005466 Bacteria 1347
107 Ga0070685_10699909 3300005466 Unclassified 739
108 Ga0070706_100243303 3300005467 Bacteria 1680
109 Ga0070706_100546416 3300005467 Bacteria 1077
110 Ga0070679_100074056 3300005530 Bacteria 3396
111 Ga0070679_100115854 3300005530 Bacteria 2665
112 Ga0070679_100586798 3300005530 Bacteria 1058
113 Ga0070679_100643568 3300005530 Unclassified 1003
114 Ga0070684_100030101 3300005535 Bacteria 4610
115 Ga0070684_100445753 3300005535 Bacteria 1196
116 Ga0070697_100185705 3300005536 Bacteria 1763
117 Ga0068853_100538909 3300005539 Bacteria 1105
118 Ga0070672_100000613 3300005543 Bacteria 20968
119 Ga0070686_100001003 3300005544 Bacteria 16289
120 Ga0070686_100283057 3300005544 Bacteria 1224
121 Ga0070695_100022132 3300005545 Bacteria 3896
122 Ga0070695_100139908 3300005545 Unclassified 1677
123 Ga0070695_100144101 3300005545 Bacteria 1656
124 Ga0070695_100853416 3300005545 Bacteria 733
125 Ga0070696_100020029 3300005546 Bacteria 4536
126 Ga0070696_100412136 3300005546 Bacteria 1059
127 Ga0070693_100058698 3300005547 Bacteria 2228
128 Ga0070693_100136915 3300005547 Unclassified 1537
129 Ga0070665_100215780 3300005548 Bacteria 1919
130 Ga0070665_100445654 3300005548 Bacteria 1304
131 Ga0070704_100008155 3300005549 Bacteria 6265
132 Ga0070704_100188779 3300005549 Bacteria 1655
133 Ga0070704_100560737 3300005549 Bacteria 999
134 Ga0070704_100986298 3300005549 Bacteria 761
135 Ga0068855_100017462 3300005563 Bacteria 8631
136 Ga0070664_100000316 3300005564 Bacteria 35228
137 Ga0070664_100412362 3300005564 Bacteria 1236
138 Ga0070664_101617508 3300005564 Bacteria 614
139 Ga0068854_100006142 3300005578 Bacteria 7623
140 Ga0068854_100349887 3300005578 Bacteria 1209
141 Ga0068854_100905176 3300005578 Bacteria 776
142 Ga0068856_100541867 3300005614 Bacteria 1185
143 Ga0068856_100931596 3300005614 Bacteria 887
144 Ga0070702_100000040 3300005615 Bacteria 35063
145 Ga0070702_100011565 3300005615 Bacteria 4393
146 Ga0070702_100058944 3300005615 Bacteria 2226
147 Ga0070702_100234032 3300005615 Bacteria 1236
148 Ga0070702_100304206 3300005615 Unclassified 1104
149 Ga0070702_100333716 3300005615 Bacteria 1061
150 Ga0068852_100000229 3300005616 Bacteria 38015
151 Ga0068859_100031545 3300005617 Bacteria 5322
152 Ga0068859_100042159 3300005617 Bacteria 4584
153 Ga0068859_100084377 3300005617 Bacteria 3222
154 Ga0068859_101111277 3300005617 Bacteria 869
155 Ga0068864_100006381 3300005618 Bacteria 9665
156 Ga0068864_100164332 3300005618 Bacteria 2020
157 Ga0068864_100174535 3300005618 Bacteria 1961
158 Ga0068864_100214637 3300005618 Bacteria 1773
159 Ga0068864_101468301 3300005618 Bacteria 684
160 Ga0068864_102437372 3300005618 Unclassified 529
161 Ga0068866_10001473 3300005718 Bacteria 10036
162 Ga0068866_10044262 3300005718 Bacteria 2226
163 Ga0068861_100000658 3300005719 Bacteria 20535
164 Ga0068861_100072633 3300005719 Bacteria 2670
165 Ga0068861_100174398 3300005719 Bacteria 1785
166 Ga0068851_10005187 3300005834 Bacteria 5914
167 Ga0068870_10003999 3300005840 Bacteria 6292
168 Ga0068870_10569075 3300005840 Bacteria 765
169 Ga0068870_10962877 3300005840 Bacteria 606
170 Ga0068863_100052247 3300005841 Bacteria 3873
171 Ga0068863_100059980 3300005841 Bacteria 3599
172 Ga0068863_100126314 3300005841 Bacteria 2440
173 Ga0068863_100408415 3300005841 Bacteria 1329
174 Ga0068863_100415522 3300005841 Unclassified 1317
175 Ga0068858_100003367 3300005842 Bacteria 15912
176 Ga0068858_100241941 3300005842 Bacteria 1712
177 Ga0068858_100329800 3300005842 Bacteria 1459
178 Ga0068858_100585653 3300005842 Bacteria 1081
179 Ga0068860_100079128 3300005843 Bacteria 3126
180 Ga0068860_100092581 3300005843 Bacteria 2880
181 Ga0068860_100808146 3300005843 Bacteria 951
182 Ga0068862_100242416 3300005844 Bacteria 1639
183 Ga0068862_100470605 3300005844 Bacteria 1188
184 Ga0068862_101093861 3300005844 Bacteria 792
185 Ga0081539_10129038 3300005985 Bacteria 1244
186 Ga0075364_10583040 3300006051 Bacteria 764
187 Ga0075432_10109233 3300006058 Bacteria 1029
188 Ga0070716_100241005 3300006173 Unclassified 1226
189 Ga0097621_100001842 3300006237 Bacteria 14533
190 Ga0097621_100003464 3300006237 Bacteria 10878
191 Ga0097621_100161618 3300006237 Bacteria 1925
192 Ga0097621_100207675 3300006237 Bacteria 1702
193 Ga0097621_100313607 3300006237 Bacteria 1388
194 Ga0068871_100000463 3300006358 Bacteria 27903
195 Ga0068871_100043321 3300006358 Bacteria 3615
196 Ga0068871_100320039 3300006358 Bacteria 1365
197 Ga0075428_100195225 3300006844 Bacteria 2189
198 Ga0075428_100382866 3300006844 Bacteria 1508
199 Ga0075430_100054607 3300006846 Bacteria 3361
200 Ga0075431_100000405 3300006847 Bacteria 34877
201 Ga0075431_100703394 3300006847 Bacteria 988
202 Ga0075433_10550132 3300006852 Bacteria 1015
203 Ga0075433_11205073 3300006852 Unclassified 657
204 Ga0075434_100388254 3300006871 Bacteria 1417
205 Ga0075434_100780632 3300006871 Bacteria 972
206 Ga0075429_100017441 3300006880 Bacteria 6208
207 Ga0075429_100753562 3300006880 Bacteria 853
208 Ga0075429_100909153 3300006880 Bacteria 770
209 Ga0068865_100000529 3300006881 Bacteria 21356
210 Ga0068865_100110321 3300006881 Bacteria 2028
211 Ga0068865_100181633 3300006881 Bacteria 1620
212 Ga0068865_100563197 3300006881 Bacteria 958
213 Ga0075436_100625478 3300006914 Unclassified 794
214 Ga0097620_100031545 3300006931 Bacteria 5322
215 Ga0097620_100042160 3300006931 Bacteria 4584
216 Ga0097620_100084376 3300006931 Bacteria 3222
217 Ga0097620_101111332 3300006931 Bacteria 869
218 Ga0105251_10347355 3300009011 Bacteria 677
219 Ga0111539_10008285 3300009094 Bacteria 13231
220 Ga0111539_10166798 3300009094 Bacteria 2574
221 Ga0111539_10205558 3300009094 Bacteria 2295
222 Ga0111539_10427340 3300009094 Bacteria 1543
223 Ga0111539_10445061 3300009094 Bacteria 1509
224 Ga0111539_10776304 3300009094 Bacteria 1115
225 Ga0111539_11367727 3300009094 Bacteria 821
226 Ga0111539_12300240 3300009094 Bacteria 625
227 Ga0105245_10001373 3300009098 Bacteria 22028
228 Ga0105245_10088181 3300009098 Bacteria 2849
229 Ga0105245_10748151 3300009098 Bacteria 1013
230 Ga0105245_11914274 3300009098 Bacteria 646
231 Ga0105243_10000265 3300009148 Bacteria 58881
232 Ga0105243_10046941 3300009148 Bacteria 3399
233 Ga0105243_10130322 3300009148 Bacteria 2133
234 Ga0105243_10146830 3300009148 Bacteria 2019
235 Ga0105243_11484059 3300009148 Unclassified 701
236 Ga0105241_10000819 3300009174 Bacteria 23602
237 Ga0105242_10004037 3300009176 Bacteria 11408
238 Ga0105242_10165022 3300009176 Bacteria 1942
239 Ga0105242_10320105 3300009176 Bacteria 1422
240 Ga0105242_10411928 3300009176 Unclassified 1264
241 Ga0105242_11510324 3300009176 Bacteria 703
242 Ga0105248_10002997 3300009177 Bacteria 18729
243 Ga0105248_10054534 3300009177 Bacteria 4483
244 Ga0105248_10347775 3300009177 Bacteria 1669
245 Ga0105248_10362462 3300009177 Bacteria 1632
246 Ga0105248_11551752 3300009177 Bacteria 750
247 Ga0105237_10182374 3300009545 Bacteria 2099
248 Ga0105238_10156818 3300009551 Bacteria 2251
249 Ga0105238_10319870 3300009551 Bacteria 1537
250 Ga0105238_10531760 3300009551 Bacteria 1179
251 Ga0105249_10070378 3300009553 Bacteria 3229
252 Ga0105249_10258074 3300009553 Bacteria 1731
253 Ga0105249_11730548 3300009553 Bacteria 698
254 Ga0105239_10179579 3300010375 Bacteria 2368
255 Ga0105239_10332716 3300010375 Bacteria 1713
256 Ga0105246_10211486 3300011119 Bacteria 1514
257 Ga0105246_10412066 3300011119 Bacteria 1125
258 Ga0105246_10431656 3300011119 Bacteria 1102
259 Ga0157328_1003321 3300012478 Bacteria 833
260 Ga0157371_10245366 3300013102 Bacteria 1289
261 Ga0157370_10022519 3300013104 Bacteria 6269
262 Ga0157374_10000860 3300013296 Bacteria 26547
263 Ga0157374_10209813 3300013296 Bacteria 1909
264 Ga0157374_10683187 3300013296 Bacteria 1039
265 Ga0157378_10000478 3300013297 Bacteria 38074
266 Ga0157378_10001726 3300013297 Bacteria 19632
267 Ga0157378_10100198 3300013297 Bacteria 2644
268 Ga0157378_10143942 3300013297 Bacteria 2216
269 Ga0157378_10184725 3300013297 Bacteria 1963
270 Ga0157378_10507743 3300013297 Bacteria 1205
271 Ga0157378_10944521 3300013297 Bacteria 895
272 Ga0157378_11069670 3300013297 Bacteria 843
273 Ga0163162_10099349 3300013306 Bacteria 3001
274 Ga0163162_10105559 3300013306 Bacteria 2912
275 Ga0163162_12848258 3300013306 Bacteria 557
276 Ga0157372_10413726 3300013307 Bacteria 1571
277 Ga0157372_10704470 3300013307 Unclassified 1175
278 Ga0157375_10000496 3300013308 Bacteria 35668
279 Ga0157375_10115278 3300013308 Bacteria 2790
280 Ga0157375_10164398 3300013308 Bacteria 2363
281 Ga0157375_10200480 3300013308 Bacteria 2151
282 Ga0163163_10295431 3300014325 Bacteria 1672
283 Ga0157380_10040803 3300014326 Bacteria 3618
284 Ga0157380_10335209 3300014326 Bacteria 1408
285 Ga0157380_10658535 3300014326 Bacteria 1046
286 Ga0157377_10138741 3300014745 Bacteria 1492
287 Ga0157377_10161519 3300014745 Bacteria 1394
288 Ga0157377_10649245 3300014745 Bacteria 759
289 Ga0157379_10035557 3300014968 Bacteria 4441
290 Ga0157379_10325220 3300014968 Bacteria 1404
