F475684
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 334 | 693 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_074680|Ga0500643_074680_63_860 |
| Length | 242 |
| Sequence | LAARLEVGNGRQEAGMLNEQDRARISAAIAQVESKTAGEIFCVLAKDVSRYREVPLLWAAVAAFIVPPLLVVVGLHRLALASIFSSWTDESAHAMEGLILRALSTFELVQAGIFLIVAVLVAMPGVRRAVTPGALKTYRVRQAARRHFVAVGARLSDAEPHILIYASLADRRVELVAHDKIHKAVGEGPWNQSVAAVIDGMQSGKPADGFVKAIEICGTALAQHFPPSGTPANRLPNTILET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 326 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 330 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.61 |
| Nodule | 0 |
| Rhizoplane | 8.95 |
| Rhizosphere | 86.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1007809 | 3300001977 | Bacteria | 1627 |
| 2 | JGI24743J22301_10006434 | 3300001991 | Bacteria | 2003 |
| 3 | JGI24750J21931_1001938 | 3300002070 | Bacteria | 2527 |
| 4 | JGI24745J21846_1001757 | 3300002073 | Bacteria | 2137 |
| 5 | JGI24738J21930_10014202 | 3300002075 | Bacteria | 1712 |
| 6 | JGI24749J21850_1008317 | 3300002076 | Bacteria | 1445 |
| 7 | JGI24744J21845_10000406 | 3300002077 | Bacteria | 7457 |
| 8 | JGI24742J22300_10001904 | 3300002244 | Bacteria | 3319 |
| 9 | JGI25406J46586_10001759 | 3300003203 | Bacteria | 10189 |
| 10 | JGI25153J46596_10006977 | 3300003215 | Bacteria | 5628 |
| 11 | JGI25404J52841_10002770 | 3300003659 | Bacteria | 3373 |
| 12 | Ga0070676_10310741 | 3300005328 | Bacteria | 1072 |
| 13 | Ga0070690_100281039 | 3300005330 | Unclassified | 1187 |
| 14 | Ga0070670_100019601 | 3300005331 | Bacteria | 5806 |
| 15 | Ga0070677_10007226 | 3300005333 | Bacteria | 3702 |
| 16 | Ga0070677_10172119 | 3300005333 | Bacteria | 1024 |
| 17 | Ga0068869_100018551 | 3300005334 | Bacteria | 4737 |
| 18 | Ga0068869_100930773 | 3300005334 | Bacteria | 753 |
| 19 | Ga0070666_10016334 | 3300005335 | Bacteria | 4747 |
| 20 | Ga0070666_10218196 | 3300005335 | Bacteria | 1345 |
| 21 | Ga0070666_10320437 | 3300005335 | Bacteria | 1106 |
| 22 | Ga0070680_100376706 | 3300005336 | Bacteria | 1208 |
| 23 | Ga0070682_100001556 | 3300005337 | Bacteria | 12840 |
| 24 | Ga0070682_100010810 | 3300005337 | Bacteria | 5193 |
| 25 | Ga0070682_100694673 | 3300005337 | Bacteria | 815 |
| 26 | Ga0068868_100010355 | 3300005338 | Bacteria | 6746 |
| 27 | Ga0068868_100346087 | 3300005338 | Bacteria | 1272 |
| 28 | Ga0068868_100531176 | 3300005338 | Unclassified | 1034 |
| 29 | Ga0070660_100043079 | 3300005339 | Bacteria | 3448 |
| 30 | Ga0070660_100097872 | 3300005339 | Bacteria | 2322 |
| 31 | Ga0070689_100124521 | 3300005340 | Bacteria | 2061 |
| 32 | Ga0070689_100365883 | 3300005340 | Bacteria | 1212 |
| 33 | Ga0070691_10041216 | 3300005341 | Bacteria | 2183 |
| 34 | Ga0070687_100310669 | 3300005343 | Bacteria | 1004 |
| 35 | Ga0070661_100000071 | 3300005344 | Bacteria | 82723 |
| 36 | Ga0070692_10114576 | 3300005345 | Bacteria | 1495 |
| 37 | Ga0070668_100003443 | 3300005347 | Bacteria | 11685 |
| 38 | Ga0070668_100004096 | 3300005347 | Bacteria | 10796 |
| 39 | Ga0070668_100075925 | 3300005347 | Bacteria | 2624 |
| 40 | Ga0070669_100103425 | 3300005353 | Bacteria | 2152 |
| 41 | Ga0070669_100184306 | 3300005353 | Bacteria | 1635 |
| 42 | Ga0070669_100456341 | 3300005353 | Bacteria | 1054 |
| 43 | Ga0070675_100078289 | 3300005354 | Bacteria | 2753 |
| 44 | Ga0070671_100003476 | 3300005355 | Bacteria | 12288 |
| 45 | Ga0070671_100076539 | 3300005355 | Bacteria | 2795 |
| 46 | Ga0070674_100007703 | 3300005356 | Bacteria | 6361 |
| 47 | Ga0070674_100042735 | 3300005356 | Bacteria | 3080 |
| 48 | Ga0070673_100012560 | 3300005364 | Bacteria | 5819 |
| 49 | Ga0070673_100013937 | 3300005364 | Bacteria | 5582 |
| 50 | Ga0070673_100698000 | 3300005364 | Bacteria | 932 |
| 51 | Ga0070688_100049175 | 3300005365 | Bacteria | 2623 |
| 52 | Ga0070688_100057908 | 3300005365 | Bacteria | 2438 |
| 53 | Ga0070688_100193467 | 3300005365 | Bacteria | 1418 |
| 54 | Ga0070659_100009307 | 3300005366 | Bacteria | 7214 |
| 55 | Ga0070659_100104161 | 3300005366 | Bacteria | 2285 |
| 56 | Ga0070659_101160990 | 3300005366 | Unclassified | 682 |
| 57 | Ga0070667_100011828 | 3300005367 | Bacteria | 7214 |
| 58 | Ga0070667_100873381 | 3300005367 | Bacteria | 836 |
| 59 | Ga0070667_101030747 | 3300005367 | Bacteria | 768 |
| 60 | Ga0070713_100161785 | 3300005436 | Bacteria | 1999 |
| 61 | Ga0070713_100175301 | 3300005436 | Bacteria | 1924 |
| 62 | Ga0070713_100296663 | 3300005436 | Bacteria | 1487 |
| 63 | Ga0070710_10348158 | 3300005437 | Bacteria | 980 |
| 64 | Ga0070701_10005829 | 3300005438 | Bacteria | 5131 |
| 65 | Ga0070701_10082252 | 3300005438 | Bacteria | 1746 |
| 66 | Ga0070701_10236131 | 3300005438 | Bacteria | 1097 |
| 67 | Ga0070711_100116747 | 3300005439 | Bacteria | 1967 |
| 68 | Ga0070711_100123025 | 3300005439 | Bacteria | 1922 |
| 69 | Ga0070705_100387009 | 3300005440 | Bacteria | 1031 |
| 70 | Ga0070700_100003371 | 3300005441 | Bacteria | 8238 |
| 71 | Ga0070708_100257117 | 3300005445 | Bacteria | 1641 |
| 72 | Ga0070663_100166853 | 3300005455 | Unclassified | 1699 |
| 73 | Ga0070663_100647865 | 3300005455 | Bacteria | 893 |
| 74 | Ga0070678_100005894 | 3300005456 | Bacteria | 7126 |
| 75 | Ga0070678_100164216 | 3300005456 | Bacteria | 1802 |
| 76 | Ga0070678_100734975 | 3300005456 | Unclassified | 892 |
| 77 | Ga0070662_100008277 | 3300005457 | Bacteria | 6773 |
| 78 | Ga0070662_100456139 | 3300005457 | Bacteria | 1062 |
| 79 | Ga0070681_10473516 | 3300005458 | Unclassified | 1165 |
| 80 | Ga0068867_100026540 | 3300005459 | Bacteria | 4160 |
| 81 | Ga0068867_100088507 | 3300005459 | Bacteria | 2347 |
| 82 | Ga0068867_100137146 | 3300005459 | Bacteria | 1909 |
| 83 | Ga0070685_10023342 | 3300005466 | Bacteria | 3386 |
| 84 | Ga0070685_10328629 | 3300005466 | Bacteria | 1039 |
| 85 | Ga0070706_100189788 | 3300005467 | Bacteria | 1920 |
| 86 | Ga0070698_100450669 | 3300005471 | Bacteria | 1222 |
| 87 | Ga0070699_100005212 | 3300005518 | Bacteria | 11425 |
| 88 | Ga0070697_100002109 | 3300005536 | Bacteria | 15231 |
| 89 | Ga0070697_100246294 | 3300005536 | Bacteria | 1527 |
| 90 | Ga0068853_100158380 | 3300005539 | Bacteria | 2041 |
| 91 | Ga0068853_100395293 | 3300005539 | Bacteria | 1293 |
| 92 | Ga0068853_101417466 | 3300005539 | Archaea | 672 |
| 93 | Ga0070672_100015823 | 3300005543 | Bacteria | 5385 |
| 94 | Ga0070672_100555546 | 3300005543 | Bacteria | 997 |
| 95 | Ga0070672_100706927 | 3300005543 | Bacteria | 883 |
| 96 | Ga0070686_100078608 | 3300005544 | Bacteria | 2179 |
| 97 | Ga0070686_100263172 | 3300005544 | Bacteria | 1265 |
| 98 | Ga0070686_100750294 | 3300005544 | Bacteria | 783 |
| 99 | Ga0070695_100014840 | 3300005545 | Bacteria | 4700 |
| 100 | Ga0070695_100464231 | 3300005545 | Bacteria | 973 |
| 101 | Ga0070693_100031441 | 3300005547 | Bacteria | 2909 |
| 102 | Ga0070693_100340603 | 3300005547 | Bacteria | 1023 |
| 103 | Ga0070665_100007652 | 3300005548 | Bacteria | 10983 |
| 104 | Ga0070665_100126088 | 3300005548 | Bacteria | 2562 |
| 105 | Ga0070665_100163572 | 3300005548 | Bacteria | 2227 |
| 106 | Ga0070665_100220929 | 3300005548 | Bacteria | 1895 |
| 107 | Ga0070665_100256853 | 3300005548 | Bacteria | 1748 |
| 108 | Ga0070704_100038731 | 3300005549 | Bacteria | 3268 |
| 109 | Ga0068855_100034384 | 3300005563 | Bacteria | 6046 |
| 110 | Ga0070664_100108510 | 3300005564 | Bacteria | 2421 |
| 111 | Ga0068857_100072289 | 3300005577 | Bacteria | 3073 |
| 112 | Ga0068857_100439879 | 3300005577 | Bacteria | 1218 |
| 113 | Ga0068857_100659911 | 3300005577 | Unclassified | 992 |
| 114 | Ga0068856_100216260 | 3300005614 | Bacteria | 1932 |
| 115 | Ga0068856_100779655 | 3300005614 | Bacteria | 976 |
| 116 | Ga0070702_100016894 | 3300005615 | Bacteria | 3755 |
| 117 | Ga0070702_100137375 | 3300005615 | Bacteria | 1553 |
| 118 | Ga0068852_100065766 | 3300005616 | Bacteria | 3165 |
| 119 | Ga0068859_100006386 | 3300005617 | Bacteria | 11960 |
| 120 | Ga0068859_100120749 | 3300005617 | Bacteria | 2687 |
| 121 | Ga0068864_100001978 | 3300005618 | Bacteria | 16866 |
| 122 | Ga0068864_100064299 | 3300005618 | Bacteria | 3181 |
| 123 | Ga0068864_100076319 | 3300005618 | Bacteria | 2928 |
| 124 | Ga0068866_10024482 | 3300005718 | Bacteria | 2823 |
| 125 | Ga0068866_10042587 | 3300005718 | Bacteria | 2260 |
| 126 | Ga0068866_10045488 | 3300005718 | Bacteria | 2202 |
| 127 | Ga0068861_100018551 | 3300005719 | Bacteria | 4956 |
| 128 | Ga0068851_10056896 | 3300005834 | Bacteria | 1996 |
| 129 | Ga0068870_10003152 | 3300005840 | Bacteria | 6953 |
| 130 | Ga0068870_10086818 | 3300005840 | Bacteria | 1741 |
| 131 | Ga0068863_100002977 | 3300005841 | Bacteria | 16752 |
| 132 | Ga0068863_100013950 | 3300005841 | Bacteria | 7746 |
| 133 | Ga0068863_100545543 | 3300005841 | Bacteria | 1144 |
| 134 | Ga0068858_100046689 | 3300005842 | Bacteria | 4014 |
| 135 | Ga0068858_100135578 | 3300005842 | Bacteria | 2310 |
| 136 | Ga0068858_100245783 | 3300005842 | Bacteria | 1699 |
| 137 | Ga0068858_100366326 | 3300005842 | Bacteria | 1382 |
| 138 | Ga0068860_100000109 | 3300005843 | Bacteria | 132169 |
| 139 | Ga0068860_100018969 | 3300005843 | Bacteria | 6681 |
| 140 | Ga0068860_100266218 | 3300005843 | Bacteria | 1672 |
| 141 | Ga0068862_100003711 | 3300005844 | Bacteria | 13037 |
| 142 | Ga0068862_100073243 | 3300005844 | Bacteria | 2960 |
| 143 | Ga0068862_100139865 | 3300005844 | Bacteria | 2148 |
| 144 | Ga0068862_100701197 | 3300005844 | Bacteria | 981 |
| 145 | Ga0081455_10016680 | 3300005937 | Bacteria | 7075 |
| 146 | Ga0081455_10068364 | 3300005937 | Bacteria | 2957 |
| 147 | Ga0081455_10087507 | 3300005937 | Bacteria | 2534 |
| 148 | Ga0081455_10138944 | 3300005937 | Bacteria | 1889 |
| 149 | Ga0081455_10179887 | 3300005937 | Bacteria | 1602 |
| 150 | Ga0081455_10217491 | 3300005937 | Bacteria | 1419 |
| 151 | Ga0081538_10006350 | 3300005981 | Bacteria | 10426 |
| 152 | Ga0081538_10073205 | 3300005981 | Bacteria | 1874 |
| 153 | Ga0081540_1005049 | 3300005983 | Bacteria | 9903 |
| 154 | Ga0081540_1074935 | 3300005983 | Bacteria | 1548 |
| 155 | Ga0081539_10003504 | 3300005985 | Bacteria | 19185 |
| 156 | Ga0070717_10493952 | 3300006028 | Bacteria | 1106 |
| 157 | Ga0070717_10610656 | 3300006028 | Bacteria | 989 |
| 158 | Ga0075365_10024636 | 3300006038 | Bacteria | 3799 |
| 159 | Ga0075365_10041919 | 3300006038 | Bacteria | 2991 |
| 160 | Ga0075368_10237893 | 3300006042 | Unclassified | 776 |
| 161 | Ga0075363_100021892 | 3300006048 | Bacteria | 3227 |
| 162 | Ga0070715_10009553 | 3300006163 | Bacteria | 3424 |
| 163 | Ga0070716_100381338 | 3300006173 | Unclassified | 1008 |
| 164 | Ga0070712_100063109 | 3300006175 | Bacteria | 2621 |
| 165 | Ga0070712_100458031 | 3300006175 | Bacteria | 1063 |
| 166 | Ga0097621_100002409 | 3300006237 | Bacteria | 12810 |
| 167 | Ga0097621_100008767 | 3300006237 | Bacteria | 7306 |
| 168 | Ga0097621_100018773 | 3300006237 | Bacteria | 5291 |
| 169 | Ga0097621_100083545 | 3300006237 | Bacteria | 2661 |
| 170 | Ga0097621_100145515 | 3300006237 | Bacteria | 2028 |
| 171 | Ga0097621_100370978 | 3300006237 | Bacteria | 1277 |
| 172 | Ga0097621_100679909 | 3300006237 | Bacteria | 946 |
| 173 | Ga0068871_100000749 | 3300006358 | Bacteria | 21966 |
| 174 | Ga0068871_100003422 | 3300006358 | Bacteria | 10912 |
| 175 | Ga0068871_100024191 | 3300006358 | Bacteria | 4706 |
| 176 | Ga0068871_100117304 | 3300006358 | Unclassified | 2245 |
| 177 | Ga0068871_100280697 | 3300006358 | Bacteria | 1457 |
| 178 | Ga0068871_100672160 | 3300006358 | Bacteria | 947 |
| 179 | Ga0075428_100040886 | 3300006844 | Bacteria | 5099 |
| 180 | Ga0075428_100043831 | 3300006844 | Bacteria | 4918 |
| 181 | Ga0075428_100054314 | 3300006844 | Bacteria | 4390 |
| 182 | Ga0075430_100146936 | 3300006846 | Bacteria | 1963 |
| 183 | Ga0075430_100162727 | 3300006846 | Bacteria | 1858 |
| 184 | Ga0075431_100008575 | 3300006847 | Bacteria | 10234 |