291 Ga0157379_10907862 3300014968 Bacteria 836
292 Ga0157376_10004497 3300014969 Bacteria 9715
293 Ga0157376_10015747 3300014969 Bacteria 5722
294 Ga0157376_10055715 3300014969 Bacteria 3300
295 Ga0157376_10112186 3300014969 Bacteria 2402
296 Ga0157376_10318810 3300014969 Bacteria 1477
297 Ga0157376_10450151 3300014969 Bacteria 1256
298 Ga0157376_10548038 3300014969 Bacteria 1144
299 Ga0157376_12197770 3300014969 Bacteria 591
300 Ga0163161_10115899 3300017792 Bacteria 2008
301 Ga0163161_10155452 3300017792 Bacteria 1741
302 Ga0163161_10294604 3300017792 Bacteria 1276
303 Ga0163161_10560497 3300017792 Unclassified 937
304 Ga0207697_10011965 3300025315 Bacteria 3653
305 Ga0207682_10001311 3300025893 Bacteria 11436
306 Ga0207682_10129957 3300025893 Unclassified 1124
307 Ga0207642_10001377 3300025899 Bacteria 7544
308 Ga0207688_10296155 3300025901 Bacteria 988
309 Ga0207680_10778225 3300025903 Bacteria 686
310 Ga0207645_10109626 3300025907 Bacteria 1786
311 Ga0207645_10196517 3300025907 Bacteria 1326
312 Ga0207645_10370526 3300025907 Bacteria 960
313 Ga0207645_10502505 3300025907 Bacteria 821
314 Ga0207643_10004592 3300025908 Bacteria 7418
315 Ga0207643_10086755 3300025908 Bacteria 1819
316 Ga0207643_10104977 3300025908 Bacteria 1660
317 Ga0207705_10063839 3300025909 Bacteria 2661
318 Ga0207684_10713590 3300025910 Bacteria 851
319 Ga0207654_10004525 3300025911 Bacteria 7023
320 Ga0207707_10062251 3300025912 Bacteria 3247
321 Ga0207671_10127258 3300025914 Bacteria 1952
322 Ga0207660_10420022 3300025917 Bacteria 1079
323 Ga0207662_10003156 3300025918 Bacteria 8424
324 Ga0207662_10231946 3300025918 Bacteria 1206
325 Ga0207657_10118627 3300025919 Bacteria 2178
326 Ga0207657_10191585 3300025919 Bacteria 1649
327 Ga0207649_10002082 3300025920 Bacteria 11368
328 Ga0207652_10428048 3300025921 Unclassified 1193
329 Ga0207652_10444171 3300025921 Bacteria 1169
330 Ga0207652_10579944 3300025921 Bacteria 1007
331 Ga0207646_11047749 3300025922 Bacteria 719
332 Ga0207650_10001393 3300025925 Bacteria 17447
333 Ga0207650_10264101 3300025925 Bacteria 1397
334 Ga0207659_10001475 3300025926 Bacteria 14020
335 Ga0207659_10084861 3300025926 Bacteria 2351
336 Ga0207687_10001592 3300025927 Bacteria 15618
337 Ga0207664_11218103 3300025929 Bacteria 671
338 Ga0207644_10001467 3300025931 Bacteria 15206
339 Ga0207644_10001827 3300025931 Bacteria 13817
340 Ga0207644_10072167 3300025931 Bacteria 2528
341 Ga0207644_10129010 3300025931 Bacteria 1933
342 Ga0207690_10054275 3300025932 Bacteria 2694
343 Ga0207690_10085975 3300025932 Bacteria 2209
344 Ga0207690_10264873 3300025932 Bacteria 1333
345 Ga0207690_10489242 3300025932 Bacteria 994
346 Ga0207706_10152175 3300025933 Bacteria 2035
347 Ga0207706_10153386 3300025933 Bacteria 2026
348 Ga0207706_10233702 3300025933 Bacteria 1608
349 Ga0207706_10353465 3300025933 Bacteria 1277
350 Ga0207686_10000731 3300025934 Bacteria 20402
351 Ga0207709_10007485 3300025935 Bacteria 6077
352 Ga0207709_10474435 3300025935 Bacteria 972
353 Ga0207670_10017647 3300025936 Bacteria 4317
354 Ga0207670_10041057 3300025936 Bacteria 3040
355 Ga0207670_10047175 3300025936 Bacteria 2867
356 Ga0207669_10067408 3300025937 Bacteria 2230
357 Ga0207669_10196988 3300025937 Bacteria 1459
358 Ga0207669_10926075 3300025937 Bacteria 729
359 Ga0207704_10005518 3300025938 Bacteria 5830
360 Ga0207704_10309803 3300025938 Bacteria 1213
361 Ga0207704_10856168 3300025938 Unclassified 762
362 Ga0207665_10290852 3300025939 Bacteria 1218
363 Ga0207691_10000667 3300025940 Bacteria 33915
364 Ga0207691_10125844 3300025940 Bacteria 2268
365 Ga0207691_10635941 3300025940 Bacteria 902
366 Ga0207711_10043907 3300025941 Bacteria 3814
367 Ga0207711_10259755 3300025941 Unclassified 1596
368 Ga0207711_10395287 3300025941 Bacteria 1284
369 Ga0207689_10001388 3300025942 Bacteria 23186
370 Ga0207689_10013184 3300025942 Bacteria 7053
371 Ga0207689_10118976 3300025942 Bacteria 2173
372 Ga0207661_10000839 3300025944 Bacteria 20168
373 Ga0207679_10000649 3300025945 Bacteria 23237
374 Ga0207679_10096147 3300025945 Bacteria 2304
375 Ga0207679_10199423 3300025945 Bacteria 1671
376 Ga0207679_10439041 3300025945 Bacteria 1155
377 Ga0207679_10445227 3300025945 Bacteria 1148
378 Ga0207679_11999350 3300025945 Unclassified 528
379 Ga0207651_10070595 3300025960 Bacteria 2471
380 Ga0207651_10926664 3300025960 Bacteria 776
381 Ga0207651_11175755 3300025960 Bacteria 688
382 Ga0207712_10599567 3300025961 Unclassified 953
383 Ga0207668_10085487 3300025972 Bacteria 2302
384 Ga0207668_10192960 3300025972 Bacteria 1616
385 Ga0207668_10196614 3300025972 Bacteria 1603
386 Ga0207640_10004522 3300025981 Bacteria 7548
387 Ga0207640_10101233 3300025981 Bacteria 2021
388 Ga0207640_11683278 3300025981 Unclassified 572
389 Ga0207658_10016377 3300025986 Bacteria 5099
390 Ga0207658_10193833 3300025986 Bacteria 1691
391 Ga0207658_11051146 3300025986 Bacteria 743
392 Ga0207677_10002637 3300026023 Bacteria 9439
393 Ga0207677_10010843 3300026023 Bacteria 5170
394 Ga0207677_10139271 3300026023 Bacteria 1855
395 Ga0207677_10358060 3300026023 Bacteria 1225
396 Ga0207677_10479944 3300026023 Unclassified 1071
397 Ga0207703_10010025 3300026035 Bacteria 7427
398 Ga0207703_10302758 3300026035 Bacteria 1458
399 Ga0207703_10303459 3300026035 Bacteria 1457
400 Ga0207703_10470146 3300026035 Bacteria 1177
401 Ga0207639_10091566 3300026041 Bacteria 2435
402 Ga0207708_10000129 3300026075 Bacteria 59106
403 Ga0207708_10001911 3300026075 Bacteria 15389
404 Ga0207708_10214475 3300026075 Bacteria 1540
405 Ga0207708_10474039 3300026075 Bacteria 1046
406 Ga0207708_10916452 3300026075 Bacteria 759
407 Ga0207702_10044117 3300026078 Bacteria 3747
408 Ga0207702_10204760 3300026078 Bacteria 1831
409 Ga0207641_10053759 3300026088 Bacteria 3415
410 Ga0207641_10423968 3300026088 Bacteria 1281
411 Ga0207641_10574605 3300026088 Bacteria 1101
412 Ga0207648_10000832 3300026089 Bacteria 34738
413 Ga0207648_10032821 3300026089 Bacteria 4581
414 Ga0207648_10081734 3300026089 Unclassified 2817
415 Ga0207648_10161631 3300026089 Bacteria 1978
416 Ga0207676_10224720 3300026095 Bacteria 1674
417 Ga0207676_10338282 3300026095 Bacteria 1387
418 Ga0207676_10619360 3300026095 Bacteria 1041
419 Ga0207676_10820185 3300026095 Bacteria 908
420 Ga0207675_100003765 3300026118 Bacteria 14780
421 Ga0207675_100009662 3300026118 Bacteria 9027
422 Ga0207675_100073048 3300026118 Bacteria 3209
423 Ga0207675_100906473 3300026118 Bacteria 898
424 Ga0207675_101575766 3300026118 Bacteria 677
425 Ga0207683_10001353 3300026121 Bacteria 22149
426 Ga0207683_10017181 3300026121 Bacteria 6160
427 Ga0207683_10044602 3300026121 Bacteria 3876
428 Ga0207683_10109333 3300026121 Bacteria 2474
429 Ga0207683_10117033 3300026121 Bacteria 2390
430 Ga0207698_10000201 3300026142 Bacteria 37485
431 Ga0207698_10262088 3300026142 Bacteria 1588
432 Ga0209969_1001193 3300027360 Bacteria 3576
433 Ga0209969_1028386 3300027360 Bacteria 850
434 Ga0209967_1029195 3300027364 Bacteria 823
435 Ga0209981_1015878 3300027378 Bacteria 1056
436 Ga0210000_1003606 3300027462 Bacteria 2233
437 Ga0209995_1002446 3300027471 Bacteria 2933
438 Ga0209999_1068730 3300027543 Unclassified 678
439 Ga0210002_1031951 3300027617 Bacteria 877
440 Ga0209983_1042994 3300027665 Bacteria 980
441 Ga0209971_1007110 3300027682 Bacteria 2654
442 Ga0209974_10003811 3300027876 Bacteria 5405
443 Ga0209974_10066366 3300027876 Bacteria 1226
444 Ga0207428_10049937 3300027907 Bacteria 3349
445 Ga0268266_10163750 3300028379 Bacteria 2014
446 Ga0268265_10178882 3300028380 Bacteria 1821
447 Ga0268265_10378249 3300028380 Bacteria 1302
448 Ga0268265_10452507 3300028380 Unclassified 1199
449 Ga0268265_11255294 3300028380 Bacteria 740
450 Ga0268264_10004398 3300028381 Bacteria 12023
451 Ga0268264_10541752 3300028381 Bacteria 1140
452 Ga0268264_11360842 3300028381 Bacteria 720
453 Ga0265318_10004551 3300028577 Bacteria 6702
454 Ga0265338_10212015 3300028800 Bacteria 1453
455 Ga0265330_10117223 3300031235 Bacteria 1135
456 Ga0265332_10002198 3300031238 Bacteria 10012
457 Ga0265328_10003085 3300031239 Bacteria 7435
458 Ga0265320_10159888 3300031240 Bacteria 1014
459 Ga0265325_10098849 3300031241 Bacteria 1431
460 Ga0265325_10118444 3300031241 Bacteria 1279
461 Ga0265340_10415926 3300031247 Unclassified 593
462 Ga0265339_10179697 3300031249 Bacteria 1054
463 Ga0265331_10007426 3300031250 Bacteria 6342
464 Ga0265331_10308283 3300031250 Bacteria 709
465 Ga0265327_10194463 3300031251 Bacteria 922
466 Ga0265316_10028156 3300031344 Bacteria 4638
467 Ga0307408_100055991 3300031548 Bacteria 2858
468 Ga0307408_100663447 3300031548 Bacteria 934
469 Ga0316575_10000646 3300031665 Bacteria 10276
470 Ga0265314_10000335 3300031711 Bacteria 66101
471 Ga0265342_10006633 3300031712 Bacteria 8590
472 Ga0307413_10567800 3300031824 Bacteria 923
473 Ga0307410_10245418 3300031852 Unclassified 1390
474 Ga0307406_10137741 3300031901 Bacteria 1723
475 Ga0307407_10023684 3300031903 Bacteria 3207
476 Ga0307407_10481316 3300031903 Unclassified 906