| 185 | Ga0075431_100221581 | 3300006847 | Bacteria | 1929 |
| 186 | Ga0075429_100260356 | 3300006880 | Unclassified | 1519 |
| 187 | Ga0075429_100373876 | 3300006880 | Unclassified | 1248 |
| 188 | Ga0068865_100004897 | 3300006881 | Bacteria | 8092 |
| 189 | Ga0068865_100231895 | 3300006881 | Bacteria | 1449 |
| 190 | Ga0068865_100303705 | 3300006881 | Unclassified | 1278 |
| 191 | Ga0075436_100413100 | 3300006914 | Unclassified | 979 |
| 192 | Ga0097620_100006386 | 3300006931 | Bacteria | 11960 |
| 193 | Ga0097620_100120748 | 3300006931 | Bacteria | 2687 |
| 194 | Ga0075435_100337470 | 3300007076 | Bacteria | 1291 |
| 195 | Ga0075435_100381688 | 3300007076 | Bacteria | 1210 |
| 196 | Ga0099795_10000246 | 3300007788 | Bacteria | 9648 |
| 197 | Ga0105251_10324974 | 3300009011 | Bacteria | 699 |
| 198 | Ga0105250_10027852 | 3300009092 | Bacteria | 2277 |
| 199 | Ga0105240_10006316 | 3300009093 | Bacteria | 17442 |
| 200 | Ga0105240_10117189 | 3300009093 | Bacteria | 3212 |
| 201 | Ga0105240_10252743 | 3300009093 | Bacteria | 2037 |
| 202 | Ga0111539_10020959 | 3300009094 | Bacteria | 8048 |
| 203 | Ga0111539_10148446 | 3300009094 | Bacteria | 2745 |
| 204 | Ga0111539_10458923 | 3300009094 | Bacteria | 1484 |
| 205 | Ga0111539_11754466 | 3300009094 | Bacteria | 720 |
| 206 | Ga0105245_10042889 | 3300009098 | Bacteria | 4035 |
| 207 | Ga0105245_10047799 | 3300009098 | Bacteria | 3826 |
| 208 | Ga0105245_10164740 | 3300009098 | Bacteria | 2106 |
| 209 | Ga0105245_10347592 | 3300009098 | Bacteria | 1468 |
| 210 | Ga0105245_10426984 | 3300009098 | Bacteria | 1329 |
| 211 | Ga0105247_10044362 | 3300009101 | Bacteria | 2726 |
| 212 | Ga0114129_10018158 | 3300009147 | Bacteria | 10016 |
| 213 | Ga0114129_10036305 | 3300009147 | Bacteria | 6960 |
| 214 | Ga0105243_10075142 | 3300009148 | Bacteria | 2742 |
| 215 | Ga0105243_10510922 | 3300009148 | Bacteria | 1141 |
| 216 | Ga0105241_10035562 | 3300009174 | Bacteria | 3746 |
| 217 | Ga0105241_10060330 | 3300009174 | Unclassified | 2918 |
| 218 | Ga0105241_10213953 | 3300009174 | Bacteria | 1616 |
| 219 | Ga0105241_10733954 | 3300009174 | Bacteria | 904 |
| 220 | Ga0105242_10114466 | 3300009176 | Bacteria | 2305 |
| 221 | Ga0105242_10281456 | 3300009176 | Bacteria | 1511 |
| 222 | Ga0105242_10520350 | 3300009176 | Bacteria | 1135 |
| 223 | Ga0105248_10038158 | 3300009177 | Bacteria | 5376 |
| 224 | Ga0105248_10285851 | 3300009177 | Bacteria | 1857 |
| 225 | Ga0105248_10404428 | 3300009177 | Bacteria | 1537 |
| 226 | Ga0105237_10173242 | 3300009545 | Bacteria | 2158 |
| 227 | Ga0105237_10294971 | 3300009545 | Unclassified | 1624 |
| 228 | Ga0105237_10427516 | 3300009545 | Bacteria | 1330 |
| 229 | Ga0105238_10036048 | 3300009551 | Bacteria | 5028 |
| 230 | Ga0105238_10285725 | 3300009551 | Bacteria | 1631 |
| 231 | Ga0105238_10787308 | 3300009551 | Bacteria | 966 |
| 232 | Ga0105238_10941389 | 3300009551 | Bacteria | 883 |
| 233 | Ga0105238_11088877 | 3300009551 | Unclassified | 821 |
| 234 | Ga0105249_10003588 | 3300009553 | Bacteria | 13424 |
| 235 | Ga0105249_10010741 | 3300009553 | Bacteria | 8044 |
| 236 | Ga0105249_10059935 | 3300009553 | Bacteria | 3491 |
| 237 | Ga0105249_10526139 | 3300009553 | Bacteria | 1230 |
| 238 | Ga0105249_10898455 | 3300009553 | Unclassified | 953 |
| 239 | Ga0105249_11074169 | 3300009553 | Bacteria | 875 |
| 240 | Ga0105249_11151709 | 3300009553 | Unclassified | 846 |
| 241 | Ga0099796_10003697 | 3300010159 | Bacteria | 3592 |
| 242 | Ga0105239_10044072 | 3300010375 | Bacteria | 4891 |
| 243 | Ga0105239_10089941 | 3300010375 | Bacteria | 3386 |
| 244 | Ga0105239_10114964 | 3300010375 | Unclassified | 2985 |
| 245 | Ga0105239_10338725 | 3300010375 | Bacteria | 1697 |
| 246 | Ga0105239_10760741 | 3300010375 | Unclassified | 1109 |
| 247 | Ga0105239_10948715 | 3300010375 | Bacteria | 988 |
| 248 | Ga0105246_10063778 | 3300011119 | Bacteria | 2571 |
| 249 | Ga0105246_10099082 | 3300011119 | Bacteria | 2118 |
| 250 | Ga0105246_10123036 | 3300011119 | Bacteria | 1925 |
| 251 | Ga0105246_10303258 | 3300011119 | Bacteria | 1291 |
| 252 | Ga0105246_10317020 | 3300011119 | Bacteria | 1265 |
| 253 | Ga0157373_10065900 | 3300013100 | Bacteria | 2563 |
| 254 | Ga0157378_10064315 | 3300013297 | Bacteria | 3281 |
| 255 | Ga0157378_10146601 | 3300013297 | Bacteria | 2196 |
| 256 | Ga0157378_10169067 | 3300013297 | Bacteria | 2049 |
| 257 | Ga0157378_10747482 | 3300013297 | Unclassified | 1001 |
| 258 | Ga0163162_10016763 | 3300013306 | Bacteria | 7161 |
| 259 | Ga0163162_10433011 | 3300013306 | Unclassified | 1447 |
| 260 | Ga0163162_10674390 | 3300013306 | Bacteria | 1157 |
| 261 | Ga0157372_11093655 | 3300013307 | Bacteria | 922 |
| 262 | Ga0157375_10031834 | 3300013308 | Bacteria | 4995 |
| 263 | Ga0157375_10081237 | 3300013308 | Bacteria | 3281 |
| 264 | Ga0157375_10363560 | 3300013308 | Bacteria | 1613 |
| 265 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 266 | Ga0163163_10029488 | 3300014325 | Bacteria | 5278 |
| 267 | Ga0163163_10061400 | 3300014325 | Bacteria | 3724 |
| 268 | Ga0163163_10148602 | 3300014325 | Bacteria | 2387 |
| 269 | Ga0163163_10199498 | 3300014325 | Bacteria | 2049 |
| 270 | Ga0157380_10038167 | 3300014326 | Bacteria | 3728 |
| 271 | Ga0157380_10104563 | 3300014326 | Bacteria | 2365 |
| 272 | Ga0157380_10236348 | 3300014326 | Unclassified | 1645 |
| 273 | Ga0157377_10017371 | 3300014745 | Bacteria | 3719 |
| 274 | Ga0157379_10017446 | 3300014968 | Bacteria | 6321 |
| 275 | Ga0157379_10049285 | 3300014968 | Bacteria | 3760 |
| 276 | Ga0157379_10721528 | 3300014968 | Bacteria | 937 |
| 277 | Ga0157376_10067168 | 3300014969 | Bacteria | 3032 |
| 278 | Ga0157376_10069687 | 3300014969 | Bacteria | 2982 |
| 279 | Ga0157376_11084894 | 3300014969 | Bacteria | 826 |
| 280 | Ga0157376_11241954 | 3300014969 | Bacteria | 774 |
| 281 | Ga0163161_10088184 | 3300017792 | Bacteria | 2293 |
| 282 | Ga0163161_10193625 | 3300017792 | Bacteria | 1564 |
| 283 | Ga0163161_10263267 | 3300017792 | Unclassified | 1347 |
| 284 | Ga0213876_10239066 | 3300021384 | Bacteria | 965 |
| 285 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 286 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 287 | Ga0209758_1103827 | 3300025297 | Bacteria | 801 |
| 288 | Ga0207656_10024585 | 3300025321 | Bacteria | 2437 |
| 289 | Ga0207682_10002454 | 3300025893 | Bacteria | 8304 |
| 290 | Ga0207692_10082028 | 3300025898 | Bacteria | 1727 |
| 291 | Ga0207642_10073502 | 3300025899 | Bacteria | 1635 |
| 292 | Ga0207710_10011767 | 3300025900 | Bacteria | 3680 |
| 293 | Ga0207688_10001561 | 3300025901 | Bacteria | 12070 |
| 294 | Ga0207680_10047854 | 3300025903 | Bacteria | 2536 |
| 295 | Ga0207680_10205662 | 3300025903 | Bacteria | 1344 |
| 296 | Ga0207647_10014113 | 3300025904 | Bacteria | 5518 |
| 297 | Ga0207647_10305977 | 3300025904 | Bacteria | 904 |
| 298 | Ga0207685_10096642 | 3300025905 | Unclassified | 1255 |
| 299 | Ga0207645_10137569 | 3300025907 | Bacteria | 1591 |
| 300 | Ga0207643_10000591 | 3300025908 | Bacteria | 23005 |
| 301 | Ga0207643_10021255 | 3300025908 | Bacteria | 3563 |
| 302 | Ga0207705_10082076 | 3300025909 | Bacteria | 2350 |
| 303 | Ga0207705_10517522 | 3300025909 | Bacteria | 927 |
| 304 | Ga0207684_10198564 | 3300025910 | Bacteria | 1730 |
| 305 | Ga0207684_10847429 | 3300025910 | Unclassified | 771 |
| 306 | Ga0207654_10169474 | 3300025911 | Bacteria | 1417 |
| 307 | Ga0207707_10270457 | 3300025912 | Bacteria | 1473 |
| 308 | Ga0207695_10007385 | 3300025913 | Bacteria | 14020 |
| 309 | Ga0207695_10101228 | 3300025913 | Bacteria | 2876 |
| 310 | Ga0207695_10226385 | 3300025913 | Unclassified | 1776 |
| 311 | Ga0207693_10008486 | 3300025915 | Bacteria | 8410 |
| 312 | Ga0207693_10403275 | 3300025915 | Bacteria | 1069 |
| 313 | Ga0207660_10070641 | 3300025917 | Bacteria | 2539 |
| 314 | Ga0207662_10082374 | 3300025918 | Bacteria | 1965 |
| 315 | Ga0207662_10082931 | 3300025918 | Bacteria | 1959 |
| 316 | Ga0207662_10172906 | 3300025918 | Unclassified | 1386 |
| 317 | Ga0207657_10043092 | 3300025919 | Bacteria | 3978 |
| 318 | Ga0207657_10171922 | 3300025919 | Bacteria | 1755 |
| 319 | Ga0207657_10280084 | 3300025919 | Bacteria | 1324 |
| 320 | Ga0207649_10000175 | 3300025920 | Bacteria | 52525 |
| 321 | Ga0207649_10030643 | 3300025920 | Bacteria | 3188 |
| 322 | Ga0207649_10551305 | 3300025920 | Bacteria | 882 |
| 323 | Ga0207652_10102896 | 3300025921 | Bacteria | 2524 |
| 324 | Ga0207652_10904975 | 3300025921 | Bacteria | 779 |
| 325 | Ga0207681_10141331 | 3300025923 | Bacteria | 1793 |
| 326 | Ga0207681_10708607 | 3300025923 | Bacteria | 837 |
| 327 | Ga0207694_10350231 | 3300025924 | Bacteria | 1222 |
| 328 | Ga0207694_10433331 | 3300025924 | Bacteria | 1096 |
| 329 | Ga0207659_10091162 | 3300025926 | Bacteria | 2276 |
| 330 | Ga0207659_10546539 | 3300025926 | Bacteria | 984 |
| 331 | Ga0207687_10012644 | 3300025927 | Bacteria | 5514 |
| 332 | Ga0207687_10144860 | 3300025927 | Bacteria | 1806 |
| 333 | Ga0207700_10215255 | 3300025928 | Bacteria | 1626 |
| 334 | Ga0207700_10324434 | 3300025928 | Bacteria | 1335 |
| 335 | Ga0207644_10012355 | 3300025931 | Bacteria | 5669 |
| 336 | Ga0207644_10184853 | 3300025931 | Bacteria | 1636 |
| 337 | Ga0207690_10109465 | 3300025932 | Bacteria | 1987 |
| 338 | Ga0207706_10001103 | 3300025933 | Bacteria | 27497 |
| 339 | Ga0207706_10107628 | 3300025933 | Unclassified | 2453 |
| 340 | Ga0207706_10767071 | 3300025933 | Bacteria | 821 |
| 341 | Ga0207686_10024854 | 3300025934 | Bacteria | 3477 |
| 342 | Ga0207709_10038896 | 3300025935 | Bacteria | 2837 |
| 343 | Ga0207709_10371222 | 3300025935 | Bacteria | 1086 |
| 344 | Ga0207670_10034012 | 3300025936 | Bacteria | 3289 |
| 345 | Ga0207670_10264696 | 3300025936 | Bacteria | 1334 |
| 346 | Ga0207670_10328578 | 3300025936 | Bacteria | 1205 |
| 347 | Ga0207670_10620206 | 3300025936 | Bacteria | 889 |
| 348 | Ga0207669_10010624 | 3300025937 | Bacteria | 4438 |
| 349 | Ga0207669_10057730 | 3300025937 | Bacteria | 2364 |
| 350 | Ga0207704_10427489 | 3300025938 | Bacteria | 1052 |
| 351 | Ga0207691_10001292 | 3300025940 | Bacteria | 24983 |
| 352 | Ga0207691_10001627 | 3300025940 | Bacteria | 22294 |
| 353 | Ga0207691_10244410 | 3300025940 | Bacteria | 1551 |
| 354 | Ga0207711_10044806 | 3300025941 | Bacteria | 3778 |
| 355 | Ga0207711_10356880 | 3300025941 | Bacteria | 1354 |
| 356 | Ga0207689_10003872 | 3300025942 | Bacteria | 13632 |
| 357 | Ga0207689_10007002 | 3300025942 | Bacteria | 9914 |
| 358 | Ga0207689_10387107 | 3300025942 | Bacteria | 1165 |
| 359 | Ga0207689_10619325 | 3300025942 | Bacteria | 911 |
| 360 | Ga0207661_10021586 | 3300025944 | Bacteria | 4827 |
| 361 | Ga0207679_10240879 | 3300025945 | Bacteria | 1532 |
| 362 | Ga0207679_10299446 | 3300025945 | Bacteria | 1386 |
| 363 | Ga0207651_10018327 | 3300025960 | Bacteria | 4162 |
| 364 | Ga0207651_10031156 | 3300025960 | Bacteria | 3405 |
| 365 | Ga0207651_10265777 | 3300025960 | Bacteria | 1411 |
| 366 | Ga0207651_10601867 | 3300025960 | Unclassified | 961 |
| 367 | Ga0207712_10010489 | 3300025961 | Bacteria | 5882 |
| 368 | Ga0207712_10053294 | 3300025961 | Bacteria | 2837 |
| 369 | Ga0207712_10295183 | 3300025961 | Unclassified | 1328 |
| 370 | Ga0207668_10010533 | 3300025972 | Bacteria | 5590 |
| 371 | Ga0207668_10029820 | 3300025972 | Bacteria | 3579 |
| 372 | Ga0207640_10017964 | 3300025981 | Bacteria | 4147 |
| 373 | Ga0207640_10423110 | 3300025981 | Bacteria | 1091 |
| 374 | Ga0207640_10437322 | 3300025981 | Unclassified | 1075 |
| 375 | Ga0207658_10112977 | 3300025986 | Bacteria | 2151 |
| 376 | Ga0207658_11079153 | 3300025986 | Bacteria | 733 |
| 377 | Ga0207677_10141797 | 3300026023 | Bacteria | 1841 |
| 378 | Ga0207677_10322733 | 3300026023 | Bacteria | 1284 |
| 379 | Ga0207677_10423514 | 3300026023 | Bacteria | 1134 |
| 380 | Ga0207703_10035780 | 3300026035 | Bacteria | 3947 |
| 381 | Ga0207703_10116313 | 3300026035 | Bacteria | 2289 |
| 382 | Ga0207703_10392422 | 3300026035 | Bacteria | 1286 |
| 383 | Ga0207703_10658090 | 3300026035 | Bacteria | 994 |
| 384 | Ga0207639_10050588 | 3300026041 | Bacteria | 3156 |
| 385 | Ga0207639_10254316 | 3300026041 | Bacteria | 1533 |
| 386 | Ga0207639_10417333 | 3300026041 | Bacteria | 1212 |
| 387 | Ga0207639_10535874 | 3300026041 | Bacteria | 1073 |
| 388 | Ga0207678_10006265 | 3300026067 | Bacteria | 10566 |
| 389 | Ga0207708_10000620 | 3300026075 | Bacteria | 27264 |
| 390 | Ga0207702_10255077 | 3300026078 | Bacteria | 1649 |
| 391 | Ga0207702_10558471 | 3300026078 | Bacteria | 1120 |
| 392 | Ga0207641_10115840 | 3300026088 | Bacteria | 2383 |
| 393 | Ga0207641_10438611 | 3300026088 | Unclassified | 1260 |
| 394 | Ga0207648_10002122 | 3300026089 | Bacteria | 21569 |
| 395 | Ga0207648_10010029 | 3300026089 | Bacteria | 9010 |
| 396 | Ga0207648_10027675 | 3300026089 | Bacteria | 5031 |
| 397 | Ga0207648_10049679 | 3300026089 | Bacteria | 3669 |
| 398 | Ga0207648_10988665 | 3300026089 | Unclassified | 788 |
| 399 | Ga0207676_10053395 | 3300026095 | Bacteria | 3163 |
| 400 | Ga0207676_11168283 | 3300026095 | Bacteria | 762 |
| 401 | Ga0207674_10034599 | 3300026116 | Bacteria | 5280 |
| 402 | Ga0207674_10122408 | 3300026116 | Bacteria | 2568 |
| 403 | Ga0207674_10197966 | 3300026116 | Bacteria | 1959 |
| 404 | Ga0207674_10245581 | 3300026116 | Bacteria | 1737 |
| 405 | Ga0207674_10396984 | 3300026116 | Unclassified | 1333 |
| 406 | Ga0207675_100002342 | 3300026118 | Bacteria | 18784 |
| 407 | Ga0207675_100150368 | 3300026118 | Bacteria | 2216 |
| 408 | Ga0207675_100479267 | 3300026118 | Unclassified | 1236 |
| 409 | Ga0207675_100834633 | 3300026118 | Bacteria | 936 |
| 410 | Ga0207675_100871870 | 3300026118 | Bacteria | 916 |
| 411 | Ga0207675_100953798 | 3300026118 | Bacteria | 875 |
| 412 | Ga0207683_10001466 | 3300026121 | Bacteria | 21270 |
| 413 | Ga0207683_10019897 | 3300026121 | Bacteria | 5736 |
| 414 | Ga0207683_10027226 | 3300026121 | Bacteria | 4940 |
| 415 | Ga0207698_10030872 | 3300026142 | Bacteria | 3860 |
| 416 | Ga0207428_10059653 | 3300027907 | Bacteria | 3024 |
| 417 | Ga0207428_10593217 | 3300027907 | Unclassified | 799 |
| 418 | Ga0268266_10030897 | 3300028379 | Bacteria | 4548 |
| 419 | Ga0268266_10060428 | 3300028379 | Bacteria | 3267 |
| 420 | Ga0268266_10085736 | 3300028379 | Unclassified | 2752 |
| 421 | Ga0268266_10096077 | 3300028379 | Bacteria | 2603 |
| 422 | Ga0268266_10190657 | 3300028379 | Bacteria | 1871 |
| 423 | Ga0268265_10003847 | 3300028380 | Bacteria | 10619 |
| 424 | Ga0268265_10008498 | 3300028380 | Bacteria | 6939 |
| 425 | Ga0268265_10113362 | 3300028380 | Bacteria | 2218 |
| 426 | Ga0268265_10177336 | 3300028380 | Bacteria | 1828 |
| 427 | Ga0268265_10698879 | 3300028380 | Bacteria | 979 |
| 428 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 429 | Ga0268264_10010088 | 3300028381 | Bacteria | 7820 |
| 430 | Ga0268264_10013565 | 3300028381 | Bacteria | 6708 |
| 431 | Ga0268264_10273338 | 3300028381 | Bacteria | 1579 |
| 432 | Ga0265325_10005662 | 3300031241 | Bacteria | 7686 |
| 433 | Ga0265340_10020750 | 3300031247 | Bacteria | 3373 |
| 434 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 435 | Ga0265331_10002206 | 3300031250 | Bacteria | 13370 |
| 436 | Ga0265327_10000052 | 3300031251 | Bacteria | 256602 |
| 437 | Ga0265316_10164396 | 3300031344 | Bacteria | 1658 |
| 438 | Ga0265316_10389836 | 3300031344 | Bacteria | 1004 |
| 439 | Ga0307508_10122717 | 3300031616 | Bacteria | 2201 |
| 440 | Ga0265314_10033657 | 3300031711 | Bacteria | 3753 |
| 441 | Ga0265314_10037316 | 3300031711 | Bacteria | 3522 |
| 442 | Ga0265314_10060762 | 3300031711 | Bacteria | 2578 |
| 443 | Ga0307516_10065689 | 3300031730 | Bacteria | 3502 |
| 444 | Ga0307516_10309005 | 3300031730 | Bacteria | 1255 |
| 445 | Ga0373934_0111171 | 3300035086 | Unclassified | 1111 |
| 446 | Ga0373952_0076400 | 3300035092 | Bacteria | 847 |
| 447 | Ga0373936_0061946 | 3300035113 | Bacteria | 1529 |
| 448 | Ga0373936_0070730 | 3300035113 | Bacteria | 1438 |
| 449 | Ga0373945_0008188 | 3300035116 | Bacteria | 3400 |
| 450 | Ga0373953_0094553 | 3300035117 | Bacteria | 1253 |
| 451 | Ga0373954_0328388 | 3300035118 | Bacteria | 755 |
| 452 | Ga0373943_0020649 | 3300035170 | Bacteria | 3038 |
| 453 | Ga0373943_0083043 | 3300035170 | Bacteria | 1646 |
| 454 | Ga0373946_0029455 | 3300035171 | Bacteria | 2185 |
| 455 | Ga0373955_0009688 | 3300035172 | Bacteria | 4524 |
| 456 | Ga0373955_0115161 | 3300035172 | Bacteria | 1558 |
| 457 | Ga0373924_0196336 | 3300035410 | Unclassified | 889 |
| 458 | Ga0373935_0080626 | 3300035692 | Bacteria | 2114 |
| 459 | Ga0373935_0107535 | 3300035692 | Unclassified | 1847 |
| 460 | Ga0373927_0101168 | 3300035695 | Bacteria | 1874 |
| 461 | Ga0373927_0150214 | 3300035695 | Bacteria | 1526 |
| 462 | Ga0373927_0381062 | 3300035695 | Unclassified | 930 |
| 463 | Ga0373947_0043711 | 3300035725 | Bacteria | 2676 |
| 464 | Ga0373947_0060763 | 3300035725 | Bacteria | 2295 |
| 465 | Ga0373947_0118568 | 3300035725 | Bacteria | 1679 |
| 466 | Ga0373937_0000808 | 3300036401 | Bacteria | 26768 |
| 467 | Ga0373925_0075547 | 3300037068 | Bacteria | 2553 |
| 468 | Ga0395900_0493295 | 3300037418 | Bacteria | 1176 |
| 469 | Ga0395898_0046313 | 3300037466 | Bacteria | 4272 |
| 470 | Ga0395905_0189188 | 3300037471 | Bacteria | 1931 |
| 471 | Ga0395905_0606632 | 3300037471 | Bacteria | 996 |
| 472 | Ga0395905_0671457 | 3300037471 | Bacteria | 938 |
| 473 | Ga0395901_0009330 | 3300038443 | Bacteria | 9947 |
| 474 | Ga0436365_0198822 | 3300039437 | Bacteria | 12072 |
| 475 | Ga0436360_0786743 | 3300039438 | Bacteria | 2158 |
| 476 | Ga0436361_0402180 | 3300039447 | Bacteria | 4326 |
| 477 | Ga0466963_0101694 | 3300044694 | Bacteria | 1968 |
| 478 | Ga0495603_0025190 | 3300046455 | Bacteria | 3597 |
| 479 | Ga0495603_0281545 | 3300046455 | Bacteria | 956 |
| 480 | Ga0495638_0017859 | 3300046460 | Bacteria | 4721 |
| 481 | Ga0495580_0091521 | 3300046472 | Bacteria | 2117 |
| 482 | Ga0495582_0039945 | 3300046473 | Bacteria | 2583 |
| 483 | Ga0495605_0026817 | 3300046474 | Bacteria | 2991 |
| 484 | Ga0495605_0041262 | 3300046474 | Bacteria | 2299 |
| 485 | Ga0495605_0192347 | 3300046474 | Unclassified | 892 |
| 486 | Ga0495639_0024031 | 3300046475 | Bacteria | 2680 |
| 487 | Ga0495662_0240447 | 3300046476 | Unclassified | 892 |
| 488 | Ga0495584_0368425 | 3300046491 | Bacteria | 730 |
| 489 | Ga0495585_0038603 | 3300046492 | Bacteria | 2687 |
| 490 | Ga0495585_0057456 | 3300046492 | Bacteria | 2147 |
| 491 | Ga0495594_0114706 | 3300046499 | Bacteria | 1520 |
| 492 | Ga0495596_0088368 | 3300046500 | Bacteria | 1203 |
| 493 | Ga0495607_0053639 | 3300046501 | Bacteria | 2328 |
| 494 | Ga0495607_0138720 | 3300046501 | Bacteria | 1257 |
| 495 | Ga0495608_0320943 | 3300046511 | Unclassified | 957 |
| 496 | Ga0495628_0417019 | 3300046516 | Unclassified | 979 |
| 497 | Ga0495628_0625119 | 3300046516 | Bacteria | 767 |
| 498 | Ga0495630_0105281 | 3300046517 | Bacteria | 2136 |
| 499 | Ga0495644_0059861 | 3300046523 | Bacteria | 1432 |
| 500 | Ga0495648_0170503 | 3300046524 | Unclassified | 1116 |
| 501 | Ga0495663_0005060 | 3300046525 | Bacteria | 3684 |
| 502 | Ga0495663_0112773 | 3300046525 | Bacteria | 905 |
| 503 | Ga0495654_0045497 | 3300046530 | Bacteria | 2165 |
| 504 | Ga0495640_0066787 | 3300046533 | Unclassified | 2425 |
| 505 | Ga0495640_0321109 | 3300046533 | Bacteria | 959 |
| 506 | Ga0495609_0072852 | 3300046538 | Bacteria | 1508 |
| 507 | Ga0495621_0034236 | 3300046539 | Bacteria | 1754 |
| 508 | Ga0495621_0057120 | 3300046539 | Bacteria | 1409 |
| 509 | Ga0495633_0200147 | 3300046558 | Bacteria | 917 |
| 510 | Ga0495667_0220698 | 3300046559 | Bacteria | 1210 |
| 511 | Ga0495656_0028459 | 3300046615 | Bacteria | 2242 |
| 512 | Ga0495656_0085517 | 3300046615 | Bacteria | 1432 |
| 513 | Ga0495668_0056659 | 3300046616 | Bacteria | 2163 |
| 514 | Ga0495634_0063089 | 3300046642 | Bacteria | 2460 |
| 515 | Ga0495659_0060026 | 3300046664 | Bacteria | 1402 |
| 516 | Ga0495659_0259433 | 3300046664 | Bacteria | 726 |
| 517 | Ga0495661_0054985 | 3300046665 | Bacteria | 2388 |
| 518 | Ga0495588_0065970 | 3300046674 | Bacteria | 1878 |
| 519 | Ga0495588_0124324 | 3300046674 | Bacteria | 1360 |
| 520 | Ga0495647_0123894 | 3300046681 | Bacteria | 1090 |
| 521 | Ga0495658_0008659 | 3300046683 | Bacteria | 5049 |
| 522 | Ga0495658_0132021 | 3300046683 | Bacteria | 1521 |
| 523 | Ga0495669_0030683 | 3300046684 | Bacteria | 2360 |
| 524 | Ga0495613_0125834 | 3300046689 | Bacteria | 1838 |
| 525 | Ga0495624_0331798 | 3300046690 | Bacteria | 915 |
| 526 | Ga0495670_0019806 | 3300046691 | Bacteria | 3315 |
| 527 | Ga0495671_0202001 | 3300046692 | Bacteria | 964 |
| 528 | Ga0495649_0115228 | 3300046694 | Bacteria | 1423 |
| 529 | Ga0495581_0185301 | 3300047315 | Bacteria | 1217 |
| 530 | Ga0495676_0031293 | 3300047321 | Bacteria | 4502 |
| 531 | Ga0495676_0418903 | 3300047321 | Bacteria | 887 |
| 532 | Ga0495679_009202 | 3300047446 | Bacteria | 3970 |
| 533 | Ga0495685_084819 | 3300047447 | Bacteria | 1053 |
| 534 | Ga0495684_0163033 | 3300047471 | Unclassified | 1662 |
| 535 | Ga0495602_0351830 | 3300048088 | Bacteria | 1063 |
| 536 | Ga0495614_0308871 | 3300048089 | Bacteria | 732 |
| 537 | Ga0495615_0009836 | 3300048090 | Bacteria | 1893 |
| 538 | Ga0496100_0052828 | 3300048903 | Bacteria | 2643 |
| 539 | Ga0496100_0112909 | 3300048903 | Bacteria | 1890 |
| 540 | Ga0496100_0212877 | 3300048903 | Bacteria | 1414 |
| 541 | Ga0496101_0006039 | 3300048904 | Bacteria | 7771 |
| 542 | Ga0496101_0022942 | 3300048904 | Bacteria | 4303 |
| 543 | Ga0496101_0213854 | 3300048904 | Bacteria | 1494 |
| 544 | Ga0496102_0030424 | 3300048905 | Bacteria | 4832 |
| 545 | Ga0496102_0038590 | 3300048905 | Bacteria | 4311 |
| 546 | Ga0496103_0007690 | 3300048906 | Bacteria | 6407 |
| 547 | Ga0496103_0207773 | 3300048906 | Bacteria | 1259 |
| 548 | Ga0496104_0000671 | 3300048907 | Bacteria | 29392 |
| 549 | Ga0496104_0013106 | 3300048907 | Bacteria | 7471 |
| 550 | Ga0496104_0014367 | 3300048907 | Bacteria | 7153 |
| 551 | Ga0496104_0175951 | 3300048907 | Bacteria | 2050 |
| 552 | Ga0496104_0184912 | 3300048907 | Bacteria | 1994 |
| 553 | Ga0496105_0009471 | 3300048908 | Bacteria | 7621 |
| 554 | Ga0496105_0010252 | 3300048908 | Bacteria | 7367 |
| 555 | Ga0496105_0263459 | 3300048908 | Bacteria | 1393 |
| 556 | Ga0496106_0003496 | 3300048909 | Bacteria | 11703 |
| 557 | Ga0496106_0006990 | 3300048909 | Bacteria | 8335 |
| 558 | Ga0496106_0173641 | 3300048909 | Bacteria | 1709 |
| 559 | Ga0496107_0016347 | 3300048910 | Bacteria | 5208 |
| 560 | Ga0496107_0016379 | 3300048910 | Bacteria | 5204 |
| 561 | Ga0496108_0000347 | 3300048911 | Bacteria | 39108 |
| 562 | Ga0496108_0001531 | 3300048911 | Bacteria | 18306 |
| 563 | Ga0496108_0009690 | 3300048911 | Bacteria | 7804 |
| 564 | Ga0496108_0049755 | 3300048911 | Bacteria | 3505 |
| 565 | Ga0496108_0512843 | 3300048911 | Bacteria | 1047 |
| 566 | Ga0496109_0004728 | 3300048912 | Bacteria | 11376 |
| 567 | Ga0496109_0008070 | 3300048912 | Bacteria | 8922 |
| 568 | Ga0496109_0039283 | 3300048912 | Bacteria | 4283 |
| 569 | Ga0496109_0109428 | 3300048912 | Bacteria | 2568 |
| 570 | Ga0496109_0413601 | 3300048912 | Bacteria | 1274 |
| 571 | Ga0496109_0793474 | 3300048912 | Bacteria | 885 |
| 572 | Ga0496110_0000339 | 3300048913 | Bacteria | 31235 |
| 573 | Ga0496110_0001978 | 3300048913 | Bacteria | 15238 |
| 574 | Ga0496110_0019355 | 3300048913 | Bacteria | 5726 |
| 575 | Ga0496110_0057939 | 3300048913 | Bacteria | 3411 |
| 576 | Ga0496110_0102781 | 3300048913 | Bacteria | 2563 |
| 577 | Ga0496110_0264651 | 3300048913 | Bacteria | 1565 |
| 578 | Ga0496110_1188369 | 3300048913 | Unclassified | 671 |
| 579 | Ga0496111_0001676 | 3300048914 | Bacteria | 12899 |