477 Ga0307412_11400816 3300031911 Bacteria 633
478 Ga0307416_100394459 3300032002 Bacteria 1419
479 Ga0307411_10269668 3300032005 Bacteria 1349
480 Ga0316593_10223761 3300032168 Bacteria 699
481 Ga0373938_0155007 3300034957 Unclassified 612
482 Ga0373961_0097381 3300035241 Unclassified 948
483 Ga0373937_0455475 3300036401 Bacteria 1215
484 Ga0373937_0685105 3300036401 Bacteria 971
485 Ga0316582_0442961 3300036647 Bacteria 895
486 Ga0395900_0073722 3300037418 Bacteria 3510
487 Ga0395900_1601182 3300037418 Bacteria 563
488 Ga0436364_0126953 3300037853 Unclassified 581
489 Ga0395901_0160145 3300038443 Bacteria 2364
490 Ga0451800_0675414 3300041459 Bacteria 923
491 Ga0451839_1174650 3300041496 Unclassified 572
492 Ga0451851_0448351 3300041507 Bacteria 812
493 Ga0451853_3741827 3300041512 Bacteria 1016
494 Ga0439441_028201 3300042001 Bacteria 1075
495 Ga0450920_089859 3300042122 Bacteria 633
496 Ga0439460_0107505 3300042461 Unclassified 902
497 Ga0451577_0384248 3300042876 Bacteria 1274
498 Ga0451577_0481347 3300042876 Bacteria 1127
499 Ga0451577_0924007 3300042876 Bacteria 785
500 Ga0451577_1278795 3300042876 Bacteria 653
501 Ga0451576_0139152 3300045051 Bacteria 2532
502 Ga0451576_0664028 3300045051 Bacteria 1095
503 Ga0451576_1445534 3300045051 Bacteria 715
504 Ga0451576_1661116 3300045051 Bacteria 662
505 Ga0495598_0143007 3300046537 Bacteria 829
506 Ga0495621_0144443 3300046539 Bacteria 933
507 Ga0495657_0471402 3300046675 Bacteria 734
508 Ga0495658_0415820 3300046683 Bacteria 858
509 Ga0495669_0112754 3300046684 Bacteria 1271
510 Ga0495674_0554905 3300047319 Unclassified 914
511 Ga0496100_0025668 3300048903 Bacteria 3605
512 Ga0496100_0542356 3300048903 Bacteria 899
513 Ga0496101_0785182 3300048904 Bacteria 751
514 Ga0496102_0352229 3300048905 Bacteria 1386
515 Ga0496102_0563425 3300048905 Bacteria 1062
516 Ga0496103_0578646 3300048906 Bacteria 716
517 Ga0496106_0150399 3300048909 Bacteria 1836
518 Ga0496106_0375385 3300048909 Bacteria 1143
519 Ga0496106_0725224 3300048909 Unclassified 791
520 Ga0496108_0000486 3300048911 Bacteria 31881
521 Ga0496108_0016784 3300048911 Bacteria 5981
522 Ga0496108_0232622 3300048911 Bacteria 1603
523 Ga0496108_0299453 3300048911 Unclassified 1401
524 Ga0496108_0557049 3300048911 Bacteria 1000
525 Ga0496109_0023255 3300048912 Bacteria 5498
526 Ga0496109_0395651 3300048912 Unclassified 1305
527 Ga0496109_0544305 3300048912 Bacteria 1095
528 Ga0496110_0002637 3300048913 Bacteria 13510
529 Ga0496110_0085102 3300048913 Bacteria 2823
530 Ga0496110_0113811 3300048913 Bacteria 2434
531 Ga0496110_0470690 3300048913 Unclassified 1145
532 Ga0496110_0576307 3300048913 Bacteria 1022
533 Ga0496110_0697609 3300048913 Bacteria 916
534 Ga0496111_0022060 3300048914 Bacteria 4454
535 Ga0496112_0085485 3300048915 Bacteria 3121
536 Ga0496112_0783381 3300048915 Bacteria 879
537 Ga0496112_0797736 3300048915 Bacteria 869
538 Ga0496113_0491388 3300048916 Bacteria 986
539 Ga0496114_0003483 3300048917 Bacteria 12084
540 Ga0496114_0014858 3300048917 Bacteria 6257
541 Ga0496114_0022368 3300048917 Bacteria 5152
542 Ga0496114_0039604 3300048917 Bacteria 3900
543 Ga0496114_0426887 3300048917 Bacteria 1174
544 Ga0496115_0621864 3300048918 Unclassified 857
545 Ga0501291_036186 3300049514 Unclassified 852
546 Ga0501292_072560 3300049515 Unclassified 642
547 Ga0501303_016378 3300049526 Unclassified 750
548 Ga0501031_0001740 3300049568 Bacteria 13649
549 Ga0501031_0005296 3300049568 Bacteria 8400
550 Ga0501031_0479581 3300049568 Unclassified 803
551 Ga0501032_0000036 3300049569 Bacteria 117044
552 Ga0501032_0001298 3300049569 Bacteria 20031
553 Ga0501032_0017413 3300049569 Bacteria 5046
554 Ga0501032_0019264 3300049569 Bacteria 4775
555 Ga0501032_0080143 3300049569 Bacteria 2173
556 Ga0501032_0322917 3300049569 Bacteria 996
557 Ga0501032_0456742 3300049569 Bacteria 818
558 Ga0501033_0000119 3300049570 Bacteria 75685
559 Ga0501033_0001013 3300049570 Bacteria 25514
560 Ga0501033_0028983 3300049570 Bacteria 4159
561 Ga0501033_0173379 3300049570 Bacteria 1548
562 Ga0501033_0629440 3300049570 Bacteria 734
563 Ga0501034_0000271 3300049571 Bacteria 93642
564 Ga0501034_0004822 3300049571 Bacteria 14903
565 Ga0501034_0023031 3300049571 Bacteria 6347
566 Ga0501034_0045048 3300049571 Bacteria 4459
567 Ga0501034_0159642 3300049571 Bacteria 2226
568 Ga0501036_0002016 3300049572 Bacteria 15801
569 Ga0501036_0009002 3300049572 Bacteria 8210
570 Ga0501036_0013778 3300049572 Bacteria 6726
571 Ga0501036_0043956 3300049572 Bacteria 3783
572 Ga0501036_0204056 3300049572 Bacteria 1662
573 Ga0501036_0372287 3300049572 Bacteria 1192
574 Ga0501036_1600796 3300049572 Unclassified 526
575 Ga0501037_0002311 3300049573 Bacteria 13768
576 Ga0501037_0046784 3300049573 Bacteria 3172
577 Ga0501037_0123254 3300049573 Bacteria 1862
578 Ga0501037_0448467 3300049573 Bacteria 880
579 Ga0501038_0003772 3300049574 Bacteria 14101
580 Ga0501038_0003881 3300049574 Bacteria 13896
581 Ga0501038_0004679 3300049574 Bacteria 12740
582 Ga0501038_0008180 3300049574 Bacteria 9624
583 Ga0501038_0035791 3300049574 Bacteria 4358
584 Ga0501038_0040968 3300049574 Bacteria 4041
585 Ga0501038_0121712 3300049574 Bacteria 2151
586 Ga0501038_0276371 3300049574 Bacteria 1323
587 Ga0501038_0361900 3300049574 Bacteria 1128
588 Ga0501038_0399187 3300049574 Bacteria 1064
589 Ga0501039_0047756 3300049575 Bacteria 3309
590 Ga0501039_0090357 3300049575 Bacteria 2386
591 Ga0501039_0111413 3300049575 Bacteria 2139
592 Ga0501039_0114331 3300049575 Bacteria 2111
593 Ga0501039_0545614 3300049575 Bacteria 910
594 Ga0501040_0109705 3300049576 Bacteria 1929
595 Ga0501040_0978782 3300049576 Unclassified 613
596 Ga0501041_0000884 3300049577 Bacteria 16204
597 Ga0501041_0329503 3300049577 Bacteria 964
598 Ga0501042_0000160 3300049578 Bacteria 30676
599 Ga0501042_0012578 3300049578 Bacteria 5737
600 Ga0501043_0001217 3300049579 Bacteria 22685
601 Ga0501043_0002370 3300049579 Bacteria 15941
602 Ga0501043_0027284 3300049579 Bacteria 4484
603 Ga0501043_0192960 3300049579 Bacteria 1583
604 Ga0501043_0278837 3300049579 Bacteria 1282
605 Ga0501043_0312381 3300049579 Bacteria 1199
606 Ga0501043_0393494 3300049579 Bacteria 1048
607 Ga0501046_0001638 3300049580 Bacteria 21434
608 Ga0501046_0013430 3300049580 Bacteria 6933
609 Ga0501046_0102797 3300049580 Bacteria 2191
610 Ga0501046_0153360 3300049580 Bacteria 1737
611 Ga0501047_0001434 3300049581 Bacteria 23400
612 Ga0501048_0018606 3300049582 Bacteria 5107
613 Ga0501048_0053128 3300049582 Bacteria 2882
614 Ga0501068_0001085 3300049584 Bacteria 14415
615 Ga0501068_0003260 3300049584 Bacteria 8702
616 Ga0501069_0004756 3300049585 Bacteria 7025
617 Ga0501070_0007076 3300049586 Bacteria 9541
618 Ga0501070_0096236 3300049586 Unclassified 2449
619 Ga0501070_0178475 3300049586 Unclassified 1748
620 Ga0501070_0387582 3300049586 Bacteria 1131
621 Ga0501071_0004045 3300049587 Bacteria 9266
622 Ga0501071_0032387 3300049587 Bacteria 3712
623 Ga0501071_0118205 3300049587 Bacteria 1964
624 Ga0501071_0376774 3300049587 Bacteria 1082
625 Ga0501072_0001879 3300049588 Bacteria 15634
626 Ga0501072_0023582 3300049588 Bacteria 4779
627 Ga0501072_0039012 3300049588 Bacteria 3729
628 Ga0501073_0064876 3300049589 Bacteria 2546
629 Ga0501073_0227933 3300049589 Bacteria 1287
630 Ga0501074_0051996 3300049590 Bacteria 2957
631 Ga0501074_0110609 3300049590 Bacteria 1966
632 Ga0501074_0984873 3300049590 Bacteria 593
633 Ga0501074_1062785 3300049590 Bacteria 569
634 Ga0501075_0000323 3300049591 Bacteria 26840
635 Ga0501075_0013386 3300049591 Bacteria 5855
636 Ga0501075_0617403 3300049591 Bacteria 827
637 Ga0501075_0711578 3300049591 Bacteria 765
638 Ga0501076_0002782 3300049592 Bacteria 12115
639 Ga0501076_0010748 3300049592 Bacteria 6806
640 Ga0501076_1487784 3300049592 Unclassified 556
641 Ga0501077_0160270 3300049593 Bacteria 1428
642 Ga0501077_0176033 3300049593 Bacteria 1359
643 Ga0501079_0001098 3300049741 Bacteria 18809
644 Ga0501079_0076947 3300049741 Bacteria 2581
645 Ga0501079_0704951 3300049741 Bacteria 794
646 Ga0501080_0009212 3300049742 Bacteria 8996
647 Ga0501080_0020812 3300049742 Bacteria 6073
648 Ga0501080_0025182 3300049742 Bacteria 5522
649 Ga0501080_0319408 3300049742 Unclassified 1406
650 Ga0501081_0006454 3300049743 Bacteria 7611
651 Ga0501081_0152614 3300049743 Bacteria 1660
652 Ga0501081_0225830 3300049743 Bacteria 1363
653 Ga0501083_0097663 3300049744 Bacteria 1938
654 Ga0501083_0116386 3300049744 Bacteria 1755
655 Ga0501283_011376 3300049779 Bacteria 1323
656 Ga0501035_0000803 3300049822 Bacteria 33453
657 Ga0501035_0018898 3300049822 Bacteria 6350
658 Ga0501035_0031131 3300049822 Bacteria 4859
659 Ga0501035_0032552 3300049822 Bacteria 4742
660 Ga0501035_0251116 3300049822 Bacteria 1502
661 Ga0501035_0303103 3300049822 Bacteria 1346
662 Ga0501035_0756416 3300049822 Unclassified 779
663 Ga0501044_0000093 3300049823 Bacteria 109832
664 Ga0501044_0000891 3300049823 Bacteria 36042
665 Ga0501044_0054489 3300049823 Bacteria 4110
666 Ga0501044_0117949 3300049823 Bacteria 2657