| 580 | Ga0496111_0012805 | 3300048914 | Bacteria | 5690 |
| 581 | Ga0496111_0016270 | 3300048914 | Bacteria | 5123 |
| 582 | Ga0496111_0082411 | 3300048914 | Bacteria | 2349 |
| 583 | Ga0496112_0001338 | 3300048915 | Bacteria | 18736 |
| 584 | Ga0496112_0004698 | 3300048915 | Bacteria | 11628 |
| 585 | Ga0496112_0011100 | 3300048915 | Bacteria | 8209 |
| 586 | Ga0496112_0129944 | 3300048915 | Bacteria | 2490 |
| 587 | Ga0496112_0165213 | 3300048915 | Bacteria | 2179 |
| 588 | Ga0496112_0467015 | 3300048915 | Bacteria | 1199 |
| 589 | Ga0496113_0000331 | 3300048916 | Bacteria | 22477 |
| 590 | Ga0496113_0008812 | 3300048916 | Bacteria | 6589 |
| 591 | Ga0496113_0144162 | 3300048916 | Bacteria | 1875 |
| 592 | Ga0496114_0030874 | 3300048917 | Bacteria | 4407 |
| 593 | Ga0496114_0333346 | 3300048917 | Bacteria | 1341 |
| 594 | Ga0496114_0892541 | 3300048917 | Bacteria | 770 |
| 595 | Ga0496114_1242492 | 3300048917 | Bacteria | 631 |
| 596 | Ga0496115_0036354 | 3300048918 | Bacteria | 3899 |
| 597 | Ga0496115_0047038 | 3300048918 | Bacteria | 3449 |
| 598 | Ga0496115_0103894 | 3300048918 | Bacteria | 2331 |
| 599 | Ga0496115_0273950 | 3300048918 | Bacteria | 1386 |
| 600 | Ga0496121_0000913 | 3300048924 | Bacteria | 53289 |
| 601 | Ga0496126_0216097 | 3300048929 | Bacteria | 1612 |
| 602 | Ga0501032_0267280 | 3300049569 | Unclassified | 1108 |
| 603 | Ga0501033_0025950 | 3300049570 | Bacteria | 4412 |
| 604 | Ga0501033_0086795 | 3300049570 | Bacteria | 2290 |
| 605 | Ga0501033_0276946 | 3300049570 | Bacteria | 1185 |
| 606 | Ga0501033_0737133 | 3300049570 | Archaea | 669 |
| 607 | Ga0501034_0015949 | 3300049571 | Bacteria | 7711 |
| 608 | Ga0501036_0036722 | 3300049572 | Bacteria | 4147 |
| 609 | Ga0501037_0007536 | 3300049573 | Bacteria | 7969 |
| 610 | Ga0501037_0128768 | 3300049573 | Bacteria | 1816 |
| 611 | Ga0501038_0095310 | 3300049574 | Bacteria | 2486 |
| 612 | Ga0501043_0058645 | 3300049579 | Bacteria | 3021 |
| 613 | Ga0501046_0021675 | 3300049580 | Bacteria | 5300 |
| 614 | Ga0501046_0082042 | 3300049580 | Bacteria | 2491 |
| 615 | Ga0501047_0006741 | 3300049581 | Bacteria | 10795 |
| 616 | Ga0501047_0015028 | 3300049581 | Bacteria | 7368 |
| 617 | Ga0501047_0072211 | 3300049581 | Bacteria | 3322 |
| 618 | Ga0501047_0090486 | 3300049581 | Bacteria | 2937 |
| 619 | Ga0501047_0110036 | 3300049581 | Bacteria | 2638 |
| 620 | Ga0501047_0156437 | 3300049581 | Bacteria | 2153 |
| 621 | Ga0501047_0547428 | 3300049581 | Unclassified | 982 |
| 622 | Ga0501048_0162337 | 3300049582 | Bacteria | 1582 |
| 623 | Ga0501068_0017115 | 3300049584 | Bacteria | 4189 |
| 624 | Ga0501069_0187862 | 3300049585 | Bacteria | 1195 |
| 625 | Ga0501070_0131921 | 3300049586 | Bacteria | 2063 |
| 626 | Ga0501072_0392977 | 3300049588 | Bacteria | 1100 |
| 627 | Ga0501073_0026353 | 3300049589 | Bacteria | 4166 |
| 628 | Ga0501073_0126980 | 3300049589 | Bacteria | 1768 |
| 629 | Ga0501073_0237454 | 3300049589 | Bacteria | 1259 |
| 630 | Ga0501073_0465259 | 3300049589 | Unclassified | 874 |
| 631 | Ga0501074_0088247 | 3300049590 | Bacteria | 2221 |
| 632 | Ga0501075_0399341 | 3300049591 | Bacteria | 1048 |
| 633 | Ga0501076_0435345 | 3300049592 | Bacteria | 1079 |
| 634 | Ga0501083_0050476 | 3300049744 | Bacteria | 2800 |
| 635 | Ga0501083_0143271 | 3300049744 | Bacteria | 1565 |
| 636 | Ga0501083_0345837 | 3300049744 | Bacteria | 967 |
| 637 | Ga0501035_0005667 | 3300049822 | Bacteria | 11792 |
| 638 | Ga0501035_0047019 | 3300049822 | Bacteria | 3877 |
| 639 | Ga0501035_0107410 | 3300049822 | Bacteria | 2447 |
| 640 | Ga0501035_0122134 | 3300049822 | Bacteria | 2276 |
| 641 | Ga0501044_0001467 | 3300049823 | Bacteria | 27692 |
| 642 | Ga0501044_0002022 | 3300049823 | Bacteria | 23376 |
| 643 | Ga0501044_0448684 | 3300049823 | Bacteria | 1197 |
| 644 | Ga0501045_0177915 | 3300049824 | Bacteria | 1585 |
| 645 | nmdc:mga0yw44_49284_c1 | 3300050492 | Bacteria | 2542 |
| 646 | nmdc:mga06z11_110086_c1 | 3300050494 | Bacteria | 1524 |
| 647 | nmdc:mga06z11_367188_c1 | 3300050494 | Unclassified | 863 |
| 648 | nmdc:mga04h51_205716_c1 | 3300050495 | Unclassified | 775 |
| 649 | nmdc:mga07m45_81351_c1 | 3300050496 | Bacteria | 1849 |
| 650 | nmdc:mga05p37_136974_c1 | 3300050507 | Bacteria | 3001 |
| 651 | nmdc:mga05p37_17333_c1 | 3300050507 | Bacteria | 8689 |
| 652 | nmdc:mga05p37_46172_c1 | 3300050507 | Bacteria | 5356 |
| 653 | nmdc:mga05p37_532395_c1 | 3300050507 | Bacteria | 1341 |
| 654 | nmdc:mga09592_502414_c1 | 3300050508 | Unclassified | 1044 |
| 655 | nmdc:mga09592_727214_c1 | 3300050508 | Unclassified | 843 |
| 656 | nmdc:mga0qj67_345665_c1 | 3300050509 | Bacteria | 1203 |
| 657 | nmdc:mga06r32_108563_c1 | 3300050510 | Bacteria | 2728 |
| 658 | nmdc:mga06r32_1264791_c1 | 3300050510 | Unclassified | 683 |
| 659 | nmdc:mga06r32_1271946_c1 | 3300050510 | Bacteria | 680 |
| 660 | nmdc:mga06r32_48157_c1 | 3300050510 | Bacteria | 4074 |
| 661 | nmdc:mga06r32_487534_c1 | 3300050510 | Unclassified | 1210 |
| 662 | nmdc:mga08y16_39967_c1 | 3300050511 | Bacteria | 4920 |
| 663 | nmdc:mga08y16_87901_c1 | 3300050511 | Bacteria | 3238 |
| 664 | nmdc:mga08y16_97049_c1 | 3300050511 | Bacteria | 3069 |
| 665 | nmdc:mga0n895_1105057_c1 | 3300050512 | Bacteria | 770 |
| 666 | nmdc:mga0n895_215953_c2 | 3300050512 | Bacteria | 1042 |
| 667 | nmdc:mga0rr50_738155_c1 | 3300050513 | Bacteria | 840 |
| 668 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 669 | nmdc:mga08x19_338883_c1 | 3300050514 | Unclassified | 1048 |
| 670 | nmdc:mga0a205_261691_c1 | 3300050515 | Bacteria | 1607 |
| 671 | Ga0495601_0035347 | 3300053077 | Bacteria | 3118 |
| 672 | Ga0495655_0000668 | 3300053083 | Bacteria | 5508 |
| 673 | Ga0495619_0009907 | 3300053085 | Bacteria | 6003 |
| 674 | Ga0495619_0065055 | 3300053085 | Bacteria | 2432 |
| 675 | Ga0495619_0098107 | 3300053085 | Bacteria | 1992 |
| 676 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 677 | Ga0500643_001292 | 3300053087 | Bacteria | 14753 |
| 678 | Ga0500643_074680 | 3300053087 | Unclassified | 938 |
| 679 | Ga0500646_0060895 | 3300053090 | Unclassified | 1111 |
| 680 | Ga0500641_0000846 | 3300053096 | Bacteria | 11006 |
| 681 | Ga0500641_0018330 | 3300053096 | Bacteria | 2632 |
| 682 | Ga0500595_016745 | 3300053119 | Bacteria | 2724 |
| 683 | Ga0500568_0025794 | 3300053139 | Bacteria | 2474 |
| 684 | Ga0500568_0071634 | 3300053139 | Bacteria | 1326 |
| 685 | Ga0500573_0000008 | 3300053140 | Bacteria | 237795 |
| 686 | Ga0500577_0106815 | 3300053142 | Bacteria | 1151 |
| 687 | Ga0500639_036474 | 3300053163 | Unclassified | 2593 |
| 688 | Ga0501084_0020727 | 3300054114 | Bacteria | 5483 |
| 689 | Ga0501082_0063296 | 3300060353 | Bacteria | 3185 |
| 690 | Ga0501082_0318909 | 3300060353 | Bacteria | 1354 |
| 691 | Ga0530510_0264563 | 3300061734 | Bacteria | 1283 |
| 692 | Ga0530510_0380697 | 3300061734 | Unclassified | 1062 |
| 693 | Ga0530510_0625729 | 3300061734 | Unclassified | 819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025923 | Ga0207681_10708607 | Ga0207681_107086072 | 166 |
| 2 | 3300048917 | Ga0496114_1242492 | Ga0496114_1242492_29_556 | 175 |
| 3 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_419616_420311 | 177 |
| 4 | 3300005548 | Ga0070665_100220929 | Ga0070665_1002209292 | 180 |
| 5 | 3300049581 | Ga0501047_0072211 | Ga0501047_0072211_2418_3098 | 181 |
| 6 | 3300035725 | Ga0373947_0060763 | Ga0373947_0060763_369_1076 | 183 |
| 7 | 3300026116 | Ga0207674_10245581 | Ga0207674_102455812 | 187 |
| 8 | 3300021384 | Ga0213876_10239066 | Ga0213876_102390662 | 188 |
| 9 | 3300039437 | Ga0436365_0198822 | Ga0436365_0198822_4844_5542 | 188 |
| 10 | 3300048912 | Ga0496109_0793474 | Ga0496109_0793474_14_718 | 188 |
| 11 | 3300005937 | Ga0081455_10138944 | Ga0081455_101389442 | 189 |
| 12 | 3300037418 | Ga0395900_0493295 | Ga0395900_0493295_143_847 | 189 |
| 13 | 3300037471 | Ga0395905_0189188 | Ga0395905_0189188_1012_1716 | 189 |
| 14 | 3300049569 | Ga0501032_0267280 | Ga0501032_0267280_444_1088 | 189 |
| 15 | 3300053087 | Ga0500643_001292 | Ga0500643_001292_165_836 | 189 |
| 16 | 3300005347 | Ga0070668_100004096 | Ga0070668_10000409610 | 192 |
| 17 | 3300005844 | Ga0068862_100073243 | Ga0068862_1000732433 | 192 |
| 18 | 3300026118 | Ga0207675_100871870 | Ga0207675_1008718701 | 192 |
| 19 | 3300028380 | Ga0268265_10003847 | Ga0268265_100038476 | 192 |
| 20 | 3300037471 | Ga0395905_0606632 | Ga0395905_0606632_103_807 | 192 |
| 21 | 3300037471 | Ga0395905_0671457 | Ga0395905_0671457_133_837 | 192 |
| 22 | 3300048911 | Ga0496108_0512843 | Ga0496108_0512843_317_1021 | 192 |
| 23 | 3300005549 | Ga0070704_100038731 | Ga0070704_1000387313 | 193 |
| 24 | 3300005563 | Ga0068855_100034384 | Ga0068855_1000343844 | 193 |
| 25 | 3300009553 | Ga0105249_10003588 | Ga0105249_100035885 | 193 |
| 26 | 3300025961 | Ga0207712_10295183 | Ga0207712_102951832 | 193 |
| 27 | 3300035171 | Ga0373946_0029455 | Ga0373946_0029455_926_1534 | 193 |
| 28 | 3300035725 | Ga0373947_0043711 | Ga0373947_0043711_558_1166 | 193 |
| 29 | 3300046472 | Ga0495580_0091521 | Ga0495580_0091521_908_1516 | 193 |
| 30 | 3300046475 | Ga0495639_0024031 | Ga0495639_0024031_1416_2024 | 193 |
| 31 | 3300046476 | Ga0495662_0240447 | Ga0495662_0240447_16_624 | 193 |
| 32 | 3300046517 | Ga0495630_0105281 | Ga0495630_0105281_166_774 | 193 |
| 33 | 3300046674 | Ga0495588_0065970 | Ga0495588_0065970_58_801 | 193 |
| 34 | 3300047315 | Ga0495581_0185301 | Ga0495581_0185301_595_1203 | 193 |
| 35 | 3300009094 | Ga0111539_10458923 | Ga0111539_104589232 | 195 |
| 36 | 3300028380 | Ga0268265_10177336 | Ga0268265_101773361 | 195 |
| 37 | 3300061734 | Ga0530510_0380697 | Ga0530510_0380697_349_957 | 195 |
| 38 | 3300053096 | Ga0500641_0000846 | Ga0500641_0000846_9481_10155 | 196 |
| 39 | 3300005843 | Ga0068860_100000109 | Ga0068860_10000010948 | 197 |
| 40 | 3300005844 | Ga0068862_100701197 | Ga0068862_1007011971 | 197 |
| 41 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002599 | 197 |
| 42 | 3300005331 | Ga0070670_100019601 | Ga0070670_1000196015 | 199 |
| 43 | 3300005347 | Ga0070668_100003443 | Ga0070668_1000034438 | 199 |
| 44 | 3300005353 | Ga0070669_100103425 | Ga0070669_1001034253 | 199 |
| 45 | 3300005367 | Ga0070667_100011828 | Ga0070667_1000118286 | 199 |
| 46 | 3300005617 | Ga0068859_100006386 | Ga0068859_1000063865 | 199 |
| 47 | 3300005618 | Ga0068864_100076319 | Ga0068864_1000763193 | 199 |
| 48 | 3300005841 | Ga0068863_100013950 | Ga0068863_1000139508 | 199 |
| 49 | 3300005843 | Ga0068860_100266218 | Ga0068860_1002662182 | 199 |
| 50 | 3300005844 | Ga0068862_100003711 | Ga0068862_1000037119 | 199 |
| 51 | 3300006931 | Ga0097620_100006386 | Ga0097620_1000063869 | 199 |
| 52 | 3300025931 | Ga0207644_10184853 | Ga0207644_101848532 | 199 |
| 53 | 3300025972 | Ga0207668_10010533 | Ga0207668_100105336 | 199 |
| 54 | 3300026118 | Ga0207675_100150368 | Ga0207675_1001503683 | 199 |
| 55 | 3300028380 | Ga0268265_10008498 | Ga0268265_100084986 | 199 |
| 56 | 3300028381 | Ga0268264_10013565 | Ga0268264_100135656 | 199 |
| 57 | 3300049822 | Ga0501035_0122134 | Ga0501035_0122134_1115_1837 | 199 |
| 58 | 3300049823 | Ga0501044_0002022 | Ga0501044_0002022_1535_2257 | 199 |
| 59 | 3300003203 | JGI25406J46586_10001759 | JGI25406J46586_100017593 | 201 |
| 60 | 3300005985 | Ga0081539_10003504 | Ga0081539_100035044 | 201 |
| 61 | 3300009098 | Ga0105245_10347592 | Ga0105245_103475922 | 201 |
| 62 | 3300049581 | Ga0501047_0110036 | Ga0501047_0110036_462_1184 | 201 |
| 63 | 3300001977 | JGI24746J21847_1007809 | JGI24746J21847_10078092 | 202 |
| 64 | 3300001991 | JGI24743J22301_10006434 | JGI24743J22301_100064342 | 202 |
| 65 | 3300002070 | JGI24750J21931_1001938 | JGI24750J21931_10019381 | 202 |
| 66 | 3300002073 | JGI24745J21846_1001757 | JGI24745J21846_10017572 | 202 |
| 67 | 3300002075 | JGI24738J21930_10014202 | JGI24738J21930_100142022 | 202 |
| 68 | 3300002076 | JGI24749J21850_1008317 | JGI24749J21850_10083171 | 202 |
| 69 | 3300002077 | JGI24744J21845_10000406 | JGI24744J21845_100004065 | 202 |
| 70 | 3300002244 | JGI24742J22300_10001904 | JGI24742J22300_100019044 | 202 |
| 71 | 3300003215 | JGI25153J46596_10006977 | JGI25153J46596_100069771 | 202 |
| 72 | 3300003659 | JGI25404J52841_10002770 | JGI25404J52841_100027704 | 202 |
| 73 | 3300005328 | Ga0070676_10310741 | Ga0070676_103107412 | 202 |
| 74 | 3300005330 | Ga0070690_100281039 | Ga0070690_1002810392 | 202 |
| 75 | 3300005333 | Ga0070677_10007226 | Ga0070677_100072263 | 202 |
| 76 | 3300005333 | Ga0070677_10172119 | Ga0070677_101721191 | 202 |
| 77 | 3300005334 | Ga0068869_100018551 | Ga0068869_1000185514 | 202 |
| 78 | 3300005334 | Ga0068869_100930773 | Ga0068869_1009307731 | 202 |
| 79 | 3300005335 | Ga0070666_10016334 | Ga0070666_100163344 | 202 |
| 80 | 3300005335 | Ga0070666_10218196 | Ga0070666_102181962 | 202 |
| 81 | 3300005335 | Ga0070666_10320437 | Ga0070666_103204372 | 202 |
| 82 | 3300005336 | Ga0070680_100376706 | Ga0070680_1003767062 | 202 |
| 83 | 3300005337 | Ga0070682_100001556 | Ga0070682_1000015563 | 202 |
| 84 | 3300005337 | Ga0070682_100010810 | Ga0070682_1000108102 | 202 |
| 85 | 3300005337 | Ga0070682_100694673 | Ga0070682_1006946732 | 202 |
| 86 | 3300005338 | Ga0068868_100010355 | Ga0068868_1000103554 | 202 |
| 87 | 3300005338 | Ga0068868_100346087 | Ga0068868_1003460872 | 202 |
| 88 | 3300005338 | Ga0068868_100531176 | Ga0068868_1005311762 | 202 |
| 89 | 3300005339 | Ga0070660_100043079 | Ga0070660_1000430794 | 202 |
| 90 | 3300005339 | Ga0070660_100097872 | Ga0070660_1000978723 | 202 |
| 91 | 3300005340 | Ga0070689_100124521 | Ga0070689_1001245212 | 202 |
| 92 | 3300005340 | Ga0070689_100365883 | Ga0070689_1003658831 | 202 |
| 93 | 3300005341 | Ga0070691_10041216 | Ga0070691_100412162 | 202 |
| 94 | 3300005343 | Ga0070687_100310669 | Ga0070687_1003106692 | 202 |
| 95 | 3300005344 | Ga0070661_100000071 | Ga0070661_1000000712 | 202 |
| 96 | 3300005345 | Ga0070692_10114576 | Ga0070692_101145762 | 202 |
| 97 | 3300005347 | Ga0070668_100075925 | Ga0070668_1000759252 | 202 |
| 98 | 3300005353 | Ga0070669_100184306 | Ga0070669_1001843062 | 202 |
| 99 | 3300005353 | Ga0070669_100456341 | Ga0070669_1004563411 | 202 |
| 100 | 3300005354 | Ga0070675_100078289 | Ga0070675_1000782893 | 202 |
| 101 | 3300005355 | Ga0070671_100003476 | Ga0070671_1000034764 | 202 |
| 102 | 3300005355 | Ga0070671_100076539 | Ga0070671_1000765392 | 202 |
| 103 | 3300005356 | Ga0070674_100007703 | Ga0070674_1000077032 | 202 |
| 104 | 3300005356 | Ga0070674_100042735 | Ga0070674_1000427352 | 202 |
| 105 | 3300005364 | Ga0070673_100012560 | Ga0070673_1000125605 | 202 |
| 106 | 3300005364 | Ga0070673_100013937 | Ga0070673_1000139374 | 202 |
| 107 | 3300005364 | Ga0070673_100698000 | Ga0070673_1006980001 | 202 |
| 108 | 3300005365 | Ga0070688_100049175 | Ga0070688_1000491751 | 202 |
| 109 | 3300005365 | Ga0070688_100057908 | Ga0070688_1000579082 | 202 |
| 110 | 3300005365 | Ga0070688_100193467 | Ga0070688_1001934672 | 202 |
| 111 | 3300005366 | Ga0070659_100009307 | Ga0070659_1000093077 | 202 |
| 112 | 3300005366 | Ga0070659_100104161 | Ga0070659_1001041613 | 202 |
| 113 | 3300005366 | Ga0070659_101160990 | Ga0070659_1011609901 | 202 |
| 114 | 3300005367 | Ga0070667_100873381 | Ga0070667_1008733812 | 202 |
| 115 | 3300005367 | Ga0070667_101030747 | Ga0070667_1010307471 | 202 |
| 116 | 3300005436 | Ga0070713_100161785 | Ga0070713_1001617852 | 202 |
| 117 | 3300005436 | Ga0070713_100175301 | Ga0070713_1001753012 | 202 |
| 118 | 3300005436 | Ga0070713_100296663 | Ga0070713_1002966632 | 202 |
| 119 | 3300005437 | Ga0070710_10348158 | Ga0070710_103481582 | 202 |
| 120 | 3300005438 | Ga0070701_10005829 | Ga0070701_100058292 | 202 |
| 121 | 3300005438 | Ga0070701_10082252 | Ga0070701_100822521 | 202 |
| 122 | 3300005438 | Ga0070701_10236131 | Ga0070701_102361312 | 202 |
| 123 | 3300005439 | Ga0070711_100116747 | Ga0070711_1001167472 | 202 |
| 124 | 3300005439 | Ga0070711_100123025 | Ga0070711_1001230252 | 202 |
| 125 | 3300005440 | Ga0070705_100387009 | Ga0070705_1003870092 | 202 |
| 126 | 3300005441 | Ga0070700_100003371 | Ga0070700_1000033714 | 202 |
| 127 | 3300005445 | Ga0070708_100257117 | Ga0070708_1002571172 | 202 |
| 128 | 3300005455 | Ga0070663_100166853 | Ga0070663_1001668533 | 202 |
| 129 | 3300005455 | Ga0070663_100647865 | Ga0070663_1006478651 | 202 |
| 130 | 3300005456 | Ga0070678_100005894 | Ga0070678_1000058944 | 202 |
| 131 | 3300005456 | Ga0070678_100164216 | Ga0070678_1001642162 | 202 |
| 132 | 3300005456 | Ga0070678_100734975 | Ga0070678_1007349752 | 202 |
| 133 | 3300005457 | Ga0070662_100008277 | Ga0070662_1000082774 | 202 |
| 134 | 3300005457 | Ga0070662_100456139 | Ga0070662_1004561392 | 202 |
| 135 | 3300005458 | Ga0070681_10473516 | Ga0070681_104735161 | 202 |
| 136 | 3300005459 | Ga0068867_100026540 | Ga0068867_1000265403 | 202 |
| 137 | 3300005459 | Ga0068867_100088507 | Ga0068867_1000885073 | 202 |
| 138 | 3300005459 | Ga0068867_100137146 | Ga0068867_1001371462 | 202 |
| 139 | 3300005466 | Ga0070685_10023342 | Ga0070685_100233422 | 202 |
| 140 | 3300005466 | Ga0070685_10328629 | Ga0070685_103286292 | 202 |
| 141 | 3300005467 | Ga0070706_100189788 | Ga0070706_1001897882 | 202 |
| 142 | 3300005471 | Ga0070698_100450669 | Ga0070698_1004506692 | 202 |
| 143 | 3300005518 | Ga0070699_100005212 | Ga0070699_1000052125 | 202 |
| 144 | 3300005536 | Ga0070697_100002109 | Ga0070697_1000021094 | 202 |
| 145 | 3300005536 | Ga0070697_100246294 | Ga0070697_1002462942 | 202 |
| 146 | 3300005539 | Ga0068853_100158380 | Ga0068853_1001583803 | 202 |
| 147 | 3300005539 | Ga0068853_100395293 | Ga0068853_1003952931 | 202 |
| 148 | 3300005539 | Ga0068853_101417466 | Ga0068853_1014174661 | 202 |
| 149 | 3300005543 | Ga0070672_100015823 | Ga0070672_1000158234 | 202 |
| 150 | 3300005543 | Ga0070672_100555546 | Ga0070672_1005555462 | 202 |
| 151 | 3300005543 | Ga0070672_100706927 | Ga0070672_1007069271 | 202 |
| 152 | 3300005544 | Ga0070686_100078608 | Ga0070686_1000786082 | 202 |
| 153 | 3300005544 | Ga0070686_100263172 | Ga0070686_1002631722 | 202 |
| 154 | 3300005544 | Ga0070686_100750294 | Ga0070686_1007502941 | 202 |
| 155 | 3300005545 | Ga0070695_100014840 | Ga0070695_1000148404 | 202 |
| 156 | 3300005545 | Ga0070695_100464231 | Ga0070695_1004642312 | 202 |
| 157 | 3300005547 | Ga0070693_100031441 | Ga0070693_1000314413 | 202 |
| 158 | 3300005547 | Ga0070693_100340603 | Ga0070693_1003406031 | 202 |
| 159 | 3300005548 | Ga0070665_100007652 | Ga0070665_1000076527 | 202 |
| 160 | 3300005548 | Ga0070665_100126088 | Ga0070665_1001260882 | 202 |
| 161 | 3300005548 | Ga0070665_100163572 | Ga0070665_1001635725 | 202 |
| 162 | 3300005548 | Ga0070665_100256853 | Ga0070665_1002568532 | 202 |
| 163 | 3300005564 | Ga0070664_100108510 | Ga0070664_1001085102 | 202 |
| 164 | 3300005577 | Ga0068857_100072289 | Ga0068857_1000722894 | 202 |
| 165 | 3300005577 | Ga0068857_100439879 | Ga0068857_1004398791 | 202 |
| 166 | 3300005577 | Ga0068857_100659911 | Ga0068857_1006599112 | 202 |
| 167 | 3300005614 | Ga0068856_100216260 | Ga0068856_1002162602 | 202 |
| 168 | 3300005614 | Ga0068856_100779655 | Ga0068856_1007796552 | 202 |
| 169 | 3300005615 | Ga0070702_100016894 | Ga0070702_1000168942 | 202 |
| 170 | 3300005615 | Ga0070702_100137375 | Ga0070702_1001373752 | 202 |
| 171 | 3300005616 | Ga0068852_100065766 | Ga0068852_1000657663 | 202 |
| 172 | 3300005617 | Ga0068859_100120749 | Ga0068859_1001207492 | 202 |
| 173 | 3300005618 | Ga0068864_100001978 | Ga0068864_10000197819 | 202 |
| 174 | 3300005618 | Ga0068864_100064299 | Ga0068864_1000642991 | 202 |
| 175 | 3300005718 | Ga0068866_10024482 | Ga0068866_100244823 | 202 |
| 176 | 3300005718 | Ga0068866_10042587 | Ga0068866_100425872 | 202 |
| 177 | 3300005718 | Ga0068866_10045488 | Ga0068866_100454882 | 202 |
| 178 | 3300005719 | Ga0068861_100018551 | Ga0068861_1000185513 | 202 |
| 179 | 3300005834 | Ga0068851_10056896 | Ga0068851_100568962 | 202 |
| 180 | 3300005840 | Ga0068870_10003152 | Ga0068870_100031522 | 202 |
| 181 | 3300005840 | Ga0068870_10086818 | Ga0068870_100868183 | 202 |
| 182 | 3300005841 | Ga0068863_100002977 | Ga0068863_10000297713 | 202 |
| 183 | 3300005841 | Ga0068863_100545543 | Ga0068863_1005455432 | 202 |
| 184 | 3300005842 | Ga0068858_100046689 | Ga0068858_1000466894 | 202 |
| 185 | 3300005842 | Ga0068858_100135578 | Ga0068858_1001355782 | 202 |
| 186 | 3300005842 | Ga0068858_100245783 | Ga0068858_1002457832 | 202 |
| 187 | 3300005842 | Ga0068858_100366326 | Ga0068858_1003663262 | 202 |
| 188 | 3300005843 | Ga0068860_100018969 | Ga0068860_1000189694 | 202 |
| 189 | 3300005844 | Ga0068862_100139865 | Ga0068862_1001398652 | 202 |
| 190 | 3300005937 | Ga0081455_10016680 | Ga0081455_100166805 | 202 |
| 191 | 3300005937 | Ga0081455_10068364 | Ga0081455_100683642 | 202 |
| 192 | 3300005937 | Ga0081455_10087507 | Ga0081455_100875073 | 202 |
| 193 | 3300005937 | Ga0081455_10179887 | Ga0081455_101798872 | 202 |
| 194 | 3300005937 | Ga0081455_10217491 | Ga0081455_102174912 | 202 |
| 195 | 3300005981 | Ga0081538_10006350 | Ga0081538_100063502 | 202 |
| 196 | 3300005981 | Ga0081538_10073205 | Ga0081538_100732052 | 202 |
| 197 | 3300005983 | Ga0081540_1005049 | Ga0081540_10050497 | 202 |
| 198 | 3300005983 | Ga0081540_1074935 | Ga0081540_10749352 | 202 |
| 199 | 3300006028 | Ga0070717_10493952 | Ga0070717_104939522 | 202 |
| 200 | 3300006028 | Ga0070717_10610656 | Ga0070717_106106562 | 202 |
| 201 | 3300006038 | Ga0075365_10024636 | Ga0075365_100246362 | 202 |
| 202 | 3300006038 | Ga0075365_10041919 | Ga0075365_100419192 | 202 |
| 203 | 3300006042 | Ga0075368_10237893 | Ga0075368_102378932 | 202 |
| 204 | 3300006048 | Ga0075363_100021892 | Ga0075363_1000218926 | 202 |
| 205 | 3300006163 | Ga0070715_10009553 | Ga0070715_100095532 | 202 |
| 206 | 3300006173 | Ga0070716_100381338 | Ga0070716_1003813382 | 202 |
| 207 | 3300006175 | Ga0070712_100063109 | Ga0070712_1000631093 | 202 |
| 208 | 3300006175 | Ga0070712_100458031 | Ga0070712_1004580312 | 202 |
| 209 | 3300006237 | Ga0097621_100002409 | Ga0097621_10000240911 | 202 |
| 210 | 3300006237 | Ga0097621_100008767 | Ga0097621_1000087678 | 202 |
| 211 | 3300006237 | Ga0097621_100018773 | Ga0097621_1000187735 | 202 |
| 212 | 3300006237 | Ga0097621_100083545 | Ga0097621_1000835451 | 202 |
| 213 | 3300006237 | Ga0097621_100145515 | Ga0097621_1001455152 | 202 |
| 214 | 3300006237 | Ga0097621_100370978 | Ga0097621_1003709782 | 202 |
| 215 | 3300006237 | Ga0097621_100679909 | Ga0097621_1006799091 | 202 |
| 216 | 3300006358 | Ga0068871_100000749 | Ga0068871_10000074912 | 202 |
| 217 | 3300006358 | Ga0068871_100003422 | Ga0068871_1000034225 | 202 |
| 218 | 3300006358 | Ga0068871_100024191 | Ga0068871_1000241911 | 202 |
| 219 | 3300006358 | Ga0068871_100117304 | Ga0068871_1001173042 | 202 |
| 220 | 3300006358 | Ga0068871_100280697 | Ga0068871_1002806971 | 202 |
| 221 | 3300006358 | Ga0068871_100672160 | Ga0068871_1006721602 | 202 |
| 222 | 3300006844 | Ga0075428_100040886 | Ga0075428_1000408862 | 202 |
| 223 | 3300006844 | Ga0075428_100043831 | Ga0075428_1000438314 | 202 |
| 224 | 3300006844 | Ga0075428_100054314 | Ga0075428_1000543144 | 202 |
| 225 | 3300006846 | Ga0075430_100146936 | Ga0075430_1001469362 | 202 |
| 226 | 3300006846 | Ga0075430_100162727 | Ga0075430_1001627272 | 202 |
| 227 | 3300006847 | Ga0075431_100008575 | Ga0075431_1000085755 | 202 |
| 228 | 3300006847 | Ga0075431_100221581 | Ga0075431_1002215812 | 202 |
| 229 | 3300006880 | Ga0075429_100260356 | Ga0075429_1002603562 | 202 |
| 230 | 3300006880 | Ga0075429_100373876 | Ga0075429_1003738762 | 202 |
| 231 | 3300006881 | Ga0068865_100004897 | Ga0068865_1000048974 | 202 |
| 232 | 3300006881 | Ga0068865_100231895 | Ga0068865_1002318952 | 202 |
| 233 | 3300006881 | Ga0068865_100303705 | Ga0068865_1003037052 | 202 |