667 Ga0501044_0180241 3300049823 Bacteria 2080
668 Ga0501045_0003332 3300049824 Bacteria 10988
669 Ga0501045_0006518 3300049824 Bacteria 8092
670 Ga0501045_0027468 3300049824 Bacteria 4101
671 Ga0501045_0148804 3300049824 Bacteria 1742
672 nmdc:mga00v17_774946_c1 3300050491 Bacteria 612
673 nmdc:mga09592_11799_c1 3300050508 Bacteria 6378
674 nmdc:mga0qj67_450516_c1 3300050509 Bacteria 1037
675 nmdc:mga06r32_20793_c1 3300050510 Bacteria 6047
676 nmdc:mga06r32_938760_c1 3300050510 Unclassified 820
677 nmdc:mga08y16_1182252_c1 3300050511 Bacteria 736
678 nmdc:mga08y16_165794_c1 3300050511 Bacteria 2295
679 nmdc:mga08y16_201860_c1 3300050511 Bacteria 2060
680 nmdc:mga08y16_20638_c1 3300050511 Bacteria 6953
681 nmdc:mga08y16_294486_c1 3300050511 Bacteria 1673
682 nmdc:mga08y16_57622_c1 3300050511 Bacteria 4059
683 nmdc:mga0n895_1379198_c1 3300050512 Bacteria 674
684 nmdc:mga0n895_1757049_c1 3300050512 Bacteria 582
685 nmdc:mga0n895_85304_c1 3300050512 Bacteria 3152
686 nmdc:mga0rr50_756637_c1 3300050513 Bacteria 829
687 nmdc:mga08x19_320660_c1 3300050514 Unclassified 1078
688 nmdc:mga0a205_196585_c1 3300050515 Bacteria 1907
689 Ga0501084_0002787 3300054114 Bacteria 14106
690 Ga0501084_0301899 3300054114 Bacteria 1352
691 Ga0501082_0015215 3300060353 Bacteria 6629
692 Ga0530510_0001359 3300061734 Bacteria 16344
693 Ga0530510_0220556 3300061734 Bacteria 1409
694 Ga0530510_0626931 3300061734 Bacteria 818

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031250 Ga0265331_10308283 Ga0265331_103082832 134
2 3300049593 Ga0501077_0176033 Ga0501077_0176033_19_432 135
3 3300005340 Ga0070689_101490005 Ga0070689_1014900052 145
4 3300005466 Ga0070685_10124928 Ga0070685_101249283 145
5 3300005844 Ga0068862_101093861 Ga0068862_1010938612 145
6 3300006237 Ga0097621_100313607 Ga0097621_1003136073 145
7 3300013306 Ga0163162_12848258 Ga0163162_128482582 145
8 3300014326 Ga0157380_10335209 Ga0157380_103352092 145
9 3300014969 Ga0157376_10548038 Ga0157376_105480382 145
10 3300026118 Ga0207675_100906473 Ga0207675_1009064732 145
11 3300025933 Ga0207706_10152175 Ga0207706_101521753 146
12 3300042122 Ga0450920_089859 Ga0450920_089859_60_572 147
13 3300049571 Ga0501034_0023031 Ga0501034_0023031_116_559 147
14 3300049574 Ga0501038_0003772 Ga0501038_0003772_7563_8045 147
15 3300005343 Ga0070687_100573961 Ga0070687_1005739611 148
16 3300005355 Ga0070671_100050216 Ga0070671_1000502163 148
17 3300005439 Ga0070711_101545011 Ga0070711_1015450111 148
18 3300005615 Ga0070702_100304206 Ga0070702_1003042062 148
19 3300005841 Ga0068863_100415522 Ga0068863_1004155222 148
20 3300005985 Ga0081539_10129038 Ga0081539_101290381 148
21 3300006847 Ga0075431_100703394 Ga0075431_1007033941 148
22 3300025931 Ga0207644_10001827 Ga0207644_100018273 148
23 3300042876 Ga0451577_0924007 Ga0451577_0924007_321_773 148
24 3300049590 Ga0501074_1062785 Ga0501074_1062785_12_473 148
25 3300050510 nmdc:mga06r32_938760_c1 nmdc:mga06r32_938760_c1_341_790 148
26 3300005340 Ga0070689_100801509 Ga0070689_1008015091 149
27 3300009148 Ga0105243_11484059 Ga0105243_114840592 149
28 3300031241 Ga0265325_10098849 Ga0265325_100988492 149
29 3300031251 Ga0265327_10194463 Ga0265327_101944632 149
30 3300045051 Ga0451576_1661116 Ga0451576_1661116_22_471 149
31 3300005340 Ga0070689_100010875 Ga0070689_1000108754 150
32 3300005467 Ga0070706_100243303 Ga0070706_1002433032 150
33 3300005618 Ga0068864_102437372 Ga0068864_1024373721 150
34 3300005841 Ga0068863_100052247 Ga0068863_1000522472 150
35 3300006173 Ga0070716_100241005 Ga0070716_1002410052 150
36 3300006871 Ga0075434_100388254 Ga0075434_1003882542 150
37 3300006914 Ga0075436_100625478 Ga0075436_1006254781 150
38 3300009094 Ga0111539_10166798 Ga0111539_101667982 150
39 3300025910 Ga0207684_10713590 Ga0207684_107135903 150
40 3300025922 Ga0207646_11047749 Ga0207646_110477491 150
41 3300025936 Ga0207670_10041057 Ga0207670_100410572 150
42 3300025939 Ga0207665_10290852 Ga0207665_102908522 150
43 3300026088 Ga0207641_10574605 Ga0207641_105746052 150
44 3300031247 Ga0265340_10415926 Ga0265340_104159262 150
45 3300045051 Ga0451576_0139152 Ga0451576_0139152_73_531 150
46 3300045051 Ga0451576_1445534 Ga0451576_1445534_155_613 150
47 3300047319 Ga0495674_0554905 Ga0495674_0554905_33_491 150
48 3300050511 nmdc:mga08y16_294486_c1 nmdc:mga08y16_294486_c1_1132_1590 150
49 3300050512 nmdc:mga0n895_1379198_c1 nmdc:mga0n895_1379198_c1_145_603 150
50 3300050514 nmdc:mga08x19_320660_c1 nmdc:mga08x19_320660_c1_186_644 150
51 3300005328 Ga0070676_10450267 Ga0070676_104502672 156
52 3300005330 Ga0070690_100029641 Ga0070690_1000296413 156
53 3300005334 Ga0068869_100003052 Ga0068869_1000030522 156
54 3300005336 Ga0070680_100050071 Ga0070680_1000500713 156
55 3300005338 Ga0068868_100157105 Ga0068868_1001571054 156
56 3300005338 Ga0068868_100455482 Ga0068868_1004554822 156
57 3300005340 Ga0070689_100002386 Ga0070689_1000023867 156
58 3300005341 Ga0070691_10008905 Ga0070691_100089052 156
59 3300005345 Ga0070692_10026458 Ga0070692_100264582 156
60 3300005347 Ga0070668_100833327 Ga0070668_1008333272 156
61 3300005366 Ga0070659_100202170 Ga0070659_1002021702 156
62 3300005435 Ga0070714_100107982 Ga0070714_1001079823 156
63 3300005438 Ga0070701_10000068 Ga0070701_100000687 156
64 3300005441 Ga0070700_100031382 Ga0070700_1000313822 156
65 3300005441 Ga0070700_100406901 Ga0070700_1004069012 156
66 3300005441 Ga0070700_101008062 Ga0070700_1010080621 156
67 3300005444 Ga0070694_100162003 Ga0070694_1001620031 156
68 3300005455 Ga0070663_100086998 Ga0070663_1000869983 156
69 3300005457 Ga0070662_100217514 Ga0070662_1002175142 156
70 3300005458 Ga0070681_10156805 Ga0070681_101568053 156
71 3300005459 Ga0068867_100007256 Ga0068867_1000072565 156
72 3300005466 Ga0070685_10699909 Ga0070685_106999092 156
73 3300005530 Ga0070679_100074056 Ga0070679_1000740564 156
74 3300005530 Ga0070679_100643568 Ga0070679_1006435681 156
75 3300005539 Ga0068853_100538909 Ga0068853_1005389092 156
76 3300005544 Ga0070686_100001003 Ga0070686_10000100313 156
77 3300005545 Ga0070695_100022132 Ga0070695_1000221322 156
78 3300005545 Ga0070695_100139908 Ga0070695_1001399082 156
79 3300005546 Ga0070696_100020029 Ga0070696_1000200295 156
80 3300005547 Ga0070693_100136915 Ga0070693_1001369152 156
81 3300005549 Ga0070704_100008155 Ga0070704_1000081556 156
82 3300005614 Ga0068856_100931596 Ga0068856_1009315962 156
83 3300005615 Ga0070702_100000040 Ga0070702_1000000402 156
84 3300005617 Ga0068859_100031545 Ga0068859_1000315454 156
85 3300005718 Ga0068866_10001473 Ga0068866_100014732 156
86 3300005719 Ga0068861_100000658 Ga0068861_10000065815 156
87 3300005840 Ga0068870_10003999 Ga0068870_100039996 156
88 3300005842 Ga0068858_100003367 Ga0068858_1000033676 156
89 3300005843 Ga0068860_100079128 Ga0068860_1000791283 156
90 3300006237 Ga0097621_100003464 Ga0097621_1000034649 156
91 3300006358 Ga0068871_100043321 Ga0068871_1000433214 156
92 3300006852 Ga0075433_11205073 Ga0075433_112050731 156
93 3300006881 Ga0068865_100000529 Ga0068865_10000052914 156
94 3300006931 Ga0097620_100031545 Ga0097620_1000315454 156
95 3300009094 Ga0111539_10008285 Ga0111539_1000828510 156
96 3300009094 Ga0111539_10427340 Ga0111539_104273402 156
97 3300009094 Ga0111539_11367727 Ga0111539_113677271 156
98 3300009098 Ga0105245_10001373 Ga0105245_100013738 156
99 3300009148 Ga0105243_10000265 Ga0105243_1000026550 156
100 3300009176 Ga0105242_10004037 Ga0105242_100040373 156
101 3300009177 Ga0105248_10347775 Ga0105248_103477752 156
102 3300009551 Ga0105238_10319870 Ga0105238_103198702 156
103 3300009553 Ga0105249_10258074 Ga0105249_102580742 156
104 3300011119 Ga0105246_10431656 Ga0105246_104316562 156
105 3300013104 Ga0157370_10022519 Ga0157370_100225192 156
106 3300013297 Ga0157378_10000478 Ga0157378_100004783 156
107 3300013306 Ga0163162_10099349 Ga0163162_100993495 156
108 3300013307 Ga0157372_10413726 Ga0157372_104137262 156
109 3300013307 Ga0157372_10704470 Ga0157372_107044702 156
110 3300014326 Ga0157380_10040803 Ga0157380_100408033 156
111 3300014968 Ga0157379_10035557 Ga0157379_100355573 156
112 3300014969 Ga0157376_10055715 Ga0157376_100557153 156
113 3300014969 Ga0157376_10318810 Ga0157376_103188101 156
114 3300017792 Ga0163161_10560497 Ga0163161_105604972 156
115 3300025899 Ga0207642_10001377 Ga0207642_100013772 156
116 3300025908 Ga0207643_10086755 Ga0207643_100867552 156
117 3300025919 Ga0207657_10118627 Ga0207657_101186272 156
118 3300025921 Ga0207652_10428048 Ga0207652_104280482 156
119 3300025927 Ga0207687_10001592 Ga0207687_1000159215 156
120 3300025929 Ga0207664_11218103 Ga0207664_112181031 156
121 3300025932 Ga0207690_10054275 Ga0207690_100542752 156
122 3300025933 Ga0207706_10153386 Ga0207706_101533862 156
123 3300025933 Ga0207706_10353465 Ga0207706_103534652 156
124 3300025934 Ga0207686_10000731 Ga0207686_100007317 156
125 3300025935 Ga0207709_10007485 Ga0207709_100074853 156
126 3300025936 Ga0207670_10017647 Ga0207670_100176472 156
127 3300025938 Ga0207704_10005518 Ga0207704_100055182 156