| 234 | 3300006914 | Ga0075436_100413100 | Ga0075436_1004131001 | 202 |
| 235 | 3300006931 | Ga0097620_100120748 | Ga0097620_1001207482 | 202 |
| 236 | 3300007076 | Ga0075435_100337470 | Ga0075435_1003374702 | 202 |
| 237 | 3300007076 | Ga0075435_100381688 | Ga0075435_1003816881 | 202 |
| 238 | 3300007788 | Ga0099795_10000246 | Ga0099795_1000024610 | 202 |
| 239 | 3300009011 | Ga0105251_10324974 | Ga0105251_103249741 | 202 |
| 240 | 3300009092 | Ga0105250_10027852 | Ga0105250_100278523 | 202 |
| 241 | 3300009093 | Ga0105240_10006316 | Ga0105240_1000631615 | 202 |
| 242 | 3300009093 | Ga0105240_10117189 | Ga0105240_101171895 | 202 |
| 243 | 3300009093 | Ga0105240_10252743 | Ga0105240_102527432 | 202 |
| 244 | 3300009094 | Ga0111539_10020959 | Ga0111539_100209594 | 202 |
| 245 | 3300009094 | Ga0111539_10148446 | Ga0111539_101484462 | 202 |
| 246 | 3300009094 | Ga0111539_11754466 | Ga0111539_117544661 | 202 |
| 247 | 3300009098 | Ga0105245_10042889 | Ga0105245_100428894 | 202 |
| 248 | 3300009098 | Ga0105245_10047799 | Ga0105245_100477994 | 202 |
| 249 | 3300009098 | Ga0105245_10164740 | Ga0105245_101647402 | 202 |
| 250 | 3300009098 | Ga0105245_10426984 | Ga0105245_104269842 | 202 |
| 251 | 3300009101 | Ga0105247_10044362 | Ga0105247_100443623 | 202 |
| 252 | 3300009147 | Ga0114129_10018158 | Ga0114129_100181586 | 202 |
| 253 | 3300009147 | Ga0114129_10036305 | Ga0114129_100363056 | 202 |
| 254 | 3300009148 | Ga0105243_10075142 | Ga0105243_100751423 | 202 |
| 255 | 3300009148 | Ga0105243_10510922 | Ga0105243_105109222 | 202 |
| 256 | 3300009174 | Ga0105241_10035562 | Ga0105241_100355621 | 202 |
| 257 | 3300009174 | Ga0105241_10060330 | Ga0105241_100603302 | 202 |
| 258 | 3300009174 | Ga0105241_10213953 | Ga0105241_102139532 | 202 |
| 259 | 3300009174 | Ga0105241_10733954 | Ga0105241_107339541 | 202 |
| 260 | 3300009176 | Ga0105242_10114466 | Ga0105242_101144663 | 202 |
| 261 | 3300009176 | Ga0105242_10281456 | Ga0105242_102814562 | 202 |
| 262 | 3300009176 | Ga0105242_10520350 | Ga0105242_105203502 | 202 |
| 263 | 3300009177 | Ga0105248_10038158 | Ga0105248_100381582 | 202 |
| 264 | 3300009177 | Ga0105248_10285851 | Ga0105248_102858513 | 202 |
| 265 | 3300009177 | Ga0105248_10404428 | Ga0105248_104044282 | 202 |
| 266 | 3300009545 | Ga0105237_10173242 | Ga0105237_101732423 | 202 |
| 267 | 3300009545 | Ga0105237_10294971 | Ga0105237_102949712 | 202 |
| 268 | 3300009545 | Ga0105237_10427516 | Ga0105237_104275162 | 202 |
| 269 | 3300009551 | Ga0105238_10036048 | Ga0105238_100360483 | 202 |
| 270 | 3300009551 | Ga0105238_10285725 | Ga0105238_102857252 | 202 |
| 271 | 3300009551 | Ga0105238_10787308 | Ga0105238_107873082 | 202 |
| 272 | 3300009551 | Ga0105238_10941389 | Ga0105238_109413892 | 202 |
| 273 | 3300009551 | Ga0105238_11088877 | Ga0105238_110888771 | 202 |
| 274 | 3300009553 | Ga0105249_10010741 | Ga0105249_100107414 | 202 |
| 275 | 3300009553 | Ga0105249_10059935 | Ga0105249_100599354 | 202 |
| 276 | 3300009553 | Ga0105249_10526139 | Ga0105249_105261392 | 202 |
| 277 | 3300009553 | Ga0105249_10898455 | Ga0105249_108984552 | 202 |
| 278 | 3300009553 | Ga0105249_11074169 | Ga0105249_110741692 | 202 |
| 279 | 3300009553 | Ga0105249_11151709 | Ga0105249_111517091 | 202 |
| 280 | 3300010159 | Ga0099796_10003697 | Ga0099796_100036972 | 202 |
| 281 | 3300010375 | Ga0105239_10044072 | Ga0105239_100440725 | 202 |
| 282 | 3300010375 | Ga0105239_10089941 | Ga0105239_100899414 | 202 |
| 283 | 3300010375 | Ga0105239_10114964 | Ga0105239_101149642 | 202 |
| 284 | 3300010375 | Ga0105239_10338725 | Ga0105239_103387252 | 202 |
| 285 | 3300010375 | Ga0105239_10760741 | Ga0105239_107607411 | 202 |
| 286 | 3300010375 | Ga0105239_10948715 | Ga0105239_109487151 | 202 |
| 287 | 3300011119 | Ga0105246_10063778 | Ga0105246_100637783 | 202 |
| 288 | 3300011119 | Ga0105246_10099082 | Ga0105246_100990823 | 202 |
| 289 | 3300011119 | Ga0105246_10123036 | Ga0105246_101230363 | 202 |
| 290 | 3300011119 | Ga0105246_10303258 | Ga0105246_103032582 | 202 |
| 291 | 3300011119 | Ga0105246_10317020 | Ga0105246_103170202 | 202 |
| 292 | 3300013100 | Ga0157373_10065900 | Ga0157373_100659002 | 202 |
| 293 | 3300013297 | Ga0157378_10064315 | Ga0157378_100643152 | 202 |
| 294 | 3300013297 | Ga0157378_10146601 | Ga0157378_101466011 | 202 |
| 295 | 3300013297 | Ga0157378_10169067 | Ga0157378_101690672 | 202 |
| 296 | 3300013297 | Ga0157378_10747482 | Ga0157378_107474822 | 202 |
| 297 | 3300013306 | Ga0163162_10016763 | Ga0163162_100167636 | 202 |
| 298 | 3300013306 | Ga0163162_10433011 | Ga0163162_104330112 | 202 |
| 299 | 3300013306 | Ga0163162_10674390 | Ga0163162_106743902 | 202 |
| 300 | 3300013307 | Ga0157372_11093655 | Ga0157372_110936552 | 202 |
| 301 | 3300013308 | Ga0157375_10031834 | Ga0157375_100318342 | 202 |
| 302 | 3300013308 | Ga0157375_10081237 | Ga0157375_100812372 | 202 |
| 303 | 3300013308 | Ga0157375_10363560 | Ga0157375_103635602 | 202 |
| 304 | 3300014325 | Ga0163163_10000002 | Ga0163163_1000000272 | 202 |
| 305 | 3300014325 | Ga0163163_10029488 | Ga0163163_100294887 | 202 |
| 306 | 3300014325 | Ga0163163_10061400 | Ga0163163_100614004 | 202 |
| 307 | 3300014325 | Ga0163163_10148602 | Ga0163163_101486022 | 202 |
| 308 | 3300014325 | Ga0163163_10199498 | Ga0163163_101994982 | 202 |
| 309 | 3300014326 | Ga0157380_10038167 | Ga0157380_100381671 | 202 |
| 310 | 3300014326 | Ga0157380_10104563 | Ga0157380_101045632 | 202 |
| 311 | 3300014326 | Ga0157380_10236348 | Ga0157380_102363482 | 202 |
| 312 | 3300014745 | Ga0157377_10017371 | Ga0157377_100173712 | 202 |
| 313 | 3300014968 | Ga0157379_10017446 | Ga0157379_100174467 | 202 |
| 314 | 3300014968 | Ga0157379_10049285 | Ga0157379_100492853 | 202 |
| 315 | 3300014968 | Ga0157379_10721528 | Ga0157379_107215281 | 202 |
| 316 | 3300014969 | Ga0157376_10067168 | Ga0157376_100671683 | 202 |
| 317 | 3300014969 | Ga0157376_10069687 | Ga0157376_100696871 | 202 |
| 318 | 3300014969 | Ga0157376_11084894 | Ga0157376_110848941 | 202 |
| 319 | 3300014969 | Ga0157376_11241954 | Ga0157376_112419541 | 202 |
| 320 | 3300017792 | Ga0163161_10088184 | Ga0163161_100881842 | 202 |
| 321 | 3300017792 | Ga0163161_10193625 | Ga0163161_101936251 | 202 |
| 322 | 3300017792 | Ga0163161_10263267 | Ga0163161_102632671 | 202 |
| 323 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015589 | 202 |
| 324 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013758 | 202 |
| 325 | 3300025297 | Ga0209758_1103827 | Ga0209758_11038271 | 202 |
| 326 | 3300025321 | Ga0207656_10024585 | Ga0207656_100245853 | 202 |
| 327 | 3300025893 | Ga0207682_10002454 | Ga0207682_100024545 | 202 |
| 328 | 3300025898 | Ga0207692_10082028 | Ga0207692_100820282 | 202 |
| 329 | 3300025899 | Ga0207642_10073502 | Ga0207642_100735022 | 202 |
| 330 | 3300025900 | Ga0207710_10011767 | Ga0207710_100117674 | 202 |
| 331 | 3300025901 | Ga0207688_10001561 | Ga0207688_100015614 | 202 |
| 332 | 3300025903 | Ga0207680_10047854 | Ga0207680_100478542 | 202 |
| 333 | 3300025903 | Ga0207680_10205662 | Ga0207680_102056622 | 202 |
| 334 | 3300025904 | Ga0207647_10014113 | Ga0207647_100141134 | 202 |
| 335 | 3300025904 | Ga0207647_10305977 | Ga0207647_103059771 | 202 |
| 336 | 3300025905 | Ga0207685_10096642 | Ga0207685_100966421 | 202 |
| 337 | 3300025907 | Ga0207645_10137569 | Ga0207645_101375692 | 202 |
| 338 | 3300025908 | Ga0207643_10000591 | Ga0207643_100005917 | 202 |
| 339 | 3300025908 | Ga0207643_10021255 | Ga0207643_100212553 | 202 |
| 340 | 3300025909 | Ga0207705_10082076 | Ga0207705_100820761 | 202 |
| 341 | 3300025909 | Ga0207705_10517522 | Ga0207705_105175222 | 202 |
| 342 | 3300025910 | Ga0207684_10198564 | Ga0207684_101985642 | 202 |
| 343 | 3300025910 | Ga0207684_10847429 | Ga0207684_108474292 | 202 |
| 344 | 3300025911 | Ga0207654_10169474 | Ga0207654_101694742 | 202 |
| 345 | 3300025912 | Ga0207707_10270457 | Ga0207707_102704572 | 202 |
| 346 | 3300025913 | Ga0207695_10007385 | Ga0207695_100073855 | 202 |
| 347 | 3300025913 | Ga0207695_10101228 | Ga0207695_101012283 | 202 |
| 348 | 3300025913 | Ga0207695_10226385 | Ga0207695_102263852 | 202 |
| 349 | 3300025915 | Ga0207693_10008486 | Ga0207693_100084864 | 202 |
| 350 | 3300025915 | Ga0207693_10403275 | Ga0207693_104032752 | 202 |
| 351 | 3300025917 | Ga0207660_10070641 | Ga0207660_100706413 | 202 |
| 352 | 3300025918 | Ga0207662_10082374 | Ga0207662_100823742 | 202 |
| 353 | 3300025918 | Ga0207662_10082931 | Ga0207662_100829313 | 202 |
| 354 | 3300025918 | Ga0207662_10172906 | Ga0207662_101729062 | 202 |
| 355 | 3300025919 | Ga0207657_10043092 | Ga0207657_100430922 | 202 |
| 356 | 3300025919 | Ga0207657_10171922 | Ga0207657_101719222 | 202 |
| 357 | 3300025919 | Ga0207657_10280084 | Ga0207657_102800842 | 202 |
| 358 | 3300025920 | Ga0207649_10000175 | Ga0207649_1000017542 | 202 |
| 359 | 3300025920 | Ga0207649_10030643 | Ga0207649_100306434 | 202 |
| 360 | 3300025920 | Ga0207649_10551305 | Ga0207649_105513051 | 202 |
| 361 | 3300025921 | Ga0207652_10102896 | Ga0207652_101028963 | 202 |
| 362 | 3300025921 | Ga0207652_10904975 | Ga0207652_109049751 | 202 |
| 363 | 3300025923 | Ga0207681_10141331 | Ga0207681_101413312 | 202 |
| 364 | 3300025924 | Ga0207694_10350231 | Ga0207694_103502312 | 202 |
| 365 | 3300025924 | Ga0207694_10433331 | Ga0207694_104333312 | 202 |
| 366 | 3300025926 | Ga0207659_10091162 | Ga0207659_100911622 | 202 |
| 367 | 3300025926 | Ga0207659_10546539 | Ga0207659_105465392 | 202 |
| 368 | 3300025927 | Ga0207687_10012644 | Ga0207687_100126444 | 202 |
| 369 | 3300025927 | Ga0207687_10144860 | Ga0207687_101448601 | 202 |
| 370 | 3300025928 | Ga0207700_10215255 | Ga0207700_102152552 | 202 |
| 371 | 3300025928 | Ga0207700_10324434 | Ga0207700_103244342 | 202 |
| 372 | 3300025931 | Ga0207644_10012355 | Ga0207644_100123553 | 202 |
| 373 | 3300025932 | Ga0207690_10109465 | Ga0207690_101094652 | 202 |
| 374 | 3300025933 | Ga0207706_10001103 | Ga0207706_100011036 | 202 |
| 375 | 3300025933 | Ga0207706_10107628 | Ga0207706_101076281 | 202 |
| 376 | 3300025933 | Ga0207706_10767071 | Ga0207706_107670711 | 202 |
| 377 | 3300025934 | Ga0207686_10024854 | Ga0207686_100248544 | 202 |
| 378 | 3300025935 | Ga0207709_10038896 | Ga0207709_100388964 | 202 |
| 379 | 3300025935 | Ga0207709_10371222 | Ga0207709_103712221 | 202 |
| 380 | 3300025936 | Ga0207670_10034012 | Ga0207670_100340124 | 202 |
| 381 | 3300025936 | Ga0207670_10264696 | Ga0207670_102646962 | 202 |
| 382 | 3300025936 | Ga0207670_10328578 | Ga0207670_103285782 | 202 |
| 383 | 3300025936 | Ga0207670_10620206 | Ga0207670_106202061 | 202 |
| 384 | 3300025937 | Ga0207669_10010624 | Ga0207669_100106241 | 202 |
| 385 | 3300025937 | Ga0207669_10057730 | Ga0207669_100577303 | 202 |
| 386 | 3300025938 | Ga0207704_10427489 | Ga0207704_104274892 | 202 |
| 387 | 3300025940 | Ga0207691_10001292 | Ga0207691_1000129214 | 202 |
| 388 | 3300025940 | Ga0207691_10001627 | Ga0207691_100016274 | 202 |
| 389 | 3300025940 | Ga0207691_10244410 | Ga0207691_102444101 | 202 |
| 390 | 3300025941 | Ga0207711_10044806 | Ga0207711_100448062 | 202 |
| 391 | 3300025941 | Ga0207711_10356880 | Ga0207711_103568802 | 202 |
| 392 | 3300025942 | Ga0207689_10003872 | Ga0207689_100038728 | 202 |
| 393 | 3300025942 | Ga0207689_10007002 | Ga0207689_100070027 | 202 |
| 394 | 3300025942 | Ga0207689_10387107 | Ga0207689_103871072 | 202 |
| 395 | 3300025942 | Ga0207689_10619325 | Ga0207689_106193251 | 202 |
| 396 | 3300025944 | Ga0207661_10021586 | Ga0207661_100215865 | 202 |
| 397 | 3300025945 | Ga0207679_10240879 | Ga0207679_102408792 | 202 |
| 398 | 3300025945 | Ga0207679_10299446 | Ga0207679_102994462 | 202 |
| 399 | 3300025960 | Ga0207651_10018327 | Ga0207651_100183273 | 202 |
| 400 | 3300025960 | Ga0207651_10031156 | Ga0207651_100311562 | 202 |
| 401 | 3300025960 | Ga0207651_10265777 | Ga0207651_102657773 | 202 |
| 402 | 3300025960 | Ga0207651_10601867 | Ga0207651_106018672 | 202 |
| 403 | 3300025961 | Ga0207712_10010489 | Ga0207712_100104891 | 202 |
| 404 | 3300025961 | Ga0207712_10053294 | Ga0207712_100532942 | 202 |
| 405 | 3300025972 | Ga0207668_10029820 | Ga0207668_100298204 | 202 |
| 406 | 3300025981 | Ga0207640_10017964 | Ga0207640_100179642 | 202 |
| 407 | 3300025981 | Ga0207640_10423110 | Ga0207640_104231102 | 202 |
| 408 | 3300025981 | Ga0207640_10437322 | Ga0207640_104373222 | 202 |
| 409 | 3300025986 | Ga0207658_10112977 | Ga0207658_101129772 | 202 |
| 410 | 3300025986 | Ga0207658_11079153 | Ga0207658_110791531 | 202 |
| 411 | 3300026023 | Ga0207677_10141797 | Ga0207677_101417973 | 202 |
| 412 | 3300026023 | Ga0207677_10322733 | Ga0207677_103227332 | 202 |
| 413 | 3300026023 | Ga0207677_10423514 | Ga0207677_104235142 | 202 |
| 414 | 3300026035 | Ga0207703_10035780 | Ga0207703_100357802 | 202 |
| 415 | 3300026035 | Ga0207703_10116313 | Ga0207703_101163133 | 202 |
| 416 | 3300026035 | Ga0207703_10392422 | Ga0207703_103924221 | 202 |
| 417 | 3300026035 | Ga0207703_10658090 | Ga0207703_106580902 | 202 |
| 418 | 3300026041 | Ga0207639_10050588 | Ga0207639_100505883 | 202 |
| 419 | 3300026041 | Ga0207639_10254316 | Ga0207639_102543162 | 202 |
| 420 | 3300026041 | Ga0207639_10417333 | Ga0207639_104173332 | 202 |
| 421 | 3300026041 | Ga0207639_10535874 | Ga0207639_105358741 | 202 |
| 422 | 3300026067 | Ga0207678_10006265 | Ga0207678_100062654 | 202 |
| 423 | 3300026075 | Ga0207708_10000620 | Ga0207708_100006207 | 202 |
| 424 | 3300026078 | Ga0207702_10255077 | Ga0207702_102550773 | 202 |
| 425 | 3300026078 | Ga0207702_10558471 | Ga0207702_105584712 | 202 |
| 426 | 3300026088 | Ga0207641_10115840 | Ga0207641_101158402 | 202 |
| 427 | 3300026088 | Ga0207641_10438611 | Ga0207641_104386111 | 202 |
| 428 | 3300026089 | Ga0207648_10002122 | Ga0207648_1000212217 | 202 |
| 429 | 3300026089 | Ga0207648_10010029 | Ga0207648_100100295 | 202 |
| 430 | 3300026089 | Ga0207648_10027675 | Ga0207648_100276754 | 202 |
| 431 | 3300026089 | Ga0207648_10049679 | Ga0207648_100496791 | 202 |
| 432 | 3300026089 | Ga0207648_10988665 | Ga0207648_109886651 | 202 |
| 433 | 3300026095 | Ga0207676_10053395 | Ga0207676_100533953 | 202 |
| 434 | 3300026095 | Ga0207676_11168283 | Ga0207676_111682832 | 202 |
| 435 | 3300026116 | Ga0207674_10034599 | Ga0207674_100345995 | 202 |
| 436 | 3300026116 | Ga0207674_10122408 | Ga0207674_101224082 | 202 |
| 437 | 3300026116 | Ga0207674_10197966 | Ga0207674_101979662 | 202 |
| 438 | 3300026116 | Ga0207674_10396984 | Ga0207674_103969841 | 202 |
| 439 | 3300026118 | Ga0207675_100002342 | Ga0207675_1000023424 | 202 |
| 440 | 3300026118 | Ga0207675_100479267 | Ga0207675_1004792671 | 202 |
| 441 | 3300026118 | Ga0207675_100834633 | Ga0207675_1008346331 | 202 |
| 442 | 3300026118 | Ga0207675_100953798 | Ga0207675_1009537981 | 202 |
| 443 | 3300026121 | Ga0207683_10001466 | Ga0207683_1000146615 | 202 |
| 444 | 3300026121 | Ga0207683_10019897 | Ga0207683_100198972 | 202 |
| 445 | 3300026121 | Ga0207683_10027226 | Ga0207683_100272264 | 202 |
| 446 | 3300026142 | Ga0207698_10030872 | Ga0207698_100308724 | 202 |
| 447 | 3300027907 | Ga0207428_10059653 | Ga0207428_100596533 | 202 |
| 448 | 3300027907 | Ga0207428_10593217 | Ga0207428_105932171 | 202 |
| 449 | 3300028379 | Ga0268266_10030897 | Ga0268266_100308972 | 202 |
| 450 | 3300028379 | Ga0268266_10060428 | Ga0268266_100604283 | 202 |
| 451 | 3300028379 | Ga0268266_10085736 | Ga0268266_100857363 | 202 |
| 452 | 3300028379 | Ga0268266_10096077 | Ga0268266_100960772 | 202 |
| 453 | 3300028379 | Ga0268266_10190657 | Ga0268266_101906572 | 202 |
| 454 | 3300028380 | Ga0268265_10113362 | Ga0268265_101133622 | 202 |
| 455 | 3300028380 | Ga0268265_10698879 | Ga0268265_106988792 | 202 |
| 456 | 3300028381 | Ga0268264_10010088 | Ga0268264_100100884 | 202 |
| 457 | 3300028381 | Ga0268264_10273338 | Ga0268264_102733382 | 202 |
| 458 | 3300031241 | Ga0265325_10005662 | Ga0265325_100056623 | 202 |
| 459 | 3300031247 | Ga0265340_10020750 | Ga0265340_100207502 | 202 |
| 460 | 3300031250 | Ga0265331_10000006 | Ga0265331_10000006179 | 202 |
| 461 | 3300031250 | Ga0265331_10002206 | Ga0265331_100022066 | 202 |
| 462 | 3300031251 | Ga0265327_10000052 | Ga0265327_10000052173 | 202 |
| 463 | 3300031344 | Ga0265316_10164396 | Ga0265316_101643963 | 202 |
| 464 | 3300031344 | Ga0265316_10389836 | Ga0265316_103898361 | 202 |
| 465 | 3300031616 | Ga0307508_10122717 | Ga0307508_101227172 | 202 |
| 466 | 3300031711 | Ga0265314_10033657 | Ga0265314_100336572 | 202 |
| 467 | 3300031711 | Ga0265314_10037316 | Ga0265314_100373164 | 202 |
| 468 | 3300031711 | Ga0265314_10060762 | Ga0265314_100607623 | 202 |
| 469 | 3300031730 | Ga0307516_10065689 | Ga0307516_100656895 | 202 |
| 470 | 3300031730 | Ga0307516_10309005 | Ga0307516_103090052 | 202 |
| 471 | 3300035086 | Ga0373934_0111171 | Ga0373934_0111171_145_753 | 202 |
| 472 | 3300035092 | Ga0373952_0076400 | Ga0373952_0076400_21_704 | 202 |
| 473 | 3300035113 | Ga0373936_0061946 | Ga0373936_0061946_900_1508 | 202 |
| 474 | 3300035113 | Ga0373936_0070730 | Ga0373936_0070730_567_1175 | 202 |
| 475 | 3300035116 | Ga0373945_0008188 | Ga0373945_0008188_1531_2139 | 202 |
| 476 | 3300035117 | Ga0373953_0094553 | Ga0373953_0094553_21_629 | 202 |
| 477 | 3300035118 | Ga0373954_0328388 | Ga0373954_0328388_20_628 | 202 |
| 478 | 3300035170 | Ga0373943_0020649 | Ga0373943_0020649_2008_2616 | 202 |
| 479 | 3300035170 | Ga0373943_0083043 | Ga0373943_0083043_209_817 | 202 |
| 480 | 3300035172 | Ga0373955_0009688 | Ga0373955_0009688_547_1155 | 202 |
| 481 | 3300035172 | Ga0373955_0115161 | Ga0373955_0115161_44_772 | 202 |
| 482 | 3300035410 | Ga0373924_0196336 | Ga0373924_0196336_123_731 | 202 |
| 483 | 3300035692 | Ga0373935_0080626 | Ga0373935_0080626_837_1445 | 202 |
| 484 | 3300035692 | Ga0373935_0107535 | Ga0373935_0107535_890_1498 | 202 |
| 485 | 3300035695 | Ga0373927_0101168 | Ga0373927_0101168_10_618 | 202 |
| 486 | 3300035695 | Ga0373927_0150214 | Ga0373927_0150214_602_1210 | 202 |
| 487 | 3300035695 | Ga0373927_0381062 | Ga0373927_0381062_282_890 | 202 |
| 488 | 3300035725 | Ga0373947_0118568 | Ga0373947_0118568_223_831 | 202 |
| 489 | 3300036401 | Ga0373937_0000808 | Ga0373937_0000808_20178_20786 | 202 |
| 490 | 3300037068 | Ga0373925_0075547 | Ga0373925_0075547_530_1138 | 202 |
| 491 | 3300037466 | Ga0395898_0046313 | Ga0395898_0046313_2397_3080 | 202 |
| 492 | 3300038443 | Ga0395901_0009330 | Ga0395901_0009330_7566_8249 | 202 |
| 493 | 3300039438 | Ga0436360_0786743 | Ga0436360_0786743_1196_1804 | 202 |
| 494 | 3300039447 | Ga0436361_0402180 | Ga0436361_0402180_2632_3240 | 202 |
| 495 | 3300044694 | Ga0466963_0101694 | Ga0466963_0101694_928_1575 | 202 |
| 496 | 3300046455 | Ga0495603_0025190 | Ga0495603_0025190_2016_2624 | 202 |
| 497 | 3300046455 | Ga0495603_0281545 | Ga0495603_0281545_312_920 | 202 |
| 498 | 3300046460 | Ga0495638_0017859 | Ga0495638_0017859_2638_3252 | 202 |
| 499 | 3300046473 | Ga0495582_0039945 | Ga0495582_0039945_1312_1920 | 202 |
| 500 | 3300046474 | Ga0495605_0026817 | Ga0495605_0026817_88_702 | 202 |
| 501 | 3300046474 | Ga0495605_0041262 | Ga0495605_0041262_292_900 | 202 |
| 502 | 3300046474 | Ga0495605_0192347 | Ga0495605_0192347_60_743 | 202 |
| 503 | 3300046491 | Ga0495584_0368425 | Ga0495584_0368425_32_715 | 202 |
| 504 | 3300046492 | Ga0495585_0038603 | Ga0495585_0038603_1534_2142 | 202 |
| 505 | 3300046492 | Ga0495585_0057456 | Ga0495585_0057456_1431_2114 | 202 |
| 506 | 3300046499 | Ga0495594_0114706 | Ga0495594_0114706_722_1330 | 202 |
| 507 | 3300046500 | Ga0495596_0088368 | Ga0495596_0088368_199_807 | 202 |
| 508 | 3300046501 | Ga0495607_0053639 | Ga0495607_0053639_869_1477 | 202 |
| 509 | 3300046501 | Ga0495607_0138720 | Ga0495607_0138720_401_1084 | 202 |
| 510 | 3300046511 | Ga0495608_0320943 | Ga0495608_0320943_51_734 | 202 |
| 511 | 3300046516 | Ga0495628_0417019 | Ga0495628_0417019_301_909 | 202 |
| 512 | 3300046516 | Ga0495628_0625119 | Ga0495628_0625119_38_646 | 202 |
| 513 | 3300046523 | Ga0495644_0059861 | Ga0495644_0059861_218_901 | 202 |
| 514 | 3300046524 | Ga0495648_0170503 | Ga0495648_0170503_55_738 | 202 |
| 515 | 3300046525 | Ga0495663_0005060 | Ga0495663_0005060_380_988 | 202 |
| 516 | 3300046525 | Ga0495663_0112773 | Ga0495663_0112773_18_626 | 202 |
| 517 | 3300046530 | Ga0495654_0045497 | Ga0495654_0045497_32_715 | 202 |
| 518 | 3300046533 | Ga0495640_0066787 | Ga0495640_0066787_556_1164 | 202 |
| 519 | 3300046533 | Ga0495640_0321109 | Ga0495640_0321109_121_729 | 202 |
| 520 | 3300046538 | Ga0495609_0072852 | Ga0495609_0072852_390_998 | 202 |
| 521 | 3300046539 | Ga0495621_0034236 | Ga0495621_0034236_239_853 | 202 |
| 522 | 3300046539 | Ga0495621_0057120 | Ga0495621_0057120_622_1305 | 202 |
| 523 | 3300046558 | Ga0495633_0200147 | Ga0495633_0200147_49_732 | 202 |
| 524 | 3300046559 | Ga0495667_0220698 | Ga0495667_0220698_77_691 | 202 |
| 525 | 3300046615 | Ga0495656_0028459 | Ga0495656_0028459_63_677 | 202 |
| 526 | 3300046615 | Ga0495656_0085517 | Ga0495656_0085517_150_758 | 202 |
| 527 | 3300046616 | Ga0495668_0056659 | Ga0495668_0056659_1297_1980 | 202 |
| 528 | 3300046642 | Ga0495634_0063089 | Ga0495634_0063089_171_779 | 202 |
| 529 | 3300046664 | Ga0495659_0060026 | Ga0495659_0060026_261_869 | 202 |
| 530 | 3300046664 | Ga0495659_0259433 | Ga0495659_0259433_61_669 | 202 |
| 531 | 3300046665 | Ga0495661_0054985 | Ga0495661_0054985_1112_1720 | 202 |
| 532 | 3300046674 | Ga0495588_0124324 | Ga0495588_0124324_31_645 | 202 |
| 533 | 3300046681 | Ga0495647_0123894 | Ga0495647_0123894_421_1029 | 202 |
| 534 | 3300046683 | Ga0495658_0008659 | Ga0495658_0008659_1998_2606 | 202 |
| 535 | 3300046683 | Ga0495658_0132021 | Ga0495658_0132021_489_1097 | 202 |
| 536 | 3300046684 | Ga0495669_0030683 | Ga0495669_0030683_346_1029 | 202 |
| 537 | 3300046689 | Ga0495613_0125834 | Ga0495613_0125834_523_1131 | 202 |
| 538 | 3300046690 | Ga0495624_0331798 | Ga0495624_0331798_68_676 | 202 |
| 539 | 3300046691 | Ga0495670_0019806 | Ga0495670_0019806_16_624 | 202 |
| 540 | 3300046692 | Ga0495671_0202001 | Ga0495671_0202001_185_928 | 202 |
| 541 | 3300046694 | Ga0495649_0115228 | Ga0495649_0115228_123_806 | 202 |
| 542 | 3300047321 | Ga0495676_0031293 | Ga0495676_0031293_2557_3165 | 202 |
| 543 | 3300047321 | Ga0495676_0418903 | Ga0495676_0418903_86_694 | 202 |
| 544 | 3300047446 | Ga0495679_009202 | Ga0495679_009202_48_656 | 202 |
| 545 | 3300047447 | Ga0495685_084819 | Ga0495685_084819_32_715 | 202 |
| 546 | 3300047471 | Ga0495684_0163033 | Ga0495684_0163033_819_1427 | 202 |
| 547 | 3300048088 | Ga0495602_0351830 | Ga0495602_0351830_146_829 | 202 |
| 548 | 3300048089 | Ga0495614_0308871 | Ga0495614_0308871_58_666 | 202 |
| 549 | 3300048090 | Ga0495615_0009836 | Ga0495615_0009836_991_1605 | 202 |
| 550 | 3300048903 | Ga0496100_0052828 | Ga0496100_0052828_980_1663 | 202 |
| 551 | 3300048903 | Ga0496100_0112909 | Ga0496100_0112909_348_956 | 202 |
| 552 | 3300048903 | Ga0496100_0212877 | Ga0496100_0212877_56_664 | 202 |
| 553 | 3300048904 | Ga0496101_0006039 | Ga0496101_0006039_5729_6337 | 202 |
| 554 | 3300048904 | Ga0496101_0022942 | Ga0496101_0022942_661_1344 | 202 |
| 555 | 3300048904 | Ga0496101_0213854 | Ga0496101_0213854_250_858 | 202 |
| 556 | 3300048905 | Ga0496102_0030424 | Ga0496102_0030424_1268_1876 | 202 |
| 557 | 3300048905 | Ga0496102_0038590 | Ga0496102_0038590_2562_3245 | 202 |
| 558 | 3300048906 | Ga0496103_0007690 | Ga0496103_0007690_697_1380 | 202 |
| 559 | 3300048906 | Ga0496103_0207773 | Ga0496103_0207773_615_1223 | 202 |
| 560 | 3300048907 | Ga0496104_0000671 | Ga0496104_0000671_26349_26957 | 202 |
| 561 | 3300048907 | Ga0496104_0013106 | Ga0496104_0013106_6739_7347 | 202 |
| 562 | 3300048907 | Ga0496104_0014367 | Ga0496104_0014367_5127_5735 | 202 |
| 563 | 3300048907 | Ga0496104_0175951 | Ga0496104_0175951_1090_1698 | 202 |