128 3300025941 Ga0207711_10259755 Ga0207711_102597553 156
129 3300025961 Ga0207712_10599567 Ga0207712_105995672 156
130 3300026023 Ga0207677_10479944 Ga0207677_104799442 156
131 3300026035 Ga0207703_10010025 Ga0207703_100100257 156
132 3300026075 Ga0207708_10000129 Ga0207708_1000012923 156
133 3300026075 Ga0207708_10474039 Ga0207708_104740392 156
134 3300026078 Ga0207702_10204760 Ga0207702_102047602 156
135 3300026089 Ga0207648_10000832 Ga0207648_1000083228 156
136 3300026118 Ga0207675_100003765 Ga0207675_1000037652 156
137 3300026121 Ga0207683_10017181 Ga0207683_100171812 156
138 3300027907 Ga0207428_10049937 Ga0207428_100499372 156
139 3300028380 Ga0268265_10452507 Ga0268265_104525072 156
140 3300028381 Ga0268264_10004398 Ga0268264_100043983 156
141 3300037418 Ga0395900_0073722 Ga0395900_0073722_447_929 156
142 3300037418 Ga0395900_1601182 Ga0395900_1601182_33_515 156
143 3300038443 Ga0395901_0160145 Ga0395901_0160145_810_1292 156
144 3300048903 Ga0496100_0542356 Ga0496100_0542356_247_729 156
145 3300048909 Ga0496106_0375385 Ga0496106_0375385_573_1055 156
146 3300048909 Ga0496106_0725224 Ga0496106_0725224_57_539 156
147 3300048911 Ga0496108_0016784 Ga0496108_0016784_4112_4594 156
148 3300048911 Ga0496108_0557049 Ga0496108_0557049_67_549 156
149 3300048912 Ga0496109_0395651 Ga0496109_0395651_698_1180 156
150 3300048912 Ga0496109_0544305 Ga0496109_0544305_291_773 156
151 3300048913 Ga0496110_0085102 Ga0496110_0085102_1347_1829 156
152 3300048915 Ga0496112_0085485 Ga0496112_0085485_2005_2487 156
153 3300048917 Ga0496114_0003483 Ga0496114_0003483_7449_7931 156
154 3300048917 Ga0496114_0022368 Ga0496114_0022368_806_1288 156
155 3300048918 Ga0496115_0621864 Ga0496115_0621864_178_660 156
156 3300049568 Ga0501031_0001740 Ga0501031_0001740_8897_9439 156
157 3300049568 Ga0501031_0005296 Ga0501031_0005296_5843_6325 156
158 3300049568 Ga0501031_0479581 Ga0501031_0479581_17_499 156
159 3300049569 Ga0501032_0000036 Ga0501032_0000036_16734_17276 156
160 3300049569 Ga0501032_0001298 Ga0501032_0001298_11687_12175 156
161 3300049569 Ga0501032_0017413 Ga0501032_0017413_3078_3560 156
162 3300049569 Ga0501032_0019264 Ga0501032_0019264_2394_2876 156
163 3300049569 Ga0501032_0080143 Ga0501032_0080143_466_1011 156
164 3300049570 Ga0501033_0000119 Ga0501033_0000119_18984_19466 156
165 3300049570 Ga0501033_0001013 Ga0501033_0001013_5139_5621 156
166 3300049570 Ga0501033_0028983 Ga0501033_0028983_1791_2333 156
167 3300049570 Ga0501033_0629440 Ga0501033_0629440_52_534 156
168 3300049571 Ga0501034_0004822 Ga0501034_0004822_5337_5879 156
169 3300049571 Ga0501034_0159642 Ga0501034_0159642_524_1006 156
170 3300049572 Ga0501036_0002016 Ga0501036_0002016_13246_13788 156
171 3300049572 Ga0501036_0009002 Ga0501036_0009002_5741_6223 156
172 3300049572 Ga0501036_0204056 Ga0501036_0204056_630_1112 156
173 3300049572 Ga0501036_0372287 Ga0501036_0372287_304_786 156
174 3300049573 Ga0501037_0002311 Ga0501037_0002311_11623_12165 156
175 3300049573 Ga0501037_0123254 Ga0501037_0123254_1218_1700 156
176 3300049574 Ga0501038_0003881 Ga0501038_0003881_11751_12293 156
177 3300049574 Ga0501038_0004679 Ga0501038_0004679_8656_9138 156
178 3300049574 Ga0501038_0008180 Ga0501038_0008180_5687_6229 156
179 3300049574 Ga0501038_0035791 Ga0501038_0035791_89_634 156
180 3300049574 Ga0501038_0040968 Ga0501038_0040968_2799_3281 156
181 3300049574 Ga0501038_0361900 Ga0501038_0361900_46_528 156
182 3300049574 Ga0501038_0399187 Ga0501038_0399187_368_850 156
183 3300049575 Ga0501039_0047756 Ga0501039_0047756_1417_1899 156
184 3300049575 Ga0501039_0090357 Ga0501039_0090357_1625_2107 156
185 3300049575 Ga0501039_0114331 Ga0501039_0114331_1076_1558 156
186 3300049575 Ga0501039_0545614 Ga0501039_0545614_153_632 156
187 3300049577 Ga0501041_0329503 Ga0501041_0329503_335_817 156
188 3300049578 Ga0501042_0000160 Ga0501042_0000160_11999_12541 156
189 3300049579 Ga0501043_0001217 Ga0501043_0001217_17662_18204 156
190 3300049579 Ga0501043_0002370 Ga0501043_0002370_3702_4247 156
191 3300049579 Ga0501043_0027284 Ga0501043_0027284_3485_3967 156
192 3300049579 Ga0501043_0192960 Ga0501043_0192960_83_565 156
193 3300049579 Ga0501043_0312381 Ga0501043_0312381_52_534 156
194 3300049580 Ga0501046_0001638 Ga0501046_0001638_348_890 156
195 3300049580 Ga0501046_0013430 Ga0501046_0013430_2627_3109 156
196 3300049581 Ga0501047_0001434 Ga0501047_0001434_14154_14696 156
197 3300049582 Ga0501048_0053128 Ga0501048_0053128_1620_2162 156
198 3300049584 Ga0501068_0001085 Ga0501068_0001085_6124_6666 156
199 3300049586 Ga0501070_0178475 Ga0501070_0178475_893_1375 156
200 3300049742 Ga0501080_0319408 Ga0501080_0319408_181_723 156
201 3300049822 Ga0501035_0000803 Ga0501035_0000803_10576_11058 156
202 3300049822 Ga0501035_0018898 Ga0501035_0018898_5769_6311 156
203 3300049822 Ga0501035_0031131 Ga0501035_0031131_1547_2089 156
204 3300049822 Ga0501035_0032552 Ga0501035_0032552_361_906 156
205 3300049822 Ga0501035_0251116 Ga0501035_0251116_480_962 156
206 3300049822 Ga0501035_0303103 Ga0501035_0303103_430_912 156
207 3300049822 Ga0501035_0756416 Ga0501035_0756416_176_667 156
208 3300049823 Ga0501044_0000093 Ga0501044_0000093_94224_94706 156
209 3300049823 Ga0501044_0000891 Ga0501044_0000891_25227_25769 156
210 3300049823 Ga0501044_0054489 Ga0501044_0054489_236_718 156
211 3300049823 Ga0501044_0117949 Ga0501044_0117949_1080_1562 156
212 3300049824 Ga0501045_0003332 Ga0501045_0003332_7882_8424 156
213 3300049824 Ga0501045_0148804 Ga0501045_0148804_1152_1634 156
214 3300050511 nmdc:mga08y16_1182252_c1 nmdc:mga08y16_1182252_c1_120_608 156
215 3300050511 nmdc:mga08y16_20638_c1 nmdc:mga08y16_20638_c1_4720_5202 156
216 3300050511 nmdc:mga08y16_57622_c1 nmdc:mga08y16_57622_c1_3362_3844 156
217 3300050513 nmdc:mga0rr50_756637_c1 nmdc:mga0rr50_756637_c1_245_733 156
218 3300005328 Ga0070676_10055704 Ga0070676_100557045 157
219 3300005328 Ga0070676_10294364 Ga0070676_102943642 157
220 3300005328 Ga0070676_10641477 Ga0070676_106414772 157
221 3300005330 Ga0070690_100270012 Ga0070690_1002700122 157
222 3300005330 Ga0070690_100294952 Ga0070690_1002949522 157
223 3300005331 Ga0070670_100250503 Ga0070670_1002505032 157
224 3300005331 Ga0070670_100410736 Ga0070670_1004107362 157
225 3300005334 Ga0068869_100001424 Ga0068869_10000142411 157
226 3300005336 Ga0070680_100174528 Ga0070680_1001745282 157
227 3300005336 Ga0070680_100194408 Ga0070680_1001944081 157
228 3300005338 Ga0068868_100607902 Ga0068868_1006079022 157
229 3300005338 Ga0068868_100670593 Ga0068868_1006705932 157
230 3300005340 Ga0070689_100181147 Ga0070689_1001811471 157
231 3300005343 Ga0070687_100134323 Ga0070687_1001343232 157
232 3300005354 Ga0070675_100038641 Ga0070675_1000386414 157
233 3300005354 Ga0070675_100948594 Ga0070675_1009485942 157
234 3300005355 Ga0070671_100179419 Ga0070671_1001794194 157
235 3300005355 Ga0070671_100510316 Ga0070671_1005103162 157
236 3300005356 Ga0070674_100317034 Ga0070674_1003170342 157
237 3300005356 Ga0070674_100400569 Ga0070674_1004005692 157
238 3300005356 Ga0070674_101266174 Ga0070674_1012661742 157
239 3300005364 Ga0070673_100103225 Ga0070673_1001032252 157
240 3300005364 Ga0070673_100351521 Ga0070673_1003515212 157
241 3300005366 Ga0070659_100322272 Ga0070659_1003222722 157
242 3300005366 Ga0070659_100682621 Ga0070659_1006826211 157
243 3300005438 Ga0070701_10560760 Ga0070701_105607602 157
244 3300005440 Ga0070705_101112233 Ga0070705_1011122332 157
245 3300005441 Ga0070700_100116393 Ga0070700_1001163932 157
246 3300005444 Ga0070694_100827664 Ga0070694_1008276641 157
247 3300005445 Ga0070708_100179911 Ga0070708_1001799112 157
248 3300005456 Ga0070678_100285819 Ga0070678_1002858191 157
249 3300005456 Ga0070678_100735693 Ga0070678_1007356932 157
250 3300005456 Ga0070678_100898497 Ga0070678_1008984971 157
251 3300005458 Ga0070681_10006242 Ga0070681_100062423 157
252 3300005459 Ga0068867_100037411 Ga0068867_1000374111 157
253 3300005459 Ga0068867_100244875 Ga0068867_1002448752 157
254 3300005459 Ga0068867_100337932 Ga0068867_1003379322 157
255 3300005467 Ga0070706_100546416 Ga0070706_1005464162 157
256 3300005530 Ga0070679_100115854 Ga0070679_1001158543 157
257 3300005536 Ga0070697_100185705 Ga0070697_1001857052 157
258 3300005545 Ga0070695_100144101 Ga0070695_1001441012 157
259 3300005545 Ga0070695_100853416 Ga0070695_1008534162 157
260 3300005546 Ga0070696_100412136 Ga0070696_1004121362 157
261 3300005547 Ga0070693_100058698 Ga0070693_1000586982 157
262 3300005548 Ga0070665_100445654 Ga0070665_1004456542 157
263 3300005549 Ga0070704_100560737 Ga0070704_1005607371 157
264 3300005549 Ga0070704_100986298 Ga0070704_1009862982 157
265 3300005563 Ga0068855_100017462 Ga0068855_1000174627 157
266 3300005564 Ga0070664_100412362 Ga0070664_1004123622 157
267 3300005578 Ga0068854_100349887 Ga0068854_1003498872 157
268 3300005614 Ga0068856_100541867 Ga0068856_1005418672 157
269 3300005615 Ga0070702_100234032 Ga0070702_1002340321 157
270 3300005615 Ga0070702_100333716 Ga0070702_1003337161 157
271 3300005617 Ga0068859_100042159 Ga0068859_1000421592 157
272 3300005617 Ga0068859_100084377 Ga0068859_1000843774 157
273 3300005618 Ga0068864_100164332 Ga0068864_1001643321 157
274 3300005618 Ga0068864_100214637 Ga0068864_1002146372 157
275 3300005719 Ga0068861_100174398 Ga0068861_1001743982 157
276 3300005841 Ga0068863_100408415 Ga0068863_1004084152 157
277 3300005842 Ga0068858_100241941 Ga0068858_1002419412 157
278 3300005842 Ga0068858_100329800 Ga0068858_1003298002 157
279 3300005842 Ga0068858_100585653 Ga0068858_1005856532 157
280 3300005843 Ga0068860_100092581 Ga0068860_1000925812 157
281 3300005843 Ga0068860_100808146 Ga0068860_1008081462 157
282 3300005844 Ga0068862_100470605 Ga0068862_1004706052 157
283 3300006058 Ga0075432_10109233 Ga0075432_101092332 157
284 3300006846 Ga0075430_100054607 Ga0075430_1000546072 157
285 3300006847 Ga0075431_100000405 Ga0075431_10000040512 157
286 3300006852 Ga0075433_10550132 Ga0075433_105501322 157
287 3300006871 Ga0075434_100780632 Ga0075434_1007806322 157
288 3300006880 Ga0075429_100017441 Ga0075429_1000174419 157
289 3300006881 Ga0068865_100181633 Ga0068865_1001816332 157
290 3300006931 Ga0097620_100042160 Ga0097620_1000421605 157
291 3300006931 Ga0097620_100084376 Ga0097620_1000843764 157
292 3300009094 Ga0111539_12300240 Ga0111539_123002401 157
293 3300009098 Ga0105245_10088181 Ga0105245_100881814 157
294 3300009098 Ga0105245_10748151 Ga0105245_107481511 157
295 3300009148 Ga0105243_10046941 Ga0105243_100469413 157
296 3300009148 Ga0105243_10146830 Ga0105243_101468303 157
297 3300009174 Ga0105241_10000819 Ga0105241_1000081913 157
298 3300009176 Ga0105242_10165022 Ga0105242_101650222 157
299 3300009176 Ga0105242_10411928 Ga0105242_104119282 157
300 3300009177 Ga0105248_10002997 Ga0105248_1000299716 157
301 3300009545 Ga0105237_10182374 Ga0105237_101823742 157
302 3300009551 Ga0105238_10156818 Ga0105238_101568182 157
303 3300009553 Ga0105249_11730548 Ga0105249_117305482 157
304 3300010375 Ga0105239_10179579 Ga0105239_101795792 157
305 3300010375 Ga0105239_10332716 Ga0105239_103327163 157
306 3300011119 Ga0105246_10211486 Ga0105246_102114862 157
307 3300011119 Ga0105246_10412066 Ga0105246_104120662 157
308 3300012478 Ga0157328_1003321 Ga0157328_10033212 157
309 3300013102 Ga0157371_10245366 Ga0157371_102453662 157
310 3300013296 Ga0157374_10683187 Ga0157374_106831872 157
311 3300013297 Ga0157378_10143942 Ga0157378_101439425 157
312 3300013297 Ga0157378_10184725 Ga0157378_101847252 157
313 3300013297 Ga0157378_10507743 Ga0157378_105077432 157
314 3300013297 Ga0157378_10944521 Ga0157378_109445212 157
315 3300013297 Ga0157378_11069670 Ga0157378_110696702 157
316 3300013308 Ga0157375_10115278 Ga0157375_101152782 157
317 3300013308 Ga0157375_10200480 Ga0157375_102004802 157
318 3300014326 Ga0157380_10658535 Ga0157380_106585352 157
319 3300014745 Ga0157377_10649245 Ga0157377_106492452 157
320 3300014968 Ga0157379_10907862 Ga0157379_109078621 157
321 3300014969 Ga0157376_10004497 Ga0157376_1000449710 157
322 3300014969 Ga0157376_12197770 Ga0157376_121977701 157
323 3300017792 Ga0163161_10294604 Ga0163161_102946042 157
324 3300025903 Ga0207680_10778225 Ga0207680_107782251 157
325 3300025907 Ga0207645_10109626 Ga0207645_101096262 157
326 3300025907 Ga0207645_10370526 Ga0207645_103705262 157
327 3300025907 Ga0207645_10502505 Ga0207645_105025052 157
328 3300025908 Ga0207643_10104977 Ga0207643_101049773 157
329 3300025911 Ga0207654_10004525 Ga0207654_100045252 157
330 3300025912 Ga0207707_10062251 Ga0207707_100622513 157
331 3300025914 Ga0207671_10127258 Ga0207671_101272584 157
332 3300025917 Ga0207660_10420022 Ga0207660_104200222 157
333 3300025918 Ga0207662_10231946 Ga0207662_102319462 157
334 3300025921 Ga0207652_10444171 Ga0207652_104441712 157
335 3300025926 Ga0207659_10084861 Ga0207659_100848612 157
336 3300025931 Ga0207644_10072167 Ga0207644_100721671 157
337 3300025932 Ga0207690_10085975 Ga0207690_100859752 157
338 3300025932 Ga0207690_10489242 Ga0207690_104892422 157
339 3300025937 Ga0207669_10196988 Ga0207669_101969883 157
340 3300025937 Ga0207669_10926075 Ga0207669_109260752 157
341 3300025938 Ga0207704_10856168 Ga0207704_108561682 157
342 3300025940 Ga0207691_10635941 Ga0207691_106359412 157
343 3300025941 Ga0207711_10043907 Ga0207711_100439073 157
344 3300025942 Ga0207689_10001388 Ga0207689_100013885 157
345 3300025942 Ga0207689_10118976 Ga0207689_101189763 157
346 3300025945 Ga0207679_10096147 Ga0207679_100961473 157
347 3300025945 Ga0207679_10439041 Ga0207679_104390412 157
348 3300025945 Ga0207679_11999350 Ga0207679_119993501 157
349 3300025960 Ga0207651_11175755 Ga0207651_111757551 157
350 3300025972 Ga0207668_10192960 Ga0207668_101929603 157
351 3300025972 Ga0207668_10196614 Ga0207668_101966142 157
352 3300025981 Ga0207640_11683278 Ga0207640_116832781 157
353 3300025986 Ga0207658_11051146 Ga0207658_110511462 157
354 3300026023 Ga0207677_10010843 Ga0207677_100108432 157
355 3300026023 Ga0207677_10358060 Ga0207677_103580602 157
356 3300026035 Ga0207703_10302758 Ga0207703_103027582 157
357 3300026035 Ga0207703_10303459 Ga0207703_103034592 157
358 3300026035 Ga0207703_10470146 Ga0207703_104701462 157
359 3300026041 Ga0207639_10091566 Ga0207639_100915665 157
360 3300026075 Ga0207708_10214475 Ga0207708_102144752 157
361 3300026075 Ga0207708_10916452 Ga0207708_109164521 157
362 3300026078 Ga0207702_10044117 Ga0207702_100441175 157
363 3300026089 Ga0207648_10081734 Ga0207648_100817344 157
364 3300026089 Ga0207648_10161631 Ga0207648_101616314 157
365 3300026095 Ga0207676_10820185 Ga0207676_108201851 157
366 3300026118 Ga0207675_100073048 Ga0207675_1000730483 157
367 3300026118 Ga0207675_101575766 Ga0207675_1015757662 157
368 3300026121 Ga0207683_10109333 Ga0207683_101093332 157
369 3300026121 Ga0207683_10117033 Ga0207683_101170332 157
370 3300027543 Ga0209999_1068730 Ga0209999_10687301 157
371 3300028379 Ga0268266_10163750 Ga0268266_101637503 157
372 3300028380 Ga0268265_10378249 Ga0268265_103782492 157
373 3300028381 Ga0268264_10541752 Ga0268264_105417522 157
374 3300031548 Ga0307408_100663447 Ga0307408_1006634472 157
375 3300032002 Ga0307416_100394459 Ga0307416_1003944591 157
376 3300034957 Ga0373938_0155007 Ga0373938_0155007_67_555 157
377 3300035241 Ga0373961_0097381 Ga0373961_0097381_404_883 157
378 3300036401 Ga0373937_0455475 Ga0373937_0455475_34_522 157
379 3300041496 Ga0451839_1174650 Ga0451839_1174650_56_535 157
380 3300042001 Ga0439441_028201 Ga0439441_028201_24_509 157
381 3300048905 Ga0496102_0352229 Ga0496102_0352229_298_792 157
382 3300048905 Ga0496102_0563425 Ga0496102_0563425_380_874 157
383 3300048906 Ga0496103_0578646 Ga0496103_0578646_188_682 157
384 3300048909 Ga0496106_0150399 Ga0496106_0150399_701_1195 157
385 3300048913 Ga0496110_0113811 Ga0496110_0113811_1704_2198 157
386 3300048913 Ga0496110_0697609 Ga0496110_0697609_283_768 157
387 3300048915 Ga0496112_0783381 Ga0496112_0783381_330_824 157
388 3300049569 Ga0501032_0456742 Ga0501032_0456742_276_755 157
389 3300049570 Ga0501033_0173379 Ga0501033_0173379_700_1191 157
390 3300049571 Ga0501034_0000271 Ga0501034_0000271_31061_31540 157
391 3300049571 Ga0501034_0045048 Ga0501034_0045048_3454_3933 157
392 3300049572 Ga0501036_0013778 Ga0501036_0013778_1300_1779 157
393 3300049572 Ga0501036_0043956 Ga0501036_0043956_607_1098 157
394 3300049572 Ga0501036_1600796 Ga0501036_1600796_27_512 157
395 3300049573 Ga0501037_0046784 Ga0501037_0046784_1878_2369 157
396 3300049574 Ga0501038_0121712 Ga0501038_0121712_94_573 157
397 3300049574 Ga0501038_0276371 Ga0501038_0276371_598_1089 157
398 3300049575 Ga0501039_0111413 Ga0501039_0111413_655_1146 157
399 3300049576 Ga0501040_0109705 Ga0501040_0109705_560_1039 157
400 3300049577 Ga0501041_0000884 Ga0501041_0000884_2748_3239 157
401 3300049578 Ga0501042_0012578 Ga0501042_0012578_3846_4325 157
402 3300049579 Ga0501043_0278837 Ga0501043_0278837_217_708 157
403 3300049579 Ga0501043_0393494 Ga0501043_0393494_100_579 157
404 3300049580 Ga0501046_0102797 Ga0501046_0102797_755_1234 157
405 3300049580 Ga0501046_0153360 Ga0501046_0153360_772_1263 157
406 3300049582 Ga0501048_0018606 Ga0501048_0018606_2827_3306 157
407 3300049584 Ga0501068_0003260 Ga0501068_0003260_1397_1876 157
408 3300049586 Ga0501070_0387582 Ga0501070_0387582_240_719 157
409 3300049587 Ga0501071_0004045 Ga0501071_0004045_3875_4354 157
410 3300049587 Ga0501071_0032387 Ga0501071_0032387_127_618 157
411 3300049587 Ga0501071_0118205 Ga0501071_0118205_952_1437 157
412 3300049587 Ga0501071_0376774 Ga0501071_0376774_566_1045 157
413 3300049588 Ga0501072_0001879 Ga0501072_0001879_9453_9932 157
414 3300049588 Ga0501072_0023582 Ga0501072_0023582_4201_4680 157
415 3300049588 Ga0501072_0039012 Ga0501072_0039012_2750_3241 157
416 3300049589 Ga0501073_0064876 Ga0501073_0064876_933_1412 157
417 3300049589 Ga0501073_0227933 Ga0501073_0227933_140_619 157
418 3300049590 Ga0501074_0110609 Ga0501074_0110609_874_1353 157
419 3300049590 Ga0501074_0984873 Ga0501074_0984873_13_498 157
420 3300049591 Ga0501075_0000323 Ga0501075_0000323_7983_8462 157
421 3300049591 Ga0501075_0013386 Ga0501075_0013386_3488_3979 157
422 3300049591 Ga0501075_0617403 Ga0501075_0617403_146_637 157
423 3300049591 Ga0501075_0711578 Ga0501075_0711578_253_744 157
424 3300049592 Ga0501076_0002782 Ga0501076_0002782_8505_8984 157
425 3300049592 Ga0501076_0010748 Ga0501076_0010748_2322_2813 157
426 3300049592 Ga0501076_1487784 Ga0501076_1487784_57_536 157
427 3300049593 Ga0501077_0160270 Ga0501077_0160270_625_1116 157
428 3300049741 Ga0501079_0001098 Ga0501079_0001098_4029_4508 157
429 3300049741 Ga0501079_0076947 Ga0501079_0076947_451_942 157
430 3300049741 Ga0501079_0704951 Ga0501079_0704951_61_552 157
431 3300049742 Ga0501080_0009212 Ga0501080_0009212_7144_7623 157
432 3300049742 Ga0501080_0020812 Ga0501080_0020812_787_1278 157
433 3300049742 Ga0501080_0025182 Ga0501080_0025182_4094_4573 157
434 3300049743 Ga0501081_0006454 Ga0501081_0006454_3900_4391 157
435 3300049743 Ga0501081_0152614 Ga0501081_0152614_261_740 157
436 3300049743 Ga0501081_0225830 Ga0501081_0225830_163_654 157
437 3300049744 Ga0501083_0097663 Ga0501083_0097663_543_1022 157
438 3300049744 Ga0501083_0116386 Ga0501083_0116386_172_663 157
439 3300049824 Ga0501045_0006518 Ga0501045_0006518_5485_5964 157
440 3300049824 Ga0501045_0027468 Ga0501045_0027468_2833_3324 157
441 3300050508 nmdc:mga09592_11799_c1 nmdc:mga09592_11799_c1_618_1109 157
442 3300050509 nmdc:mga0qj67_450516_c1 nmdc:mga0qj67_450516_c1_121_612 157
443 3300050510 nmdc:mga06r32_20793_c1 nmdc:mga06r32_20793_c1_756_1247 157
444 3300050512 nmdc:mga0n895_1757049_c1 nmdc:mga0n895_1757049_c1_66_557 157
445 3300050512 nmdc:mga0n895_85304_c1 nmdc:mga0n895_85304_c1_187_681 157
446 3300050515 nmdc:mga0a205_196585_c1 nmdc:mga0a205_196585_c1_41_526 157
447 3300054114 Ga0501084_0002787 Ga0501084_0002787_102_581 157
448 3300054114 Ga0501084_0301899 Ga0501084_0301899_626_1105 157
449 3300060353 Ga0501082_0015215 Ga0501082_0015215_4699_5190 157
450 3300061734 Ga0530510_0001359 Ga0530510_0001359_12248_12727 157
451 3300061734 Ga0530510_0220556 Ga0530510_0220556_334_825 157
452 3300005290 Ga0065712_10077682 Ga0065712_100776823 158
453 3300005293 Ga0065715_10044987 Ga0065715_100449872 158
454 3300005293 Ga0065715_10818593 Ga0065715_108185931 158
455 3300005327 Ga0070658_10018474 Ga0070658_100184743 158
456 3300005328 Ga0070676_10168580 Ga0070676_101685802 158
457 3300005329 Ga0070683_100000620 Ga0070683_1000006207 158
458 3300005330 Ga0070690_100038356 Ga0070690_1000383561 158
459 3300005331 Ga0070670_100000425 Ga0070670_10000042513 158
460 3300005333 Ga0070677_10019840 Ga0070677_100198404 158
461 3300005333 Ga0070677_10038317 Ga0070677_100383172 158
462 3300005334 Ga0068869_100317271 Ga0068869_1003172711 158
463 3300005335 Ga0070666_10005432 Ga0070666_100054323 158
464 3300005338 Ga0068868_100000145 Ga0068868_10000014521 158
465 3300005338 Ga0068868_100115383 Ga0068868_1001153832 158
466 3300005339 Ga0070660_100364103 Ga0070660_1003641032 158
467 3300005340 Ga0070689_100217069 Ga0070689_1002170692 158
468 3300005343 Ga0070687_100137429 Ga0070687_1001374292 158
469 3300005344 Ga0070661_100004612 Ga0070661_1000046125 158
470 3300005344 Ga0070661_101355327 Ga0070661_1013553271 158
471 3300005354 Ga0070675_100001867 Ga0070675_1000018678 158
472 3300005354 Ga0070675_100655224 Ga0070675_1006552242 158
473 3300005355 Ga0070671_100000623 Ga0070671_10000062315 158
474 3300005355 Ga0070671_100054443 Ga0070671_1000544432 158
475 3300005356 Ga0070674_100021913 Ga0070674_1000219132 158
476 3300005364 Ga0070673_100000994 Ga0070673_10000099410 158
477 3300005364 Ga0070673_100958810 Ga0070673_1009588101 158
478 3300005364 Ga0070673_101692432 Ga0070673_1016924321 158
479 3300005365 Ga0070688_100035047 Ga0070688_1000350473 158
480 3300005366 Ga0070659_100690689 Ga0070659_1006906892 158
481 3300005367 Ga0070667_100029846 Ga0070667_1000298462 158
482 3300005441 Ga0070700_100137292 Ga0070700_1001372922 158
483 3300005456 Ga0070678_100000715 Ga0070678_10000071513 158
484 3300005456 Ga0070678_100228341 Ga0070678_1002283412 158
485 3300005457 Ga0070662_100045293 Ga0070662_1000452931 158
486 3300005458 Ga0070681_10243936 Ga0070681_102439362 158
487 3300005459 Ga0068867_100012666 Ga0068867_1000126665 158
488 3300005459 Ga0068867_100987519 Ga0068867_1009875192 158
489 3300005466 Ga0070685_10117304 Ga0070685_101173042 158
490 3300005466 Ga0070685_10184031 Ga0070685_101840312 158
491 3300005530 Ga0070679_100586798 Ga0070679_1005867981 158
492 3300005535 Ga0070684_100030101 Ga0070684_1000301015 158
493 3300005535 Ga0070684_100445753 Ga0070684_1004457532 158
494 3300005543 Ga0070672_100000613 Ga0070672_1000006136 158
495 3300005544 Ga0070686_100283057 Ga0070686_1002830572 158
496 3300005548 Ga0070665_100215780 Ga0070665_1002157802 158
497 3300005549 Ga0070704_100188779 Ga0070704_1001887791 158
498 3300005564 Ga0070664_100000316 Ga0070664_10000031613 158
499 3300005564 Ga0070664_101617508 Ga0070664_1016175081 158
500 3300005578 Ga0068854_100006142 Ga0068854_1000061422 158
501 3300005578 Ga0068854_100905176 Ga0068854_1009051762 158
502 3300005615 Ga0070702_100011565 Ga0070702_1000115652 158
503 3300005615 Ga0070702_100058944 Ga0070702_1000589443 158
504 3300005616 Ga0068852_100000229 Ga0068852_10000022921 158
505 3300005617 Ga0068859_101111277 Ga0068859_1011112772 158
506 3300005618 Ga0068864_100006381 Ga0068864_10000638110 158
507 3300005618 Ga0068864_100174535 Ga0068864_1001745352 158
508 3300005618 Ga0068864_101468301 Ga0068864_1014683012 158
509 3300005718 Ga0068866_10044262 Ga0068866_100442623 158
510 3300005719 Ga0068861_100072633 Ga0068861_1000726333 158
511 3300005834 Ga0068851_10005187 Ga0068851_100051873 158
512 3300005840 Ga0068870_10569075 Ga0068870_105690751 158
513 3300005840 Ga0068870_10962877 Ga0068870_109628771 158
514 3300005841 Ga0068863_100059980 Ga0068863_1000599805 158
515 3300005841 Ga0068863_100126314 Ga0068863_1001263143 158
516 3300005844 Ga0068862_100242416 Ga0068862_1002424162 158
517 3300006051 Ga0075364_10583040 Ga0075364_105830402 158
518 3300006237 Ga0097621_100001842 Ga0097621_10000184211 158
519 3300006237 Ga0097621_100161618 Ga0097621_1001616182 158
520 3300006237 Ga0097621_100207675 Ga0097621_1002076753 158
521 3300006358 Ga0068871_100000463 Ga0068871_10000046310 158
522 3300006358 Ga0068871_100320039 Ga0068871_1003200392 158
523 3300006844 Ga0075428_100195225 Ga0075428_1001952252 158
524 3300006844 Ga0075428_100382866 Ga0075428_1003828662 158
525 3300006880 Ga0075429_100753562 Ga0075429_1007535621 158
526 3300006880 Ga0075429_100909153 Ga0075429_1009091531 158
527 3300006881 Ga0068865_100110321 Ga0068865_1001103213 158
528 3300006881 Ga0068865_100563197 Ga0068865_1005631972 158
529 3300006931 Ga0097620_101111332 Ga0097620_1011113322 158
530 3300009011 Ga0105251_10347355 Ga0105251_103473552 158
531 3300009094 Ga0111539_10205558 Ga0111539_102055582 158
532 3300009094 Ga0111539_10445061 Ga0111539_104450612 158
533 3300009094 Ga0111539_10776304 Ga0111539_107763042 158
534 3300009098 Ga0105245_11914274 Ga0105245_119142742 158
535 3300009148 Ga0105243_10130322 Ga0105243_101303221 158
536 3300009176 Ga0105242_10320105 Ga0105242_103201052 158
537 3300009176 Ga0105242_11510324 Ga0105242_115103242 158
538 3300009177 Ga0105248_10054534 Ga0105248_100545345 158
539 3300009177 Ga0105248_10362462 Ga0105248_103624622 158
540 3300009177 Ga0105248_11551752 Ga0105248_115517521 158
541 3300009551 Ga0105238_10531760 Ga0105238_105317602 158
542 3300009553 Ga0105249_10070378 Ga0105249_100703782 158
543 3300013296 Ga0157374_10000860 Ga0157374_1000086012 158
544 3300013296 Ga0157374_10209813 Ga0157374_102098132 158
545 3300013297 Ga0157378_10001726 Ga0157378_100017268 158
546 3300013297 Ga0157378_10100198 Ga0157378_101001983 158
547 3300013306 Ga0163162_10105559 Ga0163162_101055592 158
548 3300013308 Ga0157375_10000496 Ga0157375_100004962 158
549 3300013308 Ga0157375_10164398 Ga0157375_101643982 158
550 3300014325 Ga0163163_10295431 Ga0163163_102954313 158
551 3300014745 Ga0157377_10138741 Ga0157377_101387413 158
552 3300014745 Ga0157377_10161519 Ga0157377_101615192 158
553 3300014968 Ga0157379_10325220 Ga0157379_103252202 158
554 3300014969 Ga0157376_10015747 Ga0157376_100157475 158
555 3300014969 Ga0157376_10112186 Ga0157376_101121862 158
556 3300014969 Ga0157376_10450151 Ga0157376_104501512 158
557 3300017792 Ga0163161_10115899 Ga0163161_101158993 158
558 3300017792 Ga0163161_10155452 Ga0163161_101554522 158
559 3300025315 Ga0207697_10011965 Ga0207697_100119653 158
560 3300025893 Ga0207682_10001311 Ga0207682_100013113 158
561 3300025893 Ga0207682_10129957 Ga0207682_101299571 158
562 3300025901 Ga0207688_10296155 Ga0207688_102961552 158
563 3300025907 Ga0207645_10196517 Ga0207645_101965172 158
564 3300025908 Ga0207643_10004592 Ga0207643_100045927 158
565 3300025909 Ga0207705_10063839 Ga0207705_100638392 158
566 3300025918 Ga0207662_10003156 Ga0207662_100031568 158
567 3300025919 Ga0207657_10191585 Ga0207657_101915852 158
568 3300025920 Ga0207649_10002082 Ga0207649_100020826 158
569 3300025921 Ga0207652_10579944 Ga0207652_105799442 158
570 3300025925 Ga0207650_10001393 Ga0207650_100013936 158
571 3300025925 Ga0207650_10264101 Ga0207650_102641012 158
572 3300025926 Ga0207659_10001475 Ga0207659_100014756 158
573 3300025931 Ga0207644_10001467 Ga0207644_100014677 158
574 3300025931 Ga0207644_10129010 Ga0207644_101290103 158
575 3300025932 Ga0207690_10264873 Ga0207690_102648732 158
576 3300025933 Ga0207706_10233702 Ga0207706_102337021 158
577 3300025935 Ga0207709_10474435 Ga0207709_104744352 158
578 3300025936 Ga0207670_10047175 Ga0207670_100471753 158
579 3300025937 Ga0207669_10067408 Ga0207669_100674082 158
580 3300025938 Ga0207704_10309803 Ga0207704_103098032 158
581 3300025940 Ga0207691_10000667 Ga0207691_1000066714 158
582 3300025940 Ga0207691_10125844 Ga0207691_101258442 158
583 3300025941 Ga0207711_10395287 Ga0207711_103952872 158
584 3300025942 Ga0207689_10013184 Ga0207689_100131846 158
585 3300025944 Ga0207661_10000839 Ga0207661_100008397 158
586 3300025945 Ga0207679_10000649 Ga0207679_1000064911 158
587 3300025945 Ga0207679_10199423 Ga0207679_101994232 158
588 3300025945 Ga0207679_10445227 Ga0207679_104452272 158
589 3300025960 Ga0207651_10070595 Ga0207651_100705953 158
590 3300025960 Ga0207651_10926664 Ga0207651_109266641 158
591 3300025972 Ga0207668_10085487 Ga0207668_100854872 158
592 3300025981 Ga0207640_10004522 Ga0207640_100045222 158
593 3300025981 Ga0207640_10101233 Ga0207640_101012332 158
594 3300025986 Ga0207658_10016377 Ga0207658_100163772 158
595 3300025986 Ga0207658_10193833 Ga0207658_101938332 158
596 3300026023 Ga0207677_10002637 Ga0207677_100026376 158
597 3300026023 Ga0207677_10139271 Ga0207677_101392712 158
598 3300026075 Ga0207708_10001911 Ga0207708_100019114 158
599 3300026088 Ga0207641_10053759 Ga0207641_100537593 158
600 3300026088 Ga0207641_10423968 Ga0207641_104239682 158
601 3300026089 Ga0207648_10032821 Ga0207648_100328215 158
602 3300026095 Ga0207676_10224720 Ga0207676_102247202 158
603 3300026095 Ga0207676_10338282 Ga0207676_103382822 158
604 3300026095 Ga0207676_10619360 Ga0207676_106193602 158
605 3300026118 Ga0207675_100009662 Ga0207675_1000096627 158
606 3300026121 Ga0207683_10001353 Ga0207683_1000135315 158
607 3300026121 Ga0207683_10044602 Ga0207683_100446024 158
608 3300026142 Ga0207698_10000201 Ga0207698_1000020112 158
609 3300026142 Ga0207698_10262088 Ga0207698_102620882 158
610 3300027360 Ga0209969_1001193 Ga0209969_10011932 158
611 3300027360 Ga0209969_1028386 Ga0209969_10283861 158
612 3300027364 Ga0209967_1029195 Ga0209967_10291951 158
613 3300027378 Ga0209981_1015878 Ga0209981_10158782 158
614 3300027462 Ga0210000_1003606 Ga0210000_10036063 158
615 3300027471 Ga0209995_1002446 Ga0209995_10024464 158
616 3300027617 Ga0210002_1031951 Ga0210002_10319512 158
617 3300027665 Ga0209983_1042994 Ga0209983_10429942 158
618 3300027682 Ga0209971_1007110 Ga0209971_10071102 158
619 3300027876 Ga0209974_10003811 Ga0209974_100038113 158
620 3300027876 Ga0209974_10066366 Ga0209974_100663662 158
621 3300028380 Ga0268265_10178882 Ga0268265_101788823 158
622 3300028380 Ga0268265_11255294 Ga0268265_112552941 158
623 3300028381 Ga0268264_11360842 Ga0268264_113608421 158
624 3300028577 Ga0265318_10004551 Ga0265318_100045513 158
625 3300028800 Ga0265338_10212015 Ga0265338_102120152 158
626 3300031235 Ga0265330_10117223 Ga0265330_101172232 158
627 3300031238 Ga0265332_10002198 Ga0265332_100021985 158
628 3300031239 Ga0265328_10003085 Ga0265328_100030854 158
629 3300031240 Ga0265320_10159888 Ga0265320_101598881 158
630 3300031241 Ga0265325_10118444 Ga0265325_101184442 158
631 3300031249 Ga0265339_10179697 Ga0265339_101796972 158
632 3300031250 Ga0265331_10007426 Ga0265331_100074267 158
633 3300031344 Ga0265316_10028156 Ga0265316_100281562 158
634 3300031548 Ga0307408_100055991 Ga0307408_1000559914 158
635 3300031665 Ga0316575_10000646 Ga0316575_100006465 158
636 3300031711 Ga0265314_10000335 Ga0265314_1000033545 158
637 3300031712 Ga0265342_10006633 Ga0265342_100066333 158
638 3300031824 Ga0307413_10567800 Ga0307413_105678002 158
639 3300031852 Ga0307410_10245418 Ga0307410_102454182 158
640 3300031901 Ga0307406_10137741 Ga0307406_101377412 158
641 3300031903 Ga0307407_10023684 Ga0307407_100236842 158
642 3300031903 Ga0307407_10481316 Ga0307407_104813162 158
643 3300031911 Ga0307412_11400816 Ga0307412_114008162 158
644 3300032005 Ga0307411_10269668 Ga0307411_102696682 158
645 3300032168 Ga0316593_10223761 Ga0316593_102237611 158
646 3300036401 Ga0373937_0685105 Ga0373937_0685105_279_767 158
647 3300036647 Ga0316582_0442961 Ga0316582_0442961_338_826 158
648 3300037853 Ga0436364_0126953 Ga0436364_0126953_35_529 158
649 3300041459 Ga0451800_0675414 Ga0451800_0675414_350_838 158
650 3300041507 Ga0451851_0448351 Ga0451851_0448351_131_619 158
651 3300041512 Ga0451853_3741827 Ga0451853_3741827_466_954 158
652 3300042461 Ga0439460_0107505 Ga0439460_0107505_347_823 158
653 3300042876 Ga0451577_0384248 Ga0451577_0384248_637_1125 158
654 3300042876 Ga0451577_0481347 Ga0451577_0481347_498_986 158
655 3300042876 Ga0451577_1278795 Ga0451577_1278795_79_567 158
656 3300045051 Ga0451576_0664028 Ga0451576_0664028_387_944 158
657 3300046537 Ga0495598_0143007 Ga0495598_0143007_236_724 158
658 3300046539 Ga0495621_0144443 Ga0495621_0144443_247_735 158
659 3300046675 Ga0495657_0471402 Ga0495657_0471402_58_546 158
660 3300046683 Ga0495658_0415820 Ga0495658_0415820_271_759 158
661 3300046684 Ga0495669_0112754 Ga0495669_0112754_642_1130 158
662 3300048903 Ga0496100_0025668 Ga0496100_0025668_2193_2681 158
663 3300048904 Ga0496101_0785182 Ga0496101_0785182_228_716 158
664 3300048911 Ga0496108_0000486 Ga0496108_0000486_2819_3307 158
665 3300048911 Ga0496108_0232622 Ga0496108_0232622_969_1457 158
666 3300048911 Ga0496108_0299453 Ga0496108_0299453_747_1241 158
667 3300048912 Ga0496109_0023255 Ga0496109_0023255_260_748 158
668 3300048913 Ga0496110_0002637 Ga0496110_0002637_6696_7184 158
669 3300048913 Ga0496110_0470690 Ga0496110_0470690_41_535 158
670 3300048913 Ga0496110_0576307 Ga0496110_0576307_123_611 158
671 3300048914 Ga0496111_0022060 Ga0496111_0022060_2967_3455 158
672 3300048915 Ga0496112_0797736 Ga0496112_0797736_79_567 158
673 3300048916 Ga0496113_0491388 Ga0496113_0491388_413_901 158
674 3300048917 Ga0496114_0014858 Ga0496114_0014858_4805_5293 158
675 3300048917 Ga0496114_0039604 Ga0496114_0039604_1924_2418 158
676 3300048917 Ga0496114_0426887 Ga0496114_0426887_440_928 158
677 3300049514 Ga0501291_036186 Ga0501291_036186_331_825 158
678 3300049515 Ga0501292_072560 Ga0501292_072560_133_621 158
679 3300049526 Ga0501303_016378 Ga0501303_016378_74_562 158
680 3300049569 Ga0501032_0322917 Ga0501032_0322917_343_822 158
681 3300049573 Ga0501037_0448467 Ga0501037_0448467_228_707 158
682 3300049576 Ga0501040_0978782 Ga0501040_0978782_102_596 158
683 3300049585 Ga0501069_0004756 Ga0501069_0004756_594_1085 158
684 3300049586 Ga0501070_0007076 Ga0501070_0007076_6178_6669 158
685 3300049586 Ga0501070_0096236 Ga0501070_0096236_26_517 158
686 3300049590 Ga0501074_0051996 Ga0501074_0051996_766_1257 158
687 3300049779 Ga0501283_011376 Ga0501283_011376_308_796 158
688 3300049823 Ga0501044_0180241 Ga0501044_0180241_354_833 158
689 3300050491 nmdc:mga00v17_774946_c1 nmdc:mga00v17_774946_c1_21_542 158
690 3300050511 nmdc:mga08y16_165794_c1 nmdc:mga08y16_165794_c1_1279_1773 158
691 3300050511 nmdc:mga08y16_201860_c1 nmdc:mga08y16_201860_c1_1353_1841 158
692 3300061734 Ga0530510_0626931 Ga0530510_0626931_39_533 158
693 2162886007 SwRhRL2b_contig_208097 SwRhRL2b_0012.00007630 161
694 3300005289 Ga0065704_10071556 Ga0065704_100715562 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

27

148

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9252 4 139
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9238 6 141
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9213 5 139
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9197 4 139
6a6g-assembly1.cif.gz_C crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 0.9166 8 139
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9189 5 140 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.912 8 139 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8938 5 142 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8872 5 140 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8681 8 139 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2V6PMU2-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.968 10 89 GO:0005506
GO:0016226
GO:0051536
AF-A0A3D6EIP0-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9624 1 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A2H0MZJ3-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9577 1 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A3D6EIP0-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9561 1 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C5ZN38-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9551 23 144 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
88.8 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map