| 564 | 3300048907 | Ga0496104_0184912 | Ga0496104_0184912_730_1413 | 202 |
| 565 | 3300048908 | Ga0496105_0009471 | Ga0496105_0009471_6800_7408 | 202 |
| 566 | 3300048908 | Ga0496105_0010252 | Ga0496105_0010252_1382_2065 | 202 |
| 567 | 3300048908 | Ga0496105_0263459 | Ga0496105_0263459_534_1142 | 202 |
| 568 | 3300048909 | Ga0496106_0003496 | Ga0496106_0003496_10190_10798 | 202 |
| 569 | 3300048909 | Ga0496106_0006990 | Ga0496106_0006990_7099_7782 | 202 |
| 570 | 3300048909 | Ga0496106_0173641 | Ga0496106_0173641_629_1237 | 202 |
| 571 | 3300048910 | Ga0496107_0016347 | Ga0496107_0016347_4475_5158 | 202 |
| 572 | 3300048910 | Ga0496107_0016379 | Ga0496107_0016379_4512_5120 | 202 |
| 573 | 3300048911 | Ga0496108_0000347 | Ga0496108_0000347_18202_18810 | 202 |
| 574 | 3300048911 | Ga0496108_0001531 | Ga0496108_0001531_12206_12814 | 202 |
| 575 | 3300048911 | Ga0496108_0009690 | Ga0496108_0009690_5239_5847 | 202 |
| 576 | 3300048911 | Ga0496108_0049755 | Ga0496108_0049755_1067_1750 | 202 |
| 577 | 3300048912 | Ga0496109_0004728 | Ga0496109_0004728_1463_2071 | 202 |
| 578 | 3300048912 | Ga0496109_0008070 | Ga0496109_0008070_1260_1868 | 202 |
| 579 | 3300048912 | Ga0496109_0039283 | Ga0496109_0039283_2286_2894 | 202 |
| 580 | 3300048912 | Ga0496109_0109428 | Ga0496109_0109428_819_1502 | 202 |
| 581 | 3300048912 | Ga0496109_0413601 | Ga0496109_0413601_119_727 | 202 |
| 582 | 3300048913 | Ga0496110_0000339 | Ga0496110_0000339_22375_22983 | 202 |
| 583 | 3300048913 | Ga0496110_0001978 | Ga0496110_0001978_5941_6549 | 202 |
| 584 | 3300048913 | Ga0496110_0019355 | Ga0496110_0019355_2557_3240 | 202 |
| 585 | 3300048913 | Ga0496110_0057939 | Ga0496110_0057939_488_1096 | 202 |
| 586 | 3300048913 | Ga0496110_0102781 | Ga0496110_0102781_866_1474 | 202 |
| 587 | 3300048913 | Ga0496110_0264651 | Ga0496110_0264651_724_1332 | 202 |
| 588 | 3300048913 | Ga0496110_1188369 | Ga0496110_1188369_13_621 | 202 |
| 589 | 3300048914 | Ga0496111_0001676 | Ga0496111_0001676_11138_11746 | 202 |
| 590 | 3300048914 | Ga0496111_0012805 | Ga0496111_0012805_2812_3495 | 202 |
| 591 | 3300048914 | Ga0496111_0016270 | Ga0496111_0016270_1464_2072 | 202 |
| 592 | 3300048914 | Ga0496111_0082411 | Ga0496111_0082411_1359_1967 | 202 |
| 593 | 3300048915 | Ga0496112_0001338 | Ga0496112_0001338_12208_12816 | 202 |
| 594 | 3300048915 | Ga0496112_0004698 | Ga0496112_0004698_10279_10887 | 202 |
| 595 | 3300048915 | Ga0496112_0011100 | Ga0496112_0011100_3211_3819 | 202 |
| 596 | 3300048915 | Ga0496112_0129944 | Ga0496112_0129944_964_1572 | 202 |
| 597 | 3300048915 | Ga0496112_0165213 | Ga0496112_0165213_819_1502 | 202 |
| 598 | 3300048915 | Ga0496112_0467015 | Ga0496112_0467015_560_1168 | 202 |
| 599 | 3300048916 | Ga0496113_0000331 | Ga0496113_0000331_7190_7798 | 202 |
| 600 | 3300048916 | Ga0496113_0008812 | Ga0496113_0008812_3183_3866 | 202 |
| 601 | 3300048916 | Ga0496113_0144162 | Ga0496113_0144162_1188_1796 | 202 |
| 602 | 3300048917 | Ga0496114_0030874 | Ga0496114_0030874_2779_3462 | 202 |
| 603 | 3300048917 | Ga0496114_0333346 | Ga0496114_0333346_222_830 | 202 |
| 604 | 3300048917 | Ga0496114_0892541 | Ga0496114_0892541_52_660 | 202 |
| 605 | 3300048918 | Ga0496115_0036354 | Ga0496115_0036354_569_1177 | 202 |
| 606 | 3300048918 | Ga0496115_0047038 | Ga0496115_0047038_1885_2493 | 202 |
| 607 | 3300048918 | Ga0496115_0103894 | Ga0496115_0103894_1067_1750 | 202 |
| 608 | 3300048918 | Ga0496115_0273950 | Ga0496115_0273950_444_1052 | 202 |
| 609 | 3300048924 | Ga0496121_0000913 | Ga0496121_0000913_13972_14655 | 202 |
| 610 | 3300048929 | Ga0496126_0216097 | Ga0496126_0216097_529_1212 | 202 |
| 611 | 3300049570 | Ga0501033_0025950 | Ga0501033_0025950_1882_2565 | 202 |
| 612 | 3300049570 | Ga0501033_0086795 | Ga0501033_0086795_223_906 | 202 |
| 613 | 3300049570 | Ga0501033_0276946 | Ga0501033_0276946_48_731 | 202 |
| 614 | 3300049570 | Ga0501033_0737133 | Ga0501033_0737133_29_637 | 202 |
| 615 | 3300049571 | Ga0501034_0015949 | Ga0501034_0015949_6454_7137 | 202 |
| 616 | 3300049572 | Ga0501036_0036722 | Ga0501036_0036722_1202_1885 | 202 |
| 617 | 3300049573 | Ga0501037_0007536 | Ga0501037_0007536_3441_4124 | 202 |
| 618 | 3300049573 | Ga0501037_0128768 | Ga0501037_0128768_700_1383 | 202 |
| 619 | 3300049574 | Ga0501038_0095310 | Ga0501038_0095310_314_997 | 202 |
| 620 | 3300049579 | Ga0501043_0058645 | Ga0501043_0058645_2317_3000 | 202 |
| 621 | 3300049580 | Ga0501046_0021675 | Ga0501046_0021675_2869_3552 | 202 |
| 622 | 3300049580 | Ga0501046_0082042 | Ga0501046_0082042_1673_2356 | 202 |
| 623 | 3300049581 | Ga0501047_0006741 | Ga0501047_0006741_3536_4219 | 202 |
| 624 | 3300049581 | Ga0501047_0015028 | Ga0501047_0015028_5411_6094 | 202 |
| 625 | 3300049581 | Ga0501047_0090486 | Ga0501047_0090486_698_1381 | 202 |
| 626 | 3300049581 | Ga0501047_0156437 | Ga0501047_0156437_251_934 | 202 |
| 627 | 3300049581 | Ga0501047_0547428 | Ga0501047_0547428_266_949 | 202 |
| 628 | 3300049582 | Ga0501048_0162337 | Ga0501048_0162337_144_758 | 202 |
| 629 | 3300049584 | Ga0501068_0017115 | Ga0501068_0017115_828_1511 | 202 |
| 630 | 3300049585 | Ga0501069_0187862 | Ga0501069_0187862_137_820 | 202 |
| 631 | 3300049586 | Ga0501070_0131921 | Ga0501070_0131921_682_1365 | 202 |
| 632 | 3300049588 | Ga0501072_0392977 | Ga0501072_0392977_409_1017 | 202 |
| 633 | 3300049589 | Ga0501073_0026353 | Ga0501073_0026353_2003_2686 | 202 |
| 634 | 3300049589 | Ga0501073_0126980 | Ga0501073_0126980_749_1432 | 202 |
| 635 | 3300049589 | Ga0501073_0237454 | Ga0501073_0237454_481_1164 | 202 |
| 636 | 3300049589 | Ga0501073_0465259 | Ga0501073_0465259_245_853 | 202 |
| 637 | 3300049590 | Ga0501074_0088247 | Ga0501074_0088247_474_1157 | 202 |
| 638 | 3300049591 | Ga0501075_0399341 | Ga0501075_0399341_325_939 | 202 |
| 639 | 3300049592 | Ga0501076_0435345 | Ga0501076_0435345_166_774 | 202 |
| 640 | 3300049744 | Ga0501083_0050476 | Ga0501083_0050476_1545_2228 | 202 |
| 641 | 3300049744 | Ga0501083_0143271 | Ga0501083_0143271_163_771 | 202 |
| 642 | 3300049744 | Ga0501083_0345837 | Ga0501083_0345837_142_750 | 202 |
| 643 | 3300049822 | Ga0501035_0005667 | Ga0501035_0005667_10431_11114 | 202 |
| 644 | 3300049822 | Ga0501035_0047019 | Ga0501035_0047019_2563_3246 | 202 |
| 645 | 3300049822 | Ga0501035_0107410 | Ga0501035_0107410_628_1311 | 202 |
| 646 | 3300049823 | Ga0501044_0001467 | Ga0501044_0001467_5466_6149 | 202 |
| 647 | 3300049823 | Ga0501044_0448684 | Ga0501044_0448684_123_809 | 202 |
| 648 | 3300049824 | Ga0501045_0177915 | Ga0501045_0177915_280_888 | 202 |
| 649 | 3300050492 | nmdc:mga0yw44_49284_c1 | nmdc:mga0yw44_49284_c1_1656_2264 | 202 |
| 650 | 3300050494 | nmdc:mga06z11_110086_c1 | nmdc:mga06z11_110086_c1_801_1484 | 202 |
| 651 | 3300050494 | nmdc:mga06z11_367188_c1 | nmdc:mga06z11_367188_c1_130_741 | 202 |
| 652 | 3300050495 | nmdc:mga04h51_205716_c1 | nmdc:mga04h51_205716_c1_125_736 | 202 |
| 653 | 3300050496 | nmdc:mga07m45_81351_c1 | nmdc:mga07m45_81351_c1_423_1106 | 202 |
| 654 | 3300050507 | nmdc:mga05p37_136974_c1 | nmdc:mga05p37_136974_c1_651_1259 | 202 |
| 655 | 3300050507 | nmdc:mga05p37_17333_c1 | nmdc:mga05p37_17333_c1_4740_5348 | 202 |
| 656 | 3300050507 | nmdc:mga05p37_46172_c1 | nmdc:mga05p37_46172_c1_2809_3417 | 202 |
| 657 | 3300050507 | nmdc:mga05p37_532395_c1 | nmdc:mga05p37_532395_c1_36_698 | 202 |
| 658 | 3300050508 | nmdc:mga09592_502414_c1 | nmdc:mga09592_502414_c1_312_920 | 202 |
| 659 | 3300050508 | nmdc:mga09592_727214_c1 | nmdc:mga09592_727214_c1_37_651 | 202 |
| 660 | 3300050509 | nmdc:mga0qj67_345665_c1 | nmdc:mga0qj67_345665_c1_65_679 | 202 |
| 661 | 3300050510 | nmdc:mga06r32_108563_c1 | nmdc:mga06r32_108563_c1_1404_2018 | 202 |
| 662 | 3300050510 | nmdc:mga06r32_1264791_c1 | nmdc:mga06r32_1264791_c1_58_666 | 202 |
| 663 | 3300050510 | nmdc:mga06r32_1271946_c1 | nmdc:mga06r32_1271946_c1_40_648 | 202 |
| 664 | 3300050510 | nmdc:mga06r32_48157_c1 | nmdc:mga06r32_48157_c1_1756_2364 | 202 |
| 665 | 3300050510 | nmdc:mga06r32_487534_c1 | nmdc:mga06r32_487534_c1_381_989 | 202 |
| 666 | 3300050511 | nmdc:mga08y16_39967_c1 | nmdc:mga08y16_39967_c1_3391_4008 | 202 |
| 667 | 3300050511 | nmdc:mga08y16_87901_c1 | nmdc:mga08y16_87901_c1_2471_3154 | 202 |
| 668 | 3300050511 | nmdc:mga08y16_97049_c1 | nmdc:mga08y16_97049_c1_1501_2109 | 202 |
| 669 | 3300050512 | nmdc:mga0n895_1105057_c1 | nmdc:mga0n895_1105057_c1_83_691 | 202 |
| 670 | 3300050512 | nmdc:mga0n895_215953_c2 | nmdc:mga0n895_215953_c2_295_903 | 202 |
| 671 | 3300050513 | nmdc:mga0rr50_738155_c1 | nmdc:mga0rr50_738155_c1_96_704 | 202 |
| 672 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_147339_147950 | 202 |
| 673 | 3300050514 | nmdc:mga08x19_338883_c1 | nmdc:mga08x19_338883_c1_154_762 | 202 |
| 674 | 3300050515 | nmdc:mga0a205_261691_c1 | nmdc:mga0a205_261691_c1_875_1492 | 202 |
| 675 | 3300053077 | Ga0495601_0035347 | Ga0495601_0035347_2330_3013 | 202 |
| 676 | 3300053083 | Ga0495655_0000668 | Ga0495655_0000668_4389_4997 | 202 |
| 677 | 3300053085 | Ga0495619_0009907 | Ga0495619_0009907_4080_4688 | 202 |
| 678 | 3300053085 | Ga0495619_0065055 | Ga0495619_0065055_880_1488 | 202 |
| 679 | 3300053085 | Ga0495619_0098107 | Ga0495619_0098107_327_1010 | 202 |
| 680 | 3300053087 | Ga0500643_074680 | Ga0500643_074680_63_860 | 202 |
| 681 | 3300053090 | Ga0500646_0060895 | Ga0500646_0060895_78_692 | 202 |
| 682 | 3300053096 | Ga0500641_0018330 | Ga0500641_0018330_1435_2049 | 202 |
| 683 | 3300053119 | Ga0500595_016745 | Ga0500595_016745_911_1594 | 202 |
| 684 | 3300053139 | Ga0500568_0025794 | Ga0500568_0025794_181_864 | 202 |
| 685 | 3300053139 | Ga0500568_0071634 | Ga0500568_0071634_261_872 | 202 |
| 686 | 3300053140 | Ga0500573_0000008 | Ga0500573_0000008_18068_18751 | 202 |
| 687 | 3300053142 | Ga0500577_0106815 | Ga0500577_0106815_487_1101 | 202 |
| 688 | 3300053163 | Ga0500639_036474 | Ga0500639_036474_228_911 | 202 |
| 689 | 3300054114 | Ga0501084_0020727 | Ga0501084_0020727_1695_2462 | 202 |
| 690 | 3300060353 | Ga0501082_0063296 | Ga0501082_0063296_274_957 | 202 |
| 691 | 3300060353 | Ga0501082_0318909 | Ga0501082_0318909_716_1324 | 202 |
| 692 | 3300061734 | Ga0530510_0264563 | Ga0530510_0264563_95_703 | 202 |
| 693 | 3300061734 | Ga0530510_0625729 | Ga0530510_0625729_191_805 | 202 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2lt2-assembly1.cif.gz_A | nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. | 0.8666 | 1 | 201 |
| 2lt2-assembly1.cif.gz_A | nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. | 0.8233 | 1 | 201 |
| 3ptj-assembly1.cif.gz_A | structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3 | 0.7657 | 2 | 188 |
| 5anp-assembly1.cif.gz_A | crystal structure of the ba41 protein from bizionia argentinensis | 0.7489 | 1 | 185 |
| 7e1v-assembly1.cif.gz_J | cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv | 0.7415 | 2 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2lt2A00 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8666 | 1 | 201 | 3.10.310.50 |
| 2lt2A00 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8233 | 1 | 201 | 3.10.310.50 |
| af_P55140_17_164_3.10.310.50 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.8164 | 2 | 188 | 3.10.310.50 |
| 3ptjA00 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.7691 | 2 | 188 | 3.10.310.50 |
| af_P9WLA7_26_161_3.10.310.50 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; | 0.7454 | 2 | 176 | 3.10.310.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A9VYL9-F1-model_v4 | Uncharacterized protein | 0.9284 | 120 | 182 |
|
| AF-F8JGA9-F1-model_v4 | TPM domain-containing protein | 0.9237 | 2 | 202 |
GO:0016020
|
| AF-F8JGA9-F1-model_v4 | TPM domain-containing protein | 0.915 | 2 | 202 |
GO:0016020
|
| AF-A0A0B0Q7C9-F1-model_v4 | TPM domain-containing protein | 0.9098 | 1 | 202 |
GO:0016020
|
| AF-A0A1M3NQU2-F1-model_v4 | TPM domain-containing protein | 0.9087 | 1 | 202 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar