F475684

General Info

Members Datasets Scaffolds Average Seq Length
693 334 693 211

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_074680|Ga0500643_074680_63_860
Length 242
Sequence LAARLEVGNGRQEAGMLNEQDRARISAAIAQVESKTAGEIFCVLAKDVSRYREVPLLWAAVAAFIVPPLLVVVGLHRLALASIFSSWTDESAHAMEGLILRALSTFELVQAGIFLIVAVLVAMPGVRRAVTPGALKTYRVRQAARRHFVAVGARLSDAEPHILIYASLADRRVELVAHDKIHKAVGEGPWNQSVAAVIDGMQSGKPADGFVKAIEICGTALAQHFPPSGTPANRLPNTILET

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
330 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
331 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 8.95
Rhizosphere 86.44
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1007809 3300001977 Bacteria 1627
2 JGI24743J22301_10006434 3300001991 Bacteria 2003
3 JGI24750J21931_1001938 3300002070 Bacteria 2527
4 JGI24745J21846_1001757 3300002073 Bacteria 2137
5 JGI24738J21930_10014202 3300002075 Bacteria 1712
6 JGI24749J21850_1008317 3300002076 Bacteria 1445
7 JGI24744J21845_10000406 3300002077 Bacteria 7457
8 JGI24742J22300_10001904 3300002244 Bacteria 3319
9 JGI25406J46586_10001759 3300003203 Bacteria 10189
10 JGI25153J46596_10006977 3300003215 Bacteria 5628
11 JGI25404J52841_10002770 3300003659 Bacteria 3373
12 Ga0070676_10310741 3300005328 Bacteria 1072
13 Ga0070690_100281039 3300005330 Unclassified 1187
14 Ga0070670_100019601 3300005331 Bacteria 5806
15 Ga0070677_10007226 3300005333 Bacteria 3702
16 Ga0070677_10172119 3300005333 Bacteria 1024
17 Ga0068869_100018551 3300005334 Bacteria 4737
18 Ga0068869_100930773 3300005334 Bacteria 753
19 Ga0070666_10016334 3300005335 Bacteria 4747
20 Ga0070666_10218196 3300005335 Bacteria 1345
21 Ga0070666_10320437 3300005335 Bacteria 1106
22 Ga0070680_100376706 3300005336 Bacteria 1208
23 Ga0070682_100001556 3300005337 Bacteria 12840
24 Ga0070682_100010810 3300005337 Bacteria 5193
25 Ga0070682_100694673 3300005337 Bacteria 815
26 Ga0068868_100010355 3300005338 Bacteria 6746
27 Ga0068868_100346087 3300005338 Bacteria 1272
28 Ga0068868_100531176 3300005338 Unclassified 1034
29 Ga0070660_100043079 3300005339 Bacteria 3448
30 Ga0070660_100097872 3300005339 Bacteria 2322
31 Ga0070689_100124521 3300005340 Bacteria 2061
32 Ga0070689_100365883 3300005340 Bacteria 1212
33 Ga0070691_10041216 3300005341 Bacteria 2183
34 Ga0070687_100310669 3300005343 Bacteria 1004
35 Ga0070661_100000071 3300005344 Bacteria 82723
36 Ga0070692_10114576 3300005345 Bacteria 1495
37 Ga0070668_100003443 3300005347 Bacteria 11685
38 Ga0070668_100004096 3300005347 Bacteria 10796
39 Ga0070668_100075925 3300005347 Bacteria 2624
40 Ga0070669_100103425 3300005353 Bacteria 2152
41 Ga0070669_100184306 3300005353 Bacteria 1635
42 Ga0070669_100456341 3300005353 Bacteria 1054
43 Ga0070675_100078289 3300005354 Bacteria 2753
44 Ga0070671_100003476 3300005355 Bacteria 12288
45 Ga0070671_100076539 3300005355 Bacteria 2795
46 Ga0070674_100007703 3300005356 Bacteria 6361
47 Ga0070674_100042735 3300005356 Bacteria 3080
48 Ga0070673_100012560 3300005364 Bacteria 5819
49 Ga0070673_100013937 3300005364 Bacteria 5582
50 Ga0070673_100698000 3300005364 Bacteria 932
51 Ga0070688_100049175 3300005365 Bacteria 2623
52 Ga0070688_100057908 3300005365 Bacteria 2438
53 Ga0070688_100193467 3300005365 Bacteria 1418
54 Ga0070659_100009307 3300005366 Bacteria 7214
55 Ga0070659_100104161 3300005366 Bacteria 2285
56 Ga0070659_101160990 3300005366 Unclassified 682
57 Ga0070667_100011828 3300005367 Bacteria 7214
58 Ga0070667_100873381 3300005367 Bacteria 836
59 Ga0070667_101030747 3300005367 Bacteria 768
60 Ga0070713_100161785 3300005436 Bacteria 1999
61 Ga0070713_100175301 3300005436 Bacteria 1924
62 Ga0070713_100296663 3300005436 Bacteria 1487
63 Ga0070710_10348158 3300005437 Bacteria 980
64 Ga0070701_10005829 3300005438 Bacteria 5131
65 Ga0070701_10082252 3300005438 Bacteria 1746
66 Ga0070701_10236131 3300005438 Bacteria 1097
67 Ga0070711_100116747 3300005439 Bacteria 1967
68 Ga0070711_100123025 3300005439 Bacteria 1922
69 Ga0070705_100387009 3300005440 Bacteria 1031
70 Ga0070700_100003371 3300005441 Bacteria 8238
71 Ga0070708_100257117 3300005445 Bacteria 1641
72 Ga0070663_100166853 3300005455 Unclassified 1699
73 Ga0070663_100647865 3300005455 Bacteria 893
74 Ga0070678_100005894 3300005456 Bacteria 7126
75 Ga0070678_100164216 3300005456 Bacteria 1802
76 Ga0070678_100734975 3300005456 Unclassified 892
77 Ga0070662_100008277 3300005457 Bacteria 6773
78 Ga0070662_100456139 3300005457 Bacteria 1062
79 Ga0070681_10473516 3300005458 Unclassified 1165
80 Ga0068867_100026540 3300005459 Bacteria 4160
81 Ga0068867_100088507 3300005459 Bacteria 2347
82 Ga0068867_100137146 3300005459 Bacteria 1909
83 Ga0070685_10023342 3300005466 Bacteria 3386
84 Ga0070685_10328629 3300005466 Bacteria 1039
85 Ga0070706_100189788 3300005467 Bacteria 1920
86 Ga0070698_100450669 3300005471 Bacteria 1222
87 Ga0070699_100005212 3300005518 Bacteria 11425
88 Ga0070697_100002109 3300005536 Bacteria 15231
89 Ga0070697_100246294 3300005536 Bacteria 1527
90 Ga0068853_100158380 3300005539 Bacteria 2041
91 Ga0068853_100395293 3300005539 Bacteria 1293
92 Ga0068853_101417466 3300005539 Archaea 672
93 Ga0070672_100015823 3300005543 Bacteria 5385
94 Ga0070672_100555546 3300005543 Bacteria 997
95 Ga0070672_100706927 3300005543 Bacteria 883
96 Ga0070686_100078608 3300005544 Bacteria 2179
97 Ga0070686_100263172 3300005544 Bacteria 1265
98 Ga0070686_100750294 3300005544 Bacteria 783
99 Ga0070695_100014840 3300005545 Bacteria 4700
100 Ga0070695_100464231 3300005545 Bacteria 973
101 Ga0070693_100031441 3300005547 Bacteria 2909
102 Ga0070693_100340603 3300005547 Bacteria 1023
103 Ga0070665_100007652 3300005548 Bacteria 10983
104 Ga0070665_100126088 3300005548 Bacteria 2562
105 Ga0070665_100163572 3300005548 Bacteria 2227
106 Ga0070665_100220929 3300005548 Bacteria 1895
107 Ga0070665_100256853 3300005548 Bacteria 1748
108 Ga0070704_100038731 3300005549 Bacteria 3268
109 Ga0068855_100034384 3300005563 Bacteria 6046
110 Ga0070664_100108510 3300005564 Bacteria 2421
111 Ga0068857_100072289 3300005577 Bacteria 3073
112 Ga0068857_100439879 3300005577 Bacteria 1218
113 Ga0068857_100659911 3300005577 Unclassified 992
114 Ga0068856_100216260 3300005614 Bacteria 1932
115 Ga0068856_100779655 3300005614 Bacteria 976
116 Ga0070702_100016894 3300005615 Bacteria 3755
117 Ga0070702_100137375 3300005615 Bacteria 1553
118 Ga0068852_100065766 3300005616 Bacteria 3165
119 Ga0068859_100006386 3300005617 Bacteria 11960
120 Ga0068859_100120749 3300005617 Bacteria 2687
121 Ga0068864_100001978 3300005618 Bacteria 16866
122 Ga0068864_100064299 3300005618 Bacteria 3181
123 Ga0068864_100076319 3300005618 Bacteria 2928
124 Ga0068866_10024482 3300005718 Bacteria 2823
125 Ga0068866_10042587 3300005718 Bacteria 2260
126 Ga0068866_10045488 3300005718 Bacteria 2202
127 Ga0068861_100018551 3300005719 Bacteria 4956
128 Ga0068851_10056896 3300005834 Bacteria 1996
129 Ga0068870_10003152 3300005840 Bacteria 6953
130 Ga0068870_10086818 3300005840 Bacteria 1741
131 Ga0068863_100002977 3300005841 Bacteria 16752
132 Ga0068863_100013950 3300005841 Bacteria 7746
133 Ga0068863_100545543 3300005841 Bacteria 1144
134 Ga0068858_100046689 3300005842 Bacteria 4014
135 Ga0068858_100135578 3300005842 Bacteria 2310
136 Ga0068858_100245783 3300005842 Bacteria 1699
137 Ga0068858_100366326 3300005842 Bacteria 1382
138 Ga0068860_100000109 3300005843 Bacteria 132169
139 Ga0068860_100018969 3300005843 Bacteria 6681
140 Ga0068860_100266218 3300005843 Bacteria 1672
141 Ga0068862_100003711 3300005844 Bacteria 13037
142 Ga0068862_100073243 3300005844 Bacteria 2960
143 Ga0068862_100139865 3300005844 Bacteria 2148
144 Ga0068862_100701197 3300005844 Bacteria 981
145 Ga0081455_10016680 3300005937 Bacteria 7075
146 Ga0081455_10068364 3300005937 Bacteria 2957
147 Ga0081455_10087507 3300005937 Bacteria 2534
148 Ga0081455_10138944 3300005937 Bacteria 1889
149 Ga0081455_10179887 3300005937 Bacteria 1602
150 Ga0081455_10217491 3300005937 Bacteria 1419
151 Ga0081538_10006350 3300005981 Bacteria 10426
152 Ga0081538_10073205 3300005981 Bacteria 1874
153 Ga0081540_1005049 3300005983 Bacteria 9903
154 Ga0081540_1074935 3300005983 Bacteria 1548
155 Ga0081539_10003504 3300005985 Bacteria 19185
156 Ga0070717_10493952 3300006028 Bacteria 1106
157 Ga0070717_10610656 3300006028 Bacteria 989
158 Ga0075365_10024636 3300006038 Bacteria 3799
159 Ga0075365_10041919 3300006038 Bacteria 2991
160 Ga0075368_10237893 3300006042 Unclassified 776
161 Ga0075363_100021892 3300006048 Bacteria 3227
162 Ga0070715_10009553 3300006163 Bacteria 3424
163 Ga0070716_100381338 3300006173 Unclassified 1008
164 Ga0070712_100063109 3300006175 Bacteria 2621
165 Ga0070712_100458031 3300006175 Bacteria 1063
166 Ga0097621_100002409 3300006237 Bacteria 12810
167 Ga0097621_100008767 3300006237 Bacteria 7306
168 Ga0097621_100018773 3300006237 Bacteria 5291
169 Ga0097621_100083545 3300006237 Bacteria 2661
170 Ga0097621_100145515 3300006237 Bacteria 2028
171 Ga0097621_100370978 3300006237 Bacteria 1277
172 Ga0097621_100679909 3300006237 Bacteria 946
173 Ga0068871_100000749 3300006358 Bacteria 21966
174 Ga0068871_100003422 3300006358 Bacteria 10912
175 Ga0068871_100024191 3300006358 Bacteria 4706
176 Ga0068871_100117304 3300006358 Unclassified 2245
177 Ga0068871_100280697 3300006358 Bacteria 1457
178 Ga0068871_100672160 3300006358 Bacteria 947
179 Ga0075428_100040886 3300006844 Bacteria 5099
180 Ga0075428_100043831 3300006844 Bacteria 4918
181 Ga0075428_100054314 3300006844 Bacteria 4390
182 Ga0075430_100146936 3300006846 Bacteria 1963
183 Ga0075430_100162727 3300006846 Bacteria 1858
184 Ga0075431_100008575 3300006847 Bacteria 10234
185 Ga0075431_100221581 3300006847 Bacteria 1929
186 Ga0075429_100260356 3300006880 Unclassified 1519
187 Ga0075429_100373876 3300006880 Unclassified 1248
188 Ga0068865_100004897 3300006881 Bacteria 8092
189 Ga0068865_100231895 3300006881 Bacteria 1449
190 Ga0068865_100303705 3300006881 Unclassified 1278
191 Ga0075436_100413100 3300006914 Unclassified 979
192 Ga0097620_100006386 3300006931 Bacteria 11960
193 Ga0097620_100120748 3300006931 Bacteria 2687
194 Ga0075435_100337470 3300007076 Bacteria 1291
195 Ga0075435_100381688 3300007076 Bacteria 1210
196 Ga0099795_10000246 3300007788 Bacteria 9648
197 Ga0105251_10324974 3300009011 Bacteria 699
198 Ga0105250_10027852 3300009092 Bacteria 2277
199 Ga0105240_10006316 3300009093 Bacteria 17442
200 Ga0105240_10117189 3300009093 Bacteria 3212
201 Ga0105240_10252743 3300009093 Bacteria 2037
202 Ga0111539_10020959 3300009094 Bacteria 8048
203 Ga0111539_10148446 3300009094 Bacteria 2745
204 Ga0111539_10458923 3300009094 Bacteria 1484
205 Ga0111539_11754466 3300009094 Bacteria 720
206 Ga0105245_10042889 3300009098 Bacteria 4035
207 Ga0105245_10047799 3300009098 Bacteria 3826
208 Ga0105245_10164740 3300009098 Bacteria 2106
209 Ga0105245_10347592 3300009098 Bacteria 1468
210 Ga0105245_10426984 3300009098 Bacteria 1329
211 Ga0105247_10044362 3300009101 Bacteria 2726
212 Ga0114129_10018158 3300009147 Bacteria 10016
213 Ga0114129_10036305 3300009147 Bacteria 6960
214 Ga0105243_10075142 3300009148 Bacteria 2742
215 Ga0105243_10510922 3300009148 Bacteria 1141
216 Ga0105241_10035562 3300009174 Bacteria 3746
217 Ga0105241_10060330 3300009174 Unclassified 2918
218 Ga0105241_10213953 3300009174 Bacteria 1616
219 Ga0105241_10733954 3300009174 Bacteria 904
220 Ga0105242_10114466 3300009176 Bacteria 2305
221 Ga0105242_10281456 3300009176 Bacteria 1511
222 Ga0105242_10520350 3300009176 Bacteria 1135
223 Ga0105248_10038158 3300009177 Bacteria 5376
224 Ga0105248_10285851 3300009177 Bacteria 1857
225 Ga0105248_10404428 3300009177 Bacteria 1537
226 Ga0105237_10173242 3300009545 Bacteria 2158
227 Ga0105237_10294971 3300009545 Unclassified 1624
228 Ga0105237_10427516 3300009545 Bacteria 1330
229 Ga0105238_10036048 3300009551 Bacteria 5028
230 Ga0105238_10285725 3300009551 Bacteria 1631
231 Ga0105238_10787308 3300009551 Bacteria 966
232 Ga0105238_10941389 3300009551 Bacteria 883
233 Ga0105238_11088877 3300009551 Unclassified 821
234 Ga0105249_10003588 3300009553 Bacteria 13424
235 Ga0105249_10010741 3300009553 Bacteria 8044
236 Ga0105249_10059935 3300009553 Bacteria 3491
237 Ga0105249_10526139 3300009553 Bacteria 1230
238 Ga0105249_10898455 3300009553 Unclassified 953
239 Ga0105249_11074169 3300009553 Bacteria 875
240 Ga0105249_11151709 3300009553 Unclassified 846
241 Ga0099796_10003697 3300010159 Bacteria 3592
242 Ga0105239_10044072 3300010375 Bacteria 4891
243 Ga0105239_10089941 3300010375 Bacteria 3386
244 Ga0105239_10114964 3300010375 Unclassified 2985
245 Ga0105239_10338725 3300010375 Bacteria 1697
246 Ga0105239_10760741 3300010375 Unclassified 1109
247 Ga0105239_10948715 3300010375 Bacteria 988
248 Ga0105246_10063778 3300011119 Bacteria 2571
249 Ga0105246_10099082 3300011119 Bacteria 2118
250 Ga0105246_10123036 3300011119 Bacteria 1925
251 Ga0105246_10303258 3300011119 Bacteria 1291
252 Ga0105246_10317020 3300011119 Bacteria 1265
253 Ga0157373_10065900 3300013100 Bacteria 2563
254 Ga0157378_10064315 3300013297 Bacteria 3281
255 Ga0157378_10146601 3300013297 Bacteria 2196
256 Ga0157378_10169067 3300013297 Bacteria 2049
257 Ga0157378_10747482 3300013297 Unclassified 1001
258 Ga0163162_10016763 3300013306 Bacteria 7161
259 Ga0163162_10433011 3300013306 Unclassified 1447
260 Ga0163162_10674390 3300013306 Bacteria 1157
261 Ga0157372_11093655 3300013307 Bacteria 922
262 Ga0157375_10031834 3300013308 Bacteria 4995
263 Ga0157375_10081237 3300013308 Bacteria 3281
264 Ga0157375_10363560 3300013308 Bacteria 1613
265 Ga0163163_10000002 3300014325 Bacteria 609846
266 Ga0163163_10029488 3300014325 Bacteria 5278
267 Ga0163163_10061400 3300014325 Bacteria 3724
268 Ga0163163_10148602 3300014325 Bacteria 2387
269 Ga0163163_10199498 3300014325 Bacteria 2049
270 Ga0157380_10038167 3300014326 Bacteria 3728
271 Ga0157380_10104563 3300014326 Bacteria 2365
272 Ga0157380_10236348 3300014326 Unclassified 1645
273 Ga0157377_10017371 3300014745 Bacteria 3719
274 Ga0157379_10017446 3300014968 Bacteria 6321
275 Ga0157379_10049285 3300014968 Bacteria 3760
276 Ga0157379_10721528 3300014968 Bacteria 937
277 Ga0157376_10067168 3300014969 Bacteria 3032
278 Ga0157376_10069687 3300014969 Bacteria 2982
279 Ga0157376_11084894 3300014969 Bacteria 826
280 Ga0157376_11241954 3300014969 Bacteria 774
281 Ga0163161_10088184 3300017792 Bacteria 2293
282 Ga0163161_10193625 3300017792 Bacteria 1564
283 Ga0163161_10263267 3300017792 Unclassified 1347
284 Ga0213876_10239066 3300021384 Bacteria 965
285 Ga0209233_1000015 3300025261 Bacteria 980563
286 Ga0209758_1000013 3300025297 Bacteria 873003
287 Ga0209758_1103827 3300025297 Bacteria 801
288 Ga0207656_10024585 3300025321 Bacteria 2437
289 Ga0207682_10002454 3300025893 Bacteria 8304
290 Ga0207692_10082028 3300025898 Bacteria 1727
291 Ga0207642_10073502 3300025899 Bacteria 1635
292 Ga0207710_10011767 3300025900 Bacteria 3680
293 Ga0207688_10001561 3300025901 Bacteria 12070
294 Ga0207680_10047854 3300025903 Bacteria 2536
295 Ga0207680_10205662 3300025903 Bacteria 1344
296 Ga0207647_10014113 3300025904 Bacteria 5518
297 Ga0207647_10305977 3300025904 Bacteria 904
298 Ga0207685_10096642 3300025905 Unclassified 1255
299 Ga0207645_10137569 3300025907 Bacteria 1591
300 Ga0207643_10000591 3300025908 Bacteria 23005
301 Ga0207643_10021255 3300025908 Bacteria 3563
302 Ga0207705_10082076 3300025909 Bacteria 2350
303 Ga0207705_10517522 3300025909 Bacteria 927
304 Ga0207684_10198564 3300025910 Bacteria 1730
305 Ga0207684_10847429 3300025910 Unclassified 771
306 Ga0207654_10169474 3300025911 Bacteria 1417
307 Ga0207707_10270457 3300025912 Bacteria 1473
308 Ga0207695_10007385 3300025913 Bacteria 14020
309 Ga0207695_10101228 3300025913 Bacteria 2876
310 Ga0207695_10226385 3300025913 Unclassified 1776
311 Ga0207693_10008486 3300025915 Bacteria 8410
312 Ga0207693_10403275 3300025915 Bacteria 1069
313 Ga0207660_10070641 3300025917 Bacteria 2539
314 Ga0207662_10082374 3300025918 Bacteria 1965
315 Ga0207662_10082931 3300025918 Bacteria 1959
316 Ga0207662_10172906 3300025918 Unclassified 1386
317 Ga0207657_10043092 3300025919 Bacteria 3978
318 Ga0207657_10171922 3300025919 Bacteria 1755
319 Ga0207657_10280084 3300025919 Bacteria 1324
320 Ga0207649_10000175 3300025920 Bacteria 52525
321 Ga0207649_10030643 3300025920 Bacteria 3188
322 Ga0207649_10551305 3300025920 Bacteria 882
323 Ga0207652_10102896 3300025921 Bacteria 2524
324 Ga0207652_10904975 3300025921 Bacteria 779
325 Ga0207681_10141331 3300025923 Bacteria 1793
326 Ga0207681_10708607 3300025923 Bacteria 837
327 Ga0207694_10350231 3300025924 Bacteria 1222
328 Ga0207694_10433331 3300025924 Bacteria 1096
329 Ga0207659_10091162 3300025926 Bacteria 2276
330 Ga0207659_10546539 3300025926 Bacteria 984
331 Ga0207687_10012644 3300025927 Bacteria 5514
332 Ga0207687_10144860 3300025927 Bacteria 1806
333 Ga0207700_10215255 3300025928 Bacteria 1626
334 Ga0207700_10324434 3300025928 Bacteria 1335
335 Ga0207644_10012355 3300025931 Bacteria 5669
336 Ga0207644_10184853 3300025931 Bacteria 1636
337 Ga0207690_10109465 3300025932 Bacteria 1987
338 Ga0207706_10001103 3300025933 Bacteria 27497
339 Ga0207706_10107628 3300025933 Unclassified 2453
340 Ga0207706_10767071 3300025933 Bacteria 821
341 Ga0207686_10024854 3300025934 Bacteria 3477
342 Ga0207709_10038896 3300025935 Bacteria 2837
343 Ga0207709_10371222 3300025935 Bacteria 1086
344 Ga0207670_10034012 3300025936 Bacteria 3289
345 Ga0207670_10264696 3300025936 Bacteria 1334
346 Ga0207670_10328578 3300025936 Bacteria 1205
347 Ga0207670_10620206 3300025936 Bacteria 889
348 Ga0207669_10010624 3300025937 Bacteria 4438
349 Ga0207669_10057730 3300025937 Bacteria 2364
350 Ga0207704_10427489 3300025938 Bacteria 1052
351 Ga0207691_10001292 3300025940 Bacteria 24983
352 Ga0207691_10001627 3300025940 Bacteria 22294
353 Ga0207691_10244410 3300025940 Bacteria 1551
354 Ga0207711_10044806 3300025941 Bacteria 3778
355 Ga0207711_10356880 3300025941 Bacteria 1354
356 Ga0207689_10003872 3300025942 Bacteria 13632
357 Ga0207689_10007002 3300025942 Bacteria 9914
358 Ga0207689_10387107 3300025942 Bacteria 1165
359 Ga0207689_10619325 3300025942 Bacteria 911
360 Ga0207661_10021586 3300025944 Bacteria 4827
361 Ga0207679_10240879 3300025945 Bacteria 1532
362 Ga0207679_10299446 3300025945 Bacteria 1386
363 Ga0207651_10018327 3300025960 Bacteria 4162
364 Ga0207651_10031156 3300025960 Bacteria 3405
365 Ga0207651_10265777 3300025960 Bacteria 1411
366 Ga0207651_10601867 3300025960 Unclassified 961
367 Ga0207712_10010489 3300025961 Bacteria 5882
368 Ga0207712_10053294 3300025961 Bacteria 2837
369 Ga0207712_10295183 3300025961 Unclassified 1328
370 Ga0207668_10010533 3300025972 Bacteria 5590
371 Ga0207668_10029820 3300025972 Bacteria 3579
372 Ga0207640_10017964 3300025981 Bacteria 4147
373 Ga0207640_10423110 3300025981 Bacteria 1091
374 Ga0207640_10437322 3300025981 Unclassified 1075
375 Ga0207658_10112977 3300025986 Bacteria 2151
376 Ga0207658_11079153 3300025986 Bacteria 733
377 Ga0207677_10141797 3300026023 Bacteria 1841
378 Ga0207677_10322733 3300026023 Bacteria 1284
379 Ga0207677_10423514 3300026023 Bacteria 1134
380 Ga0207703_10035780 3300026035 Bacteria 3947
381 Ga0207703_10116313 3300026035 Bacteria 2289
382 Ga0207703_10392422 3300026035 Bacteria 1286
383 Ga0207703_10658090 3300026035 Bacteria 994
384 Ga0207639_10050588 3300026041 Bacteria 3156
385 Ga0207639_10254316 3300026041 Bacteria 1533
386 Ga0207639_10417333 3300026041 Bacteria 1212
387 Ga0207639_10535874 3300026041 Bacteria 1073
388 Ga0207678_10006265 3300026067 Bacteria 10566
389 Ga0207708_10000620 3300026075 Bacteria 27264
390 Ga0207702_10255077 3300026078 Bacteria 1649
391 Ga0207702_10558471 3300026078 Bacteria 1120
392 Ga0207641_10115840 3300026088 Bacteria 2383
393 Ga0207641_10438611 3300026088 Unclassified 1260
394 Ga0207648_10002122 3300026089 Bacteria 21569
395 Ga0207648_10010029 3300026089 Bacteria 9010
396 Ga0207648_10027675 3300026089 Bacteria 5031
397 Ga0207648_10049679 3300026089 Bacteria 3669
398 Ga0207648_10988665 3300026089 Unclassified 788
399 Ga0207676_10053395 3300026095 Bacteria 3163
400 Ga0207676_11168283 3300026095 Bacteria 762
401 Ga0207674_10034599 3300026116 Bacteria 5280
402 Ga0207674_10122408 3300026116 Bacteria 2568
403 Ga0207674_10197966 3300026116 Bacteria 1959
404 Ga0207674_10245581 3300026116 Bacteria 1737
405 Ga0207674_10396984 3300026116 Unclassified 1333
406 Ga0207675_100002342 3300026118 Bacteria 18784
407 Ga0207675_100150368 3300026118 Bacteria 2216
408 Ga0207675_100479267 3300026118 Unclassified 1236
409 Ga0207675_100834633 3300026118 Bacteria 936
410 Ga0207675_100871870 3300026118 Bacteria 916
411 Ga0207675_100953798 3300026118 Bacteria 875
412 Ga0207683_10001466 3300026121 Bacteria 21270
413 Ga0207683_10019897 3300026121 Bacteria 5736
414 Ga0207683_10027226 3300026121 Bacteria 4940
415 Ga0207698_10030872 3300026142 Bacteria 3860
416 Ga0207428_10059653 3300027907 Bacteria 3024
417 Ga0207428_10593217 3300027907 Unclassified 799
418 Ga0268266_10030897 3300028379 Bacteria 4548
419 Ga0268266_10060428 3300028379 Bacteria 3267
420 Ga0268266_10085736 3300028379 Unclassified 2752
421 Ga0268266_10096077 3300028379 Bacteria 2603
422 Ga0268266_10190657 3300028379 Bacteria 1871
423 Ga0268265_10003847 3300028380 Bacteria 10619
424 Ga0268265_10008498 3300028380 Bacteria 6939
425 Ga0268265_10113362 3300028380 Bacteria 2218
426 Ga0268265_10177336 3300028380 Bacteria 1828
427 Ga0268265_10698879 3300028380 Bacteria 979
428 Ga0268264_10000002 3300028381 Bacteria 1153045
429 Ga0268264_10010088 3300028381 Bacteria 7820
430 Ga0268264_10013565 3300028381 Bacteria 6708
431 Ga0268264_10273338 3300028381 Bacteria 1579
432 Ga0265325_10005662 3300031241 Bacteria 7686
433 Ga0265340_10020750 3300031247 Bacteria 3373
434 Ga0265331_10000006 3300031250 Bacteria 418907
435 Ga0265331_10002206 3300031250 Bacteria 13370
436 Ga0265327_10000052 3300031251 Bacteria 256602
437 Ga0265316_10164396 3300031344 Bacteria 1658
438 Ga0265316_10389836 3300031344 Bacteria 1004
439 Ga0307508_10122717 3300031616 Bacteria 2201
440 Ga0265314_10033657 3300031711 Bacteria 3753
441 Ga0265314_10037316 3300031711 Bacteria 3522
442 Ga0265314_10060762 3300031711 Bacteria 2578
443 Ga0307516_10065689 3300031730 Bacteria 3502
444 Ga0307516_10309005 3300031730 Bacteria 1255
445 Ga0373934_0111171 3300035086 Unclassified 1111
446 Ga0373952_0076400 3300035092 Bacteria 847
447 Ga0373936_0061946 3300035113 Bacteria 1529
448 Ga0373936_0070730 3300035113 Bacteria 1438
449 Ga0373945_0008188 3300035116 Bacteria 3400
450 Ga0373953_0094553 3300035117 Bacteria 1253
451 Ga0373954_0328388 3300035118 Bacteria 755
452 Ga0373943_0020649 3300035170 Bacteria 3038
453 Ga0373943_0083043 3300035170 Bacteria 1646
454 Ga0373946_0029455 3300035171 Bacteria 2185
455 Ga0373955_0009688 3300035172 Bacteria 4524
456 Ga0373955_0115161 3300035172 Bacteria 1558
457 Ga0373924_0196336 3300035410 Unclassified 889
458 Ga0373935_0080626 3300035692 Bacteria 2114
459 Ga0373935_0107535 3300035692 Unclassified 1847
460 Ga0373927_0101168 3300035695 Bacteria 1874
461 Ga0373927_0150214 3300035695 Bacteria 1526
462 Ga0373927_0381062 3300035695 Unclassified 930
463 Ga0373947_0043711 3300035725 Bacteria 2676
464 Ga0373947_0060763 3300035725 Bacteria 2295
465 Ga0373947_0118568 3300035725 Bacteria 1679
466 Ga0373937_0000808 3300036401 Bacteria 26768
467 Ga0373925_0075547 3300037068 Bacteria 2553
468 Ga0395900_0493295 3300037418 Bacteria 1176
469 Ga0395898_0046313 3300037466 Bacteria 4272
470 Ga0395905_0189188 3300037471 Bacteria 1931
471 Ga0395905_0606632 3300037471 Bacteria 996
472 Ga0395905_0671457 3300037471 Bacteria 938
473 Ga0395901_0009330 3300038443 Bacteria 9947
474 Ga0436365_0198822 3300039437 Bacteria 12072
475 Ga0436360_0786743 3300039438 Bacteria 2158
476 Ga0436361_0402180 3300039447 Bacteria 4326
477 Ga0466963_0101694 3300044694 Bacteria 1968
478 Ga0495603_0025190 3300046455 Bacteria 3597
479 Ga0495603_0281545 3300046455 Bacteria 956
480 Ga0495638_0017859 3300046460 Bacteria 4721
481 Ga0495580_0091521 3300046472 Bacteria 2117
482 Ga0495582_0039945 3300046473 Bacteria 2583
483 Ga0495605_0026817 3300046474 Bacteria 2991
484 Ga0495605_0041262 3300046474 Bacteria 2299
485 Ga0495605_0192347 3300046474 Unclassified 892
486 Ga0495639_0024031 3300046475 Bacteria 2680
487 Ga0495662_0240447 3300046476 Unclassified 892
488 Ga0495584_0368425 3300046491 Bacteria 730
489 Ga0495585_0038603 3300046492 Bacteria 2687
490 Ga0495585_0057456 3300046492 Bacteria 2147
491 Ga0495594_0114706 3300046499 Bacteria 1520
492 Ga0495596_0088368 3300046500 Bacteria 1203
493 Ga0495607_0053639 3300046501 Bacteria 2328
494 Ga0495607_0138720 3300046501 Bacteria 1257
495 Ga0495608_0320943 3300046511 Unclassified 957
496 Ga0495628_0417019 3300046516 Unclassified 979
497 Ga0495628_0625119 3300046516 Bacteria 767
498 Ga0495630_0105281 3300046517 Bacteria 2136
499 Ga0495644_0059861 3300046523 Bacteria 1432
500 Ga0495648_0170503 3300046524 Unclassified 1116
501 Ga0495663_0005060 3300046525 Bacteria 3684
502 Ga0495663_0112773 3300046525 Bacteria 905
503 Ga0495654_0045497 3300046530 Bacteria 2165
504 Ga0495640_0066787 3300046533 Unclassified 2425
505 Ga0495640_0321109 3300046533 Bacteria 959
506 Ga0495609_0072852 3300046538 Bacteria 1508
507 Ga0495621_0034236 3300046539 Bacteria 1754
508 Ga0495621_0057120 3300046539 Bacteria 1409
509 Ga0495633_0200147 3300046558 Bacteria 917
510 Ga0495667_0220698 3300046559 Bacteria 1210
511 Ga0495656_0028459 3300046615 Bacteria 2242
512 Ga0495656_0085517 3300046615 Bacteria 1432
513 Ga0495668_0056659 3300046616 Bacteria 2163
514 Ga0495634_0063089 3300046642 Bacteria 2460
515 Ga0495659_0060026 3300046664 Bacteria 1402
516 Ga0495659_0259433 3300046664 Bacteria 726
517 Ga0495661_0054985 3300046665 Bacteria 2388
518 Ga0495588_0065970 3300046674 Bacteria 1878
519 Ga0495588_0124324 3300046674 Bacteria 1360
520 Ga0495647_0123894 3300046681 Bacteria 1090
521 Ga0495658_0008659 3300046683 Bacteria 5049
522 Ga0495658_0132021 3300046683 Bacteria 1521
523 Ga0495669_0030683 3300046684 Bacteria 2360
524 Ga0495613_0125834 3300046689 Bacteria 1838
525 Ga0495624_0331798 3300046690 Bacteria 915
526 Ga0495670_0019806 3300046691 Bacteria 3315
527 Ga0495671_0202001 3300046692 Bacteria 964
528 Ga0495649_0115228 3300046694 Bacteria 1423
529 Ga0495581_0185301 3300047315 Bacteria 1217
530 Ga0495676_0031293 3300047321 Bacteria 4502
531 Ga0495676_0418903 3300047321 Bacteria 887
532 Ga0495679_009202 3300047446 Bacteria 3970
533 Ga0495685_084819 3300047447 Bacteria 1053
534 Ga0495684_0163033 3300047471 Unclassified 1662
535 Ga0495602_0351830 3300048088 Bacteria 1063
536 Ga0495614_0308871 3300048089 Bacteria 732
537 Ga0495615_0009836 3300048090 Bacteria 1893
538 Ga0496100_0052828 3300048903 Bacteria 2643
539 Ga0496100_0112909 3300048903 Bacteria 1890
540 Ga0496100_0212877 3300048903 Bacteria 1414
541 Ga0496101_0006039 3300048904 Bacteria 7771
542 Ga0496101_0022942 3300048904 Bacteria 4303
543 Ga0496101_0213854 3300048904 Bacteria 1494
544 Ga0496102_0030424 3300048905 Bacteria 4832
545 Ga0496102_0038590 3300048905 Bacteria 4311
546 Ga0496103_0007690 3300048906 Bacteria 6407
547 Ga0496103_0207773 3300048906 Bacteria 1259
548 Ga0496104_0000671 3300048907 Bacteria 29392
549 Ga0496104_0013106 3300048907 Bacteria 7471
550 Ga0496104_0014367 3300048907 Bacteria 7153
551 Ga0496104_0175951 3300048907 Bacteria 2050
552 Ga0496104_0184912 3300048907 Bacteria 1994
553 Ga0496105_0009471 3300048908 Bacteria 7621
554 Ga0496105_0010252 3300048908 Bacteria 7367
555 Ga0496105_0263459 3300048908 Bacteria 1393
556 Ga0496106_0003496 3300048909 Bacteria 11703
557 Ga0496106_0006990 3300048909 Bacteria 8335
558 Ga0496106_0173641 3300048909 Bacteria 1709
559 Ga0496107_0016347 3300048910 Bacteria 5208
560 Ga0496107_0016379 3300048910 Bacteria 5204
561 Ga0496108_0000347 3300048911 Bacteria 39108
562 Ga0496108_0001531 3300048911 Bacteria 18306
563 Ga0496108_0009690 3300048911 Bacteria 7804
564 Ga0496108_0049755 3300048911 Bacteria 3505
565 Ga0496108_0512843 3300048911 Bacteria 1047
566 Ga0496109_0004728 3300048912 Bacteria 11376
567 Ga0496109_0008070 3300048912 Bacteria 8922
568 Ga0496109_0039283 3300048912 Bacteria 4283
569 Ga0496109_0109428 3300048912 Bacteria 2568
570 Ga0496109_0413601 3300048912 Bacteria 1274
571 Ga0496109_0793474 3300048912 Bacteria 885
572 Ga0496110_0000339 3300048913 Bacteria 31235
573 Ga0496110_0001978 3300048913 Bacteria 15238
574 Ga0496110_0019355 3300048913 Bacteria 5726
575 Ga0496110_0057939 3300048913 Bacteria 3411
576 Ga0496110_0102781 3300048913 Bacteria 2563
577 Ga0496110_0264651 3300048913 Bacteria 1565
578 Ga0496110_1188369 3300048913 Unclassified 671
579 Ga0496111_0001676 3300048914 Bacteria 12899
580 Ga0496111_0012805 3300048914 Bacteria 5690
581 Ga0496111_0016270 3300048914 Bacteria 5123
582 Ga0496111_0082411 3300048914 Bacteria 2349
583 Ga0496112_0001338 3300048915 Bacteria 18736
584 Ga0496112_0004698 3300048915 Bacteria 11628
585 Ga0496112_0011100 3300048915 Bacteria 8209
586 Ga0496112_0129944 3300048915 Bacteria 2490
587 Ga0496112_0165213 3300048915 Bacteria 2179
588 Ga0496112_0467015 3300048915 Bacteria 1199
589 Ga0496113_0000331 3300048916 Bacteria 22477
590 Ga0496113_0008812 3300048916 Bacteria 6589
591 Ga0496113_0144162 3300048916 Bacteria 1875
592 Ga0496114_0030874 3300048917 Bacteria 4407
593 Ga0496114_0333346 3300048917 Bacteria 1341
594 Ga0496114_0892541 3300048917 Bacteria 770
595 Ga0496114_1242492 3300048917 Bacteria 631
596 Ga0496115_0036354 3300048918 Bacteria 3899
597 Ga0496115_0047038 3300048918 Bacteria 3449
598 Ga0496115_0103894 3300048918 Bacteria 2331
599 Ga0496115_0273950 3300048918 Bacteria 1386
600 Ga0496121_0000913 3300048924 Bacteria 53289
601 Ga0496126_0216097 3300048929 Bacteria 1612
602 Ga0501032_0267280 3300049569 Unclassified 1108
603 Ga0501033_0025950 3300049570 Bacteria 4412
604 Ga0501033_0086795 3300049570 Bacteria 2290
605 Ga0501033_0276946 3300049570 Bacteria 1185
606 Ga0501033_0737133 3300049570 Archaea 669
607 Ga0501034_0015949 3300049571 Bacteria 7711
608 Ga0501036_0036722 3300049572 Bacteria 4147
609 Ga0501037_0007536 3300049573 Bacteria 7969
610 Ga0501037_0128768 3300049573 Bacteria 1816
611 Ga0501038_0095310 3300049574 Bacteria 2486
612 Ga0501043_0058645 3300049579 Bacteria 3021
613 Ga0501046_0021675 3300049580 Bacteria 5300
614 Ga0501046_0082042 3300049580 Bacteria 2491
615 Ga0501047_0006741 3300049581 Bacteria 10795
616 Ga0501047_0015028 3300049581 Bacteria 7368
617 Ga0501047_0072211 3300049581 Bacteria 3322
618 Ga0501047_0090486 3300049581 Bacteria 2937
619 Ga0501047_0110036 3300049581 Bacteria 2638
620 Ga0501047_0156437 3300049581 Bacteria 2153
621 Ga0501047_0547428 3300049581 Unclassified 982
622 Ga0501048_0162337 3300049582 Bacteria 1582
623 Ga0501068_0017115 3300049584 Bacteria 4189
624 Ga0501069_0187862 3300049585 Bacteria 1195
625 Ga0501070_0131921 3300049586 Bacteria 2063
626 Ga0501072_0392977 3300049588 Bacteria 1100
627 Ga0501073_0026353 3300049589 Bacteria 4166
628 Ga0501073_0126980 3300049589 Bacteria 1768
629 Ga0501073_0237454 3300049589 Bacteria 1259
630 Ga0501073_0465259 3300049589 Unclassified 874
631 Ga0501074_0088247 3300049590 Bacteria 2221
632 Ga0501075_0399341 3300049591 Bacteria 1048
633 Ga0501076_0435345 3300049592 Bacteria 1079
634 Ga0501083_0050476 3300049744 Bacteria 2800
635 Ga0501083_0143271 3300049744 Bacteria 1565
636 Ga0501083_0345837 3300049744 Bacteria 967
637 Ga0501035_0005667 3300049822 Bacteria 11792
638 Ga0501035_0047019 3300049822 Bacteria 3877
639 Ga0501035_0107410 3300049822 Bacteria 2447
640 Ga0501035_0122134 3300049822 Bacteria 2276
641 Ga0501044_0001467 3300049823 Bacteria 27692
642 Ga0501044_0002022 3300049823 Bacteria 23376
643 Ga0501044_0448684 3300049823 Bacteria 1197
644 Ga0501045_0177915 3300049824 Bacteria 1585
645 nmdc:mga0yw44_49284_c1 3300050492 Bacteria 2542
646 nmdc:mga06z11_110086_c1 3300050494 Bacteria 1524
647 nmdc:mga06z11_367188_c1 3300050494 Unclassified 863
648 nmdc:mga04h51_205716_c1 3300050495 Unclassified 775
649 nmdc:mga07m45_81351_c1 3300050496 Bacteria 1849
650 nmdc:mga05p37_136974_c1 3300050507 Bacteria 3001
651 nmdc:mga05p37_17333_c1 3300050507 Bacteria 8689
652 nmdc:mga05p37_46172_c1 3300050507 Bacteria 5356
653 nmdc:mga05p37_532395_c1 3300050507 Bacteria 1341
654 nmdc:mga09592_502414_c1 3300050508 Unclassified 1044
655 nmdc:mga09592_727214_c1 3300050508 Unclassified 843
656 nmdc:mga0qj67_345665_c1 3300050509 Bacteria 1203
657 nmdc:mga06r32_108563_c1 3300050510 Bacteria 2728
658 nmdc:mga06r32_1264791_c1 3300050510 Unclassified 683
659 nmdc:mga06r32_1271946_c1 3300050510 Bacteria 680
660 nmdc:mga06r32_48157_c1 3300050510 Bacteria 4074
661 nmdc:mga06r32_487534_c1 3300050510 Unclassified 1210
662 nmdc:mga08y16_39967_c1 3300050511 Bacteria 4920
663 nmdc:mga08y16_87901_c1 3300050511 Bacteria 3238
664 nmdc:mga08y16_97049_c1 3300050511 Bacteria 3069
665 nmdc:mga0n895_1105057_c1 3300050512 Bacteria 770
666 nmdc:mga0n895_215953_c2 3300050512 Bacteria 1042
667 nmdc:mga0rr50_738155_c1 3300050513 Bacteria 840
668 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
669 nmdc:mga08x19_338883_c1 3300050514 Unclassified 1048
670 nmdc:mga0a205_261691_c1 3300050515 Bacteria 1607
671 Ga0495601_0035347 3300053077 Bacteria 3118
672 Ga0495655_0000668 3300053083 Bacteria 5508
673 Ga0495619_0009907 3300053085 Bacteria 6003
674 Ga0495619_0065055 3300053085 Bacteria 2432
675 Ga0495619_0098107 3300053085 Bacteria 1992
676 Ga0500643_000003 3300053087 Bacteria 876659
677 Ga0500643_001292 3300053087 Bacteria 14753
678 Ga0500643_074680 3300053087 Unclassified 938
679 Ga0500646_0060895 3300053090 Unclassified 1111
680 Ga0500641_0000846 3300053096 Bacteria 11006
681 Ga0500641_0018330 3300053096 Bacteria 2632
682 Ga0500595_016745 3300053119 Bacteria 2724
683 Ga0500568_0025794 3300053139 Bacteria 2474
684 Ga0500568_0071634 3300053139 Bacteria 1326
685 Ga0500573_0000008 3300053140 Bacteria 237795
686 Ga0500577_0106815 3300053142 Bacteria 1151
687 Ga0500639_036474 3300053163 Unclassified 2593
688 Ga0501084_0020727 3300054114 Bacteria 5483
689 Ga0501082_0063296 3300060353 Bacteria 3185
690 Ga0501082_0318909 3300060353 Bacteria 1354
691 Ga0530510_0264563 3300061734 Bacteria 1283
692 Ga0530510_0380697 3300061734 Unclassified 1062
693 Ga0530510_0625729 3300061734 Unclassified 819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_10708607 Ga0207681_107086072 166
2 3300048917 Ga0496114_1242492 Ga0496114_1242492_29_556 175
3 3300053087 Ga0500643_000003 Ga0500643_000003_419616_420311 177
4 3300005548 Ga0070665_100220929 Ga0070665_1002209292 180
5 3300049581 Ga0501047_0072211 Ga0501047_0072211_2418_3098 181
6 3300035725 Ga0373947_0060763 Ga0373947_0060763_369_1076 183
7 3300026116 Ga0207674_10245581 Ga0207674_102455812 187
8 3300021384 Ga0213876_10239066 Ga0213876_102390662 188
9 3300039437 Ga0436365_0198822 Ga0436365_0198822_4844_5542 188
10 3300048912 Ga0496109_0793474 Ga0496109_0793474_14_718 188
11 3300005937 Ga0081455_10138944 Ga0081455_101389442 189
12 3300037418 Ga0395900_0493295 Ga0395900_0493295_143_847 189
13 3300037471 Ga0395905_0189188 Ga0395905_0189188_1012_1716 189
14 3300049569 Ga0501032_0267280 Ga0501032_0267280_444_1088 189
15 3300053087 Ga0500643_001292 Ga0500643_001292_165_836 189
16 3300005347 Ga0070668_100004096 Ga0070668_10000409610 192
17 3300005844 Ga0068862_100073243 Ga0068862_1000732433 192
18 3300026118 Ga0207675_100871870 Ga0207675_1008718701 192
19 3300028380 Ga0268265_10003847 Ga0268265_100038476 192
20 3300037471 Ga0395905_0606632 Ga0395905_0606632_103_807 192
21 3300037471 Ga0395905_0671457 Ga0395905_0671457_133_837 192
22 3300048911 Ga0496108_0512843 Ga0496108_0512843_317_1021 192
23 3300005549 Ga0070704_100038731 Ga0070704_1000387313 193
24 3300005563 Ga0068855_100034384 Ga0068855_1000343844 193
25 3300009553 Ga0105249_10003588 Ga0105249_100035885 193
26 3300025961 Ga0207712_10295183 Ga0207712_102951832 193
27 3300035171 Ga0373946_0029455 Ga0373946_0029455_926_1534 193
28 3300035725 Ga0373947_0043711 Ga0373947_0043711_558_1166 193
29 3300046472 Ga0495580_0091521 Ga0495580_0091521_908_1516 193
30 3300046475 Ga0495639_0024031 Ga0495639_0024031_1416_2024 193
31 3300046476 Ga0495662_0240447 Ga0495662_0240447_16_624 193
32 3300046517 Ga0495630_0105281 Ga0495630_0105281_166_774 193
33 3300046674 Ga0495588_0065970 Ga0495588_0065970_58_801 193
34 3300047315 Ga0495581_0185301 Ga0495581_0185301_595_1203 193
35 3300009094 Ga0111539_10458923 Ga0111539_104589232 195
36 3300028380 Ga0268265_10177336 Ga0268265_101773361 195
37 3300061734 Ga0530510_0380697 Ga0530510_0380697_349_957 195
38 3300053096 Ga0500641_0000846 Ga0500641_0000846_9481_10155 196
39 3300005843 Ga0068860_100000109 Ga0068860_10000010948 197
40 3300005844 Ga0068862_100701197 Ga0068862_1007011971 197
41 3300028381 Ga0268264_10000002 Ga0268264_10000002599 197
42 3300005331 Ga0070670_100019601 Ga0070670_1000196015 199
43 3300005347 Ga0070668_100003443 Ga0070668_1000034438 199
44 3300005353 Ga0070669_100103425 Ga0070669_1001034253 199
45 3300005367 Ga0070667_100011828 Ga0070667_1000118286 199
46 3300005617 Ga0068859_100006386 Ga0068859_1000063865 199
47 3300005618 Ga0068864_100076319 Ga0068864_1000763193 199
48 3300005841 Ga0068863_100013950 Ga0068863_1000139508 199
49 3300005843 Ga0068860_100266218 Ga0068860_1002662182 199
50 3300005844 Ga0068862_100003711 Ga0068862_1000037119 199
51 3300006931 Ga0097620_100006386 Ga0097620_1000063869 199
52 3300025931 Ga0207644_10184853 Ga0207644_101848532 199
53 3300025972 Ga0207668_10010533 Ga0207668_100105336 199
54 3300026118 Ga0207675_100150368 Ga0207675_1001503683 199
55 3300028380 Ga0268265_10008498 Ga0268265_100084986 199
56 3300028381 Ga0268264_10013565 Ga0268264_100135656 199
57 3300049822 Ga0501035_0122134 Ga0501035_0122134_1115_1837 199
58 3300049823 Ga0501044_0002022 Ga0501044_0002022_1535_2257 199
59 3300003203 JGI25406J46586_10001759 JGI25406J46586_100017593 201
60 3300005985 Ga0081539_10003504 Ga0081539_100035044 201
61 3300009098 Ga0105245_10347592 Ga0105245_103475922 201
62 3300049581 Ga0501047_0110036 Ga0501047_0110036_462_1184 201
63 3300001977 JGI24746J21847_1007809 JGI24746J21847_10078092 202
64 3300001991 JGI24743J22301_10006434 JGI24743J22301_100064342 202
65 3300002070 JGI24750J21931_1001938 JGI24750J21931_10019381 202
66 3300002073 JGI24745J21846_1001757 JGI24745J21846_10017572 202
67 3300002075 JGI24738J21930_10014202 JGI24738J21930_100142022 202
68 3300002076 JGI24749J21850_1008317 JGI24749J21850_10083171 202
69 3300002077 JGI24744J21845_10000406 JGI24744J21845_100004065 202
70 3300002244 JGI24742J22300_10001904 JGI24742J22300_100019044 202
71 3300003215 JGI25153J46596_10006977 JGI25153J46596_100069771 202
72 3300003659 JGI25404J52841_10002770 JGI25404J52841_100027704 202
73 3300005328 Ga0070676_10310741 Ga0070676_103107412 202
74 3300005330 Ga0070690_100281039 Ga0070690_1002810392 202
75 3300005333 Ga0070677_10007226 Ga0070677_100072263 202
76 3300005333 Ga0070677_10172119 Ga0070677_101721191 202
77 3300005334 Ga0068869_100018551 Ga0068869_1000185514 202
78 3300005334 Ga0068869_100930773 Ga0068869_1009307731 202
79 3300005335 Ga0070666_10016334 Ga0070666_100163344 202
80 3300005335 Ga0070666_10218196 Ga0070666_102181962 202
81 3300005335 Ga0070666_10320437 Ga0070666_103204372 202
82 3300005336 Ga0070680_100376706 Ga0070680_1003767062 202
83 3300005337 Ga0070682_100001556 Ga0070682_1000015563 202
84 3300005337 Ga0070682_100010810 Ga0070682_1000108102 202
85 3300005337 Ga0070682_100694673 Ga0070682_1006946732 202
86 3300005338 Ga0068868_100010355 Ga0068868_1000103554 202
87 3300005338 Ga0068868_100346087 Ga0068868_1003460872 202
88 3300005338 Ga0068868_100531176 Ga0068868_1005311762 202
89 3300005339 Ga0070660_100043079 Ga0070660_1000430794 202
90 3300005339 Ga0070660_100097872 Ga0070660_1000978723 202
91 3300005340 Ga0070689_100124521 Ga0070689_1001245212 202
92 3300005340 Ga0070689_100365883 Ga0070689_1003658831 202
93 3300005341 Ga0070691_10041216 Ga0070691_100412162 202
94 3300005343 Ga0070687_100310669 Ga0070687_1003106692 202
95 3300005344 Ga0070661_100000071 Ga0070661_1000000712 202
96 3300005345 Ga0070692_10114576 Ga0070692_101145762 202
97 3300005347 Ga0070668_100075925 Ga0070668_1000759252 202
98 3300005353 Ga0070669_100184306 Ga0070669_1001843062 202
99 3300005353 Ga0070669_100456341 Ga0070669_1004563411 202
100 3300005354 Ga0070675_100078289 Ga0070675_1000782893 202
101 3300005355 Ga0070671_100003476 Ga0070671_1000034764 202
102 3300005355 Ga0070671_100076539 Ga0070671_1000765392 202
103 3300005356 Ga0070674_100007703 Ga0070674_1000077032 202
104 3300005356 Ga0070674_100042735 Ga0070674_1000427352 202
105 3300005364 Ga0070673_100012560 Ga0070673_1000125605 202
106 3300005364 Ga0070673_100013937 Ga0070673_1000139374 202
107 3300005364 Ga0070673_100698000 Ga0070673_1006980001 202
108 3300005365 Ga0070688_100049175 Ga0070688_1000491751 202
109 3300005365 Ga0070688_100057908 Ga0070688_1000579082 202
110 3300005365 Ga0070688_100193467 Ga0070688_1001934672 202
111 3300005366 Ga0070659_100009307 Ga0070659_1000093077 202
112 3300005366 Ga0070659_100104161 Ga0070659_1001041613 202
113 3300005366 Ga0070659_101160990 Ga0070659_1011609901 202
114 3300005367 Ga0070667_100873381 Ga0070667_1008733812 202
115 3300005367 Ga0070667_101030747 Ga0070667_1010307471 202
116 3300005436 Ga0070713_100161785 Ga0070713_1001617852 202
117 3300005436 Ga0070713_100175301 Ga0070713_1001753012 202
118 3300005436 Ga0070713_100296663 Ga0070713_1002966632 202
119 3300005437 Ga0070710_10348158 Ga0070710_103481582 202
120 3300005438 Ga0070701_10005829 Ga0070701_100058292 202
121 3300005438 Ga0070701_10082252 Ga0070701_100822521 202
122 3300005438 Ga0070701_10236131 Ga0070701_102361312 202
123 3300005439 Ga0070711_100116747 Ga0070711_1001167472 202
124 3300005439 Ga0070711_100123025 Ga0070711_1001230252 202
125 3300005440 Ga0070705_100387009 Ga0070705_1003870092 202
126 3300005441 Ga0070700_100003371 Ga0070700_1000033714 202
127 3300005445 Ga0070708_100257117 Ga0070708_1002571172 202
128 3300005455 Ga0070663_100166853 Ga0070663_1001668533 202
129 3300005455 Ga0070663_100647865 Ga0070663_1006478651 202
130 3300005456 Ga0070678_100005894 Ga0070678_1000058944 202
131 3300005456 Ga0070678_100164216 Ga0070678_1001642162 202
132 3300005456 Ga0070678_100734975 Ga0070678_1007349752 202
133 3300005457 Ga0070662_100008277 Ga0070662_1000082774 202
134 3300005457 Ga0070662_100456139 Ga0070662_1004561392 202
135 3300005458 Ga0070681_10473516 Ga0070681_104735161 202
136 3300005459 Ga0068867_100026540 Ga0068867_1000265403 202
137 3300005459 Ga0068867_100088507 Ga0068867_1000885073 202
138 3300005459 Ga0068867_100137146 Ga0068867_1001371462 202
139 3300005466 Ga0070685_10023342 Ga0070685_100233422 202
140 3300005466 Ga0070685_10328629 Ga0070685_103286292 202
141 3300005467 Ga0070706_100189788 Ga0070706_1001897882 202
142 3300005471 Ga0070698_100450669 Ga0070698_1004506692 202
143 3300005518 Ga0070699_100005212 Ga0070699_1000052125 202
144 3300005536 Ga0070697_100002109 Ga0070697_1000021094 202
145 3300005536 Ga0070697_100246294 Ga0070697_1002462942 202
146 3300005539 Ga0068853_100158380 Ga0068853_1001583803 202
147 3300005539 Ga0068853_100395293 Ga0068853_1003952931 202
148 3300005539 Ga0068853_101417466 Ga0068853_1014174661 202
149 3300005543 Ga0070672_100015823 Ga0070672_1000158234 202
150 3300005543 Ga0070672_100555546 Ga0070672_1005555462 202
151 3300005543 Ga0070672_100706927 Ga0070672_1007069271 202
152 3300005544 Ga0070686_100078608 Ga0070686_1000786082 202
153 3300005544 Ga0070686_100263172 Ga0070686_1002631722 202
154 3300005544 Ga0070686_100750294 Ga0070686_1007502941 202
155 3300005545 Ga0070695_100014840 Ga0070695_1000148404 202
156 3300005545 Ga0070695_100464231 Ga0070695_1004642312 202
157 3300005547 Ga0070693_100031441 Ga0070693_1000314413 202
158 3300005547 Ga0070693_100340603 Ga0070693_1003406031 202
159 3300005548 Ga0070665_100007652 Ga0070665_1000076527 202
160 3300005548 Ga0070665_100126088 Ga0070665_1001260882 202
161 3300005548 Ga0070665_100163572 Ga0070665_1001635725 202
162 3300005548 Ga0070665_100256853 Ga0070665_1002568532 202
163 3300005564 Ga0070664_100108510 Ga0070664_1001085102 202
164 3300005577 Ga0068857_100072289 Ga0068857_1000722894 202
165 3300005577 Ga0068857_100439879 Ga0068857_1004398791 202
166 3300005577 Ga0068857_100659911 Ga0068857_1006599112 202
167 3300005614 Ga0068856_100216260 Ga0068856_1002162602 202
168 3300005614 Ga0068856_100779655 Ga0068856_1007796552 202
169 3300005615 Ga0070702_100016894 Ga0070702_1000168942 202
170 3300005615 Ga0070702_100137375 Ga0070702_1001373752 202
171 3300005616 Ga0068852_100065766 Ga0068852_1000657663 202
172 3300005617 Ga0068859_100120749 Ga0068859_1001207492 202
173 3300005618 Ga0068864_100001978 Ga0068864_10000197819 202
174 3300005618 Ga0068864_100064299 Ga0068864_1000642991 202
175 3300005718 Ga0068866_10024482 Ga0068866_100244823 202
176 3300005718 Ga0068866_10042587 Ga0068866_100425872 202
177 3300005718 Ga0068866_10045488 Ga0068866_100454882 202
178 3300005719 Ga0068861_100018551 Ga0068861_1000185513 202
179 3300005834 Ga0068851_10056896 Ga0068851_100568962 202
180 3300005840 Ga0068870_10003152 Ga0068870_100031522 202
181 3300005840 Ga0068870_10086818 Ga0068870_100868183 202
182 3300005841 Ga0068863_100002977 Ga0068863_10000297713 202
183 3300005841 Ga0068863_100545543 Ga0068863_1005455432 202
184 3300005842 Ga0068858_100046689 Ga0068858_1000466894 202
185 3300005842 Ga0068858_100135578 Ga0068858_1001355782 202
186 3300005842 Ga0068858_100245783 Ga0068858_1002457832 202
187 3300005842 Ga0068858_100366326 Ga0068858_1003663262 202
188 3300005843 Ga0068860_100018969 Ga0068860_1000189694 202
189 3300005844 Ga0068862_100139865 Ga0068862_1001398652 202
190 3300005937 Ga0081455_10016680 Ga0081455_100166805 202
191 3300005937 Ga0081455_10068364 Ga0081455_100683642 202
192 3300005937 Ga0081455_10087507 Ga0081455_100875073 202
193 3300005937 Ga0081455_10179887 Ga0081455_101798872 202
194 3300005937 Ga0081455_10217491 Ga0081455_102174912 202
195 3300005981 Ga0081538_10006350 Ga0081538_100063502 202
196 3300005981 Ga0081538_10073205 Ga0081538_100732052 202
197 3300005983 Ga0081540_1005049 Ga0081540_10050497 202
198 3300005983 Ga0081540_1074935 Ga0081540_10749352 202
199 3300006028 Ga0070717_10493952 Ga0070717_104939522 202
200 3300006028 Ga0070717_10610656 Ga0070717_106106562 202
201 3300006038 Ga0075365_10024636 Ga0075365_100246362 202
202 3300006038 Ga0075365_10041919 Ga0075365_100419192 202
203 3300006042 Ga0075368_10237893 Ga0075368_102378932 202
204 3300006048 Ga0075363_100021892 Ga0075363_1000218926 202
205 3300006163 Ga0070715_10009553 Ga0070715_100095532 202
206 3300006173 Ga0070716_100381338 Ga0070716_1003813382 202
207 3300006175 Ga0070712_100063109 Ga0070712_1000631093 202
208 3300006175 Ga0070712_100458031 Ga0070712_1004580312 202
209 3300006237 Ga0097621_100002409 Ga0097621_10000240911 202
210 3300006237 Ga0097621_100008767 Ga0097621_1000087678 202
211 3300006237 Ga0097621_100018773 Ga0097621_1000187735 202
212 3300006237 Ga0097621_100083545 Ga0097621_1000835451 202
213 3300006237 Ga0097621_100145515 Ga0097621_1001455152 202
214 3300006237 Ga0097621_100370978 Ga0097621_1003709782 202
215 3300006237 Ga0097621_100679909 Ga0097621_1006799091 202
216 3300006358 Ga0068871_100000749 Ga0068871_10000074912 202
217 3300006358 Ga0068871_100003422 Ga0068871_1000034225 202
218 3300006358 Ga0068871_100024191 Ga0068871_1000241911 202
219 3300006358 Ga0068871_100117304 Ga0068871_1001173042 202
220 3300006358 Ga0068871_100280697 Ga0068871_1002806971 202
221 3300006358 Ga0068871_100672160 Ga0068871_1006721602 202
222 3300006844 Ga0075428_100040886 Ga0075428_1000408862 202
223 3300006844 Ga0075428_100043831 Ga0075428_1000438314 202
224 3300006844 Ga0075428_100054314 Ga0075428_1000543144 202
225 3300006846 Ga0075430_100146936 Ga0075430_1001469362 202
226 3300006846 Ga0075430_100162727 Ga0075430_1001627272 202
227 3300006847 Ga0075431_100008575 Ga0075431_1000085755 202
228 3300006847 Ga0075431_100221581 Ga0075431_1002215812 202
229 3300006880 Ga0075429_100260356 Ga0075429_1002603562 202
230 3300006880 Ga0075429_100373876 Ga0075429_1003738762 202
231 3300006881 Ga0068865_100004897 Ga0068865_1000048974 202
232 3300006881 Ga0068865_100231895 Ga0068865_1002318952 202
233 3300006881 Ga0068865_100303705 Ga0068865_1003037052 202
234 3300006914 Ga0075436_100413100 Ga0075436_1004131001 202
235 3300006931 Ga0097620_100120748 Ga0097620_1001207482 202
236 3300007076 Ga0075435_100337470 Ga0075435_1003374702 202
237 3300007076 Ga0075435_100381688 Ga0075435_1003816881 202
238 3300007788 Ga0099795_10000246 Ga0099795_1000024610 202
239 3300009011 Ga0105251_10324974 Ga0105251_103249741 202
240 3300009092 Ga0105250_10027852 Ga0105250_100278523 202
241 3300009093 Ga0105240_10006316 Ga0105240_1000631615 202
242 3300009093 Ga0105240_10117189 Ga0105240_101171895 202
243 3300009093 Ga0105240_10252743 Ga0105240_102527432 202
244 3300009094 Ga0111539_10020959 Ga0111539_100209594 202
245 3300009094 Ga0111539_10148446 Ga0111539_101484462 202
246 3300009094 Ga0111539_11754466 Ga0111539_117544661 202
247 3300009098 Ga0105245_10042889 Ga0105245_100428894 202
248 3300009098 Ga0105245_10047799 Ga0105245_100477994 202
249 3300009098 Ga0105245_10164740 Ga0105245_101647402 202
250 3300009098 Ga0105245_10426984 Ga0105245_104269842 202
251 3300009101 Ga0105247_10044362 Ga0105247_100443623 202
252 3300009147 Ga0114129_10018158 Ga0114129_100181586 202
253 3300009147 Ga0114129_10036305 Ga0114129_100363056 202
254 3300009148 Ga0105243_10075142 Ga0105243_100751423 202
255 3300009148 Ga0105243_10510922 Ga0105243_105109222 202
256 3300009174 Ga0105241_10035562 Ga0105241_100355621 202
257 3300009174 Ga0105241_10060330 Ga0105241_100603302 202
258 3300009174 Ga0105241_10213953 Ga0105241_102139532 202
259 3300009174 Ga0105241_10733954 Ga0105241_107339541 202
260 3300009176 Ga0105242_10114466 Ga0105242_101144663 202
261 3300009176 Ga0105242_10281456 Ga0105242_102814562 202
262 3300009176 Ga0105242_10520350 Ga0105242_105203502 202
263 3300009177 Ga0105248_10038158 Ga0105248_100381582 202
264 3300009177 Ga0105248_10285851 Ga0105248_102858513 202
265 3300009177 Ga0105248_10404428 Ga0105248_104044282 202
266 3300009545 Ga0105237_10173242 Ga0105237_101732423 202
267 3300009545 Ga0105237_10294971 Ga0105237_102949712 202
268 3300009545 Ga0105237_10427516 Ga0105237_104275162 202
269 3300009551 Ga0105238_10036048 Ga0105238_100360483 202
270 3300009551 Ga0105238_10285725 Ga0105238_102857252 202
271 3300009551 Ga0105238_10787308 Ga0105238_107873082 202
272 3300009551 Ga0105238_10941389 Ga0105238_109413892 202
273 3300009551 Ga0105238_11088877 Ga0105238_110888771 202
274 3300009553 Ga0105249_10010741 Ga0105249_100107414 202
275 3300009553 Ga0105249_10059935 Ga0105249_100599354 202
276 3300009553 Ga0105249_10526139 Ga0105249_105261392 202
277 3300009553 Ga0105249_10898455 Ga0105249_108984552 202
278 3300009553 Ga0105249_11074169 Ga0105249_110741692 202
279 3300009553 Ga0105249_11151709 Ga0105249_111517091 202
280 3300010159 Ga0099796_10003697 Ga0099796_100036972 202
281 3300010375 Ga0105239_10044072 Ga0105239_100440725 202
282 3300010375 Ga0105239_10089941 Ga0105239_100899414 202
283 3300010375 Ga0105239_10114964 Ga0105239_101149642 202
284 3300010375 Ga0105239_10338725 Ga0105239_103387252 202
285 3300010375 Ga0105239_10760741 Ga0105239_107607411 202
286 3300010375 Ga0105239_10948715 Ga0105239_109487151 202
287 3300011119 Ga0105246_10063778 Ga0105246_100637783 202
288 3300011119 Ga0105246_10099082 Ga0105246_100990823 202
289 3300011119 Ga0105246_10123036 Ga0105246_101230363 202
290 3300011119 Ga0105246_10303258 Ga0105246_103032582 202
291 3300011119 Ga0105246_10317020 Ga0105246_103170202 202
292 3300013100 Ga0157373_10065900 Ga0157373_100659002 202
293 3300013297 Ga0157378_10064315 Ga0157378_100643152 202
294 3300013297 Ga0157378_10146601 Ga0157378_101466011 202
295 3300013297 Ga0157378_10169067 Ga0157378_101690672 202
296 3300013297 Ga0157378_10747482 Ga0157378_107474822 202
297 3300013306 Ga0163162_10016763 Ga0163162_100167636 202
298 3300013306 Ga0163162_10433011 Ga0163162_104330112 202
299 3300013306 Ga0163162_10674390 Ga0163162_106743902 202
300 3300013307 Ga0157372_11093655 Ga0157372_110936552 202
301 3300013308 Ga0157375_10031834 Ga0157375_100318342 202
302 3300013308 Ga0157375_10081237 Ga0157375_100812372 202
303 3300013308 Ga0157375_10363560 Ga0157375_103635602 202
304 3300014325 Ga0163163_10000002 Ga0163163_1000000272 202
305 3300014325 Ga0163163_10029488 Ga0163163_100294887 202
306 3300014325 Ga0163163_10061400 Ga0163163_100614004 202
307 3300014325 Ga0163163_10148602 Ga0163163_101486022 202
308 3300014325 Ga0163163_10199498 Ga0163163_101994982 202
309 3300014326 Ga0157380_10038167 Ga0157380_100381671 202
310 3300014326 Ga0157380_10104563 Ga0157380_101045632 202
311 3300014326 Ga0157380_10236348 Ga0157380_102363482 202
312 3300014745 Ga0157377_10017371 Ga0157377_100173712 202
313 3300014968 Ga0157379_10017446 Ga0157379_100174467 202
314 3300014968 Ga0157379_10049285 Ga0157379_100492853 202
315 3300014968 Ga0157379_10721528 Ga0157379_107215281 202
316 3300014969 Ga0157376_10067168 Ga0157376_100671683 202
317 3300014969 Ga0157376_10069687 Ga0157376_100696871 202
318 3300014969 Ga0157376_11084894 Ga0157376_110848941 202
319 3300014969 Ga0157376_11241954 Ga0157376_112419541 202
320 3300017792 Ga0163161_10088184 Ga0163161_100881842 202
321 3300017792 Ga0163161_10193625 Ga0163161_101936251 202
322 3300017792 Ga0163161_10263267 Ga0163161_102632671 202
323 3300025261 Ga0209233_1000015 Ga0209233_1000015589 202
324 3300025297 Ga0209758_1000013 Ga0209758_1000013758 202
325 3300025297 Ga0209758_1103827 Ga0209758_11038271 202
326 3300025321 Ga0207656_10024585 Ga0207656_100245853 202
327 3300025893 Ga0207682_10002454 Ga0207682_100024545 202
328 3300025898 Ga0207692_10082028 Ga0207692_100820282 202
329 3300025899 Ga0207642_10073502 Ga0207642_100735022 202
330 3300025900 Ga0207710_10011767 Ga0207710_100117674 202
331 3300025901 Ga0207688_10001561 Ga0207688_100015614 202
332 3300025903 Ga0207680_10047854 Ga0207680_100478542 202
333 3300025903 Ga0207680_10205662 Ga0207680_102056622 202
334 3300025904 Ga0207647_10014113 Ga0207647_100141134 202
335 3300025904 Ga0207647_10305977 Ga0207647_103059771 202
336 3300025905 Ga0207685_10096642 Ga0207685_100966421 202
337 3300025907 Ga0207645_10137569 Ga0207645_101375692 202
338 3300025908 Ga0207643_10000591 Ga0207643_100005917 202
339 3300025908 Ga0207643_10021255 Ga0207643_100212553 202
340 3300025909 Ga0207705_10082076 Ga0207705_100820761 202
341 3300025909 Ga0207705_10517522 Ga0207705_105175222 202
342 3300025910 Ga0207684_10198564 Ga0207684_101985642 202
343 3300025910 Ga0207684_10847429 Ga0207684_108474292 202
344 3300025911 Ga0207654_10169474 Ga0207654_101694742 202
345 3300025912 Ga0207707_10270457 Ga0207707_102704572 202
346 3300025913 Ga0207695_10007385 Ga0207695_100073855 202
347 3300025913 Ga0207695_10101228 Ga0207695_101012283 202
348 3300025913 Ga0207695_10226385 Ga0207695_102263852 202
349 3300025915 Ga0207693_10008486 Ga0207693_100084864 202
350 3300025915 Ga0207693_10403275 Ga0207693_104032752 202
351 3300025917 Ga0207660_10070641 Ga0207660_100706413 202
352 3300025918 Ga0207662_10082374 Ga0207662_100823742 202
353 3300025918 Ga0207662_10082931 Ga0207662_100829313 202
354 3300025918 Ga0207662_10172906 Ga0207662_101729062 202
355 3300025919 Ga0207657_10043092 Ga0207657_100430922 202
356 3300025919 Ga0207657_10171922 Ga0207657_101719222 202
357 3300025919 Ga0207657_10280084 Ga0207657_102800842 202
358 3300025920 Ga0207649_10000175 Ga0207649_1000017542 202
359 3300025920 Ga0207649_10030643 Ga0207649_100306434 202
360 3300025920 Ga0207649_10551305 Ga0207649_105513051 202
361 3300025921 Ga0207652_10102896 Ga0207652_101028963 202
362 3300025921 Ga0207652_10904975 Ga0207652_109049751 202
363 3300025923 Ga0207681_10141331 Ga0207681_101413312 202
364 3300025924 Ga0207694_10350231 Ga0207694_103502312 202
365 3300025924 Ga0207694_10433331 Ga0207694_104333312 202
366 3300025926 Ga0207659_10091162 Ga0207659_100911622 202
367 3300025926 Ga0207659_10546539 Ga0207659_105465392 202
368 3300025927 Ga0207687_10012644 Ga0207687_100126444 202
369 3300025927 Ga0207687_10144860 Ga0207687_101448601 202
370 3300025928 Ga0207700_10215255 Ga0207700_102152552 202
371 3300025928 Ga0207700_10324434 Ga0207700_103244342 202
372 3300025931 Ga0207644_10012355 Ga0207644_100123553 202
373 3300025932 Ga0207690_10109465 Ga0207690_101094652 202
374 3300025933 Ga0207706_10001103 Ga0207706_100011036 202
375 3300025933 Ga0207706_10107628 Ga0207706_101076281 202
376 3300025933 Ga0207706_10767071 Ga0207706_107670711 202
377 3300025934 Ga0207686_10024854 Ga0207686_100248544 202
378 3300025935 Ga0207709_10038896 Ga0207709_100388964 202
379 3300025935 Ga0207709_10371222 Ga0207709_103712221 202
380 3300025936 Ga0207670_10034012 Ga0207670_100340124 202
381 3300025936 Ga0207670_10264696 Ga0207670_102646962 202
382 3300025936 Ga0207670_10328578 Ga0207670_103285782 202
383 3300025936 Ga0207670_10620206 Ga0207670_106202061 202
384 3300025937 Ga0207669_10010624 Ga0207669_100106241 202
385 3300025937 Ga0207669_10057730 Ga0207669_100577303 202
386 3300025938 Ga0207704_10427489 Ga0207704_104274892 202
387 3300025940 Ga0207691_10001292 Ga0207691_1000129214 202
388 3300025940 Ga0207691_10001627 Ga0207691_100016274 202
389 3300025940 Ga0207691_10244410 Ga0207691_102444101 202
390 3300025941 Ga0207711_10044806 Ga0207711_100448062 202
391 3300025941 Ga0207711_10356880 Ga0207711_103568802 202
392 3300025942 Ga0207689_10003872 Ga0207689_100038728 202
393 3300025942 Ga0207689_10007002 Ga0207689_100070027 202
394 3300025942 Ga0207689_10387107 Ga0207689_103871072 202
395 3300025942 Ga0207689_10619325 Ga0207689_106193251 202
396 3300025944 Ga0207661_10021586 Ga0207661_100215865 202
397 3300025945 Ga0207679_10240879 Ga0207679_102408792 202
398 3300025945 Ga0207679_10299446 Ga0207679_102994462 202
399 3300025960 Ga0207651_10018327 Ga0207651_100183273 202
400 3300025960 Ga0207651_10031156 Ga0207651_100311562 202
401 3300025960 Ga0207651_10265777 Ga0207651_102657773 202
402 3300025960 Ga0207651_10601867 Ga0207651_106018672 202
403 3300025961 Ga0207712_10010489 Ga0207712_100104891 202
404 3300025961 Ga0207712_10053294 Ga0207712_100532942 202
405 3300025972 Ga0207668_10029820 Ga0207668_100298204 202
406 3300025981 Ga0207640_10017964 Ga0207640_100179642 202
407 3300025981 Ga0207640_10423110 Ga0207640_104231102 202
408 3300025981 Ga0207640_10437322 Ga0207640_104373222 202
409 3300025986 Ga0207658_10112977 Ga0207658_101129772 202
410 3300025986 Ga0207658_11079153 Ga0207658_110791531 202
411 3300026023 Ga0207677_10141797 Ga0207677_101417973 202
412 3300026023 Ga0207677_10322733 Ga0207677_103227332 202
413 3300026023 Ga0207677_10423514 Ga0207677_104235142 202
414 3300026035 Ga0207703_10035780 Ga0207703_100357802 202
415 3300026035 Ga0207703_10116313 Ga0207703_101163133 202
416 3300026035 Ga0207703_10392422 Ga0207703_103924221 202
417 3300026035 Ga0207703_10658090 Ga0207703_106580902 202
418 3300026041 Ga0207639_10050588 Ga0207639_100505883 202
419 3300026041 Ga0207639_10254316 Ga0207639_102543162 202
420 3300026041 Ga0207639_10417333 Ga0207639_104173332 202
421 3300026041 Ga0207639_10535874 Ga0207639_105358741 202
422 3300026067 Ga0207678_10006265 Ga0207678_100062654 202
423 3300026075 Ga0207708_10000620 Ga0207708_100006207 202
424 3300026078 Ga0207702_10255077 Ga0207702_102550773 202
425 3300026078 Ga0207702_10558471 Ga0207702_105584712 202
426 3300026088 Ga0207641_10115840 Ga0207641_101158402 202
427 3300026088 Ga0207641_10438611 Ga0207641_104386111 202
428 3300026089 Ga0207648_10002122 Ga0207648_1000212217 202
429 3300026089 Ga0207648_10010029 Ga0207648_100100295 202
430 3300026089 Ga0207648_10027675 Ga0207648_100276754 202
431 3300026089 Ga0207648_10049679 Ga0207648_100496791 202
432 3300026089 Ga0207648_10988665 Ga0207648_109886651 202
433 3300026095 Ga0207676_10053395 Ga0207676_100533953 202
434 3300026095 Ga0207676_11168283 Ga0207676_111682832 202
435 3300026116 Ga0207674_10034599 Ga0207674_100345995 202
436 3300026116 Ga0207674_10122408 Ga0207674_101224082 202
437 3300026116 Ga0207674_10197966 Ga0207674_101979662 202
438 3300026116 Ga0207674_10396984 Ga0207674_103969841 202
439 3300026118 Ga0207675_100002342 Ga0207675_1000023424 202
440 3300026118 Ga0207675_100479267 Ga0207675_1004792671 202
441 3300026118 Ga0207675_100834633 Ga0207675_1008346331 202
442 3300026118 Ga0207675_100953798 Ga0207675_1009537981 202
443 3300026121 Ga0207683_10001466 Ga0207683_1000146615 202
444 3300026121 Ga0207683_10019897 Ga0207683_100198972 202
445 3300026121 Ga0207683_10027226 Ga0207683_100272264 202
446 3300026142 Ga0207698_10030872 Ga0207698_100308724 202
447 3300027907 Ga0207428_10059653 Ga0207428_100596533 202
448 3300027907 Ga0207428_10593217 Ga0207428_105932171 202
449 3300028379 Ga0268266_10030897 Ga0268266_100308972 202
450 3300028379 Ga0268266_10060428 Ga0268266_100604283 202
451 3300028379 Ga0268266_10085736 Ga0268266_100857363 202
452 3300028379 Ga0268266_10096077 Ga0268266_100960772 202
453 3300028379 Ga0268266_10190657 Ga0268266_101906572 202
454 3300028380 Ga0268265_10113362 Ga0268265_101133622 202
455 3300028380 Ga0268265_10698879 Ga0268265_106988792 202
456 3300028381 Ga0268264_10010088 Ga0268264_100100884 202
457 3300028381 Ga0268264_10273338 Ga0268264_102733382 202
458 3300031241 Ga0265325_10005662 Ga0265325_100056623 202
459 3300031247 Ga0265340_10020750 Ga0265340_100207502 202
460 3300031250 Ga0265331_10000006 Ga0265331_10000006179 202
461 3300031250 Ga0265331_10002206 Ga0265331_100022066 202
462 3300031251 Ga0265327_10000052 Ga0265327_10000052173 202
463 3300031344 Ga0265316_10164396 Ga0265316_101643963 202
464 3300031344 Ga0265316_10389836 Ga0265316_103898361 202
465 3300031616 Ga0307508_10122717 Ga0307508_101227172 202
466 3300031711 Ga0265314_10033657 Ga0265314_100336572 202
467 3300031711 Ga0265314_10037316 Ga0265314_100373164 202
468 3300031711 Ga0265314_10060762 Ga0265314_100607623 202
469 3300031730 Ga0307516_10065689 Ga0307516_100656895 202
470 3300031730 Ga0307516_10309005 Ga0307516_103090052 202
471 3300035086 Ga0373934_0111171 Ga0373934_0111171_145_753 202
472 3300035092 Ga0373952_0076400 Ga0373952_0076400_21_704 202
473 3300035113 Ga0373936_0061946 Ga0373936_0061946_900_1508 202
474 3300035113 Ga0373936_0070730 Ga0373936_0070730_567_1175 202
475 3300035116 Ga0373945_0008188 Ga0373945_0008188_1531_2139 202
476 3300035117 Ga0373953_0094553 Ga0373953_0094553_21_629 202
477 3300035118 Ga0373954_0328388 Ga0373954_0328388_20_628 202
478 3300035170 Ga0373943_0020649 Ga0373943_0020649_2008_2616 202
479 3300035170 Ga0373943_0083043 Ga0373943_0083043_209_817 202
480 3300035172 Ga0373955_0009688 Ga0373955_0009688_547_1155 202
481 3300035172 Ga0373955_0115161 Ga0373955_0115161_44_772 202
482 3300035410 Ga0373924_0196336 Ga0373924_0196336_123_731 202
483 3300035692 Ga0373935_0080626 Ga0373935_0080626_837_1445 202
484 3300035692 Ga0373935_0107535 Ga0373935_0107535_890_1498 202
485 3300035695 Ga0373927_0101168 Ga0373927_0101168_10_618 202
486 3300035695 Ga0373927_0150214 Ga0373927_0150214_602_1210 202
487 3300035695 Ga0373927_0381062 Ga0373927_0381062_282_890 202
488 3300035725 Ga0373947_0118568 Ga0373947_0118568_223_831 202
489 3300036401 Ga0373937_0000808 Ga0373937_0000808_20178_20786 202
490 3300037068 Ga0373925_0075547 Ga0373925_0075547_530_1138 202
491 3300037466 Ga0395898_0046313 Ga0395898_0046313_2397_3080 202
492 3300038443 Ga0395901_0009330 Ga0395901_0009330_7566_8249 202
493 3300039438 Ga0436360_0786743 Ga0436360_0786743_1196_1804 202
494 3300039447 Ga0436361_0402180 Ga0436361_0402180_2632_3240 202
495 3300044694 Ga0466963_0101694 Ga0466963_0101694_928_1575 202
496 3300046455 Ga0495603_0025190 Ga0495603_0025190_2016_2624 202
497 3300046455 Ga0495603_0281545 Ga0495603_0281545_312_920 202
498 3300046460 Ga0495638_0017859 Ga0495638_0017859_2638_3252 202
499 3300046473 Ga0495582_0039945 Ga0495582_0039945_1312_1920 202
500 3300046474 Ga0495605_0026817 Ga0495605_0026817_88_702 202
501 3300046474 Ga0495605_0041262 Ga0495605_0041262_292_900 202
502 3300046474 Ga0495605_0192347 Ga0495605_0192347_60_743 202
503 3300046491 Ga0495584_0368425 Ga0495584_0368425_32_715 202
504 3300046492 Ga0495585_0038603 Ga0495585_0038603_1534_2142 202
505 3300046492 Ga0495585_0057456 Ga0495585_0057456_1431_2114 202
506 3300046499 Ga0495594_0114706 Ga0495594_0114706_722_1330 202
507 3300046500 Ga0495596_0088368 Ga0495596_0088368_199_807 202
508 3300046501 Ga0495607_0053639 Ga0495607_0053639_869_1477 202
509 3300046501 Ga0495607_0138720 Ga0495607_0138720_401_1084 202
510 3300046511 Ga0495608_0320943 Ga0495608_0320943_51_734 202
511 3300046516 Ga0495628_0417019 Ga0495628_0417019_301_909 202
512 3300046516 Ga0495628_0625119 Ga0495628_0625119_38_646 202
513 3300046523 Ga0495644_0059861 Ga0495644_0059861_218_901 202
514 3300046524 Ga0495648_0170503 Ga0495648_0170503_55_738 202
515 3300046525 Ga0495663_0005060 Ga0495663_0005060_380_988 202
516 3300046525 Ga0495663_0112773 Ga0495663_0112773_18_626 202
517 3300046530 Ga0495654_0045497 Ga0495654_0045497_32_715 202
518 3300046533 Ga0495640_0066787 Ga0495640_0066787_556_1164 202
519 3300046533 Ga0495640_0321109 Ga0495640_0321109_121_729 202
520 3300046538 Ga0495609_0072852 Ga0495609_0072852_390_998 202
521 3300046539 Ga0495621_0034236 Ga0495621_0034236_239_853 202
522 3300046539 Ga0495621_0057120 Ga0495621_0057120_622_1305 202
523 3300046558 Ga0495633_0200147 Ga0495633_0200147_49_732 202
524 3300046559 Ga0495667_0220698 Ga0495667_0220698_77_691 202
525 3300046615 Ga0495656_0028459 Ga0495656_0028459_63_677 202
526 3300046615 Ga0495656_0085517 Ga0495656_0085517_150_758 202
527 3300046616 Ga0495668_0056659 Ga0495668_0056659_1297_1980 202
528 3300046642 Ga0495634_0063089 Ga0495634_0063089_171_779 202
529 3300046664 Ga0495659_0060026 Ga0495659_0060026_261_869 202
530 3300046664 Ga0495659_0259433 Ga0495659_0259433_61_669 202
531 3300046665 Ga0495661_0054985 Ga0495661_0054985_1112_1720 202
532 3300046674 Ga0495588_0124324 Ga0495588_0124324_31_645 202
533 3300046681 Ga0495647_0123894 Ga0495647_0123894_421_1029 202
534 3300046683 Ga0495658_0008659 Ga0495658_0008659_1998_2606 202
535 3300046683 Ga0495658_0132021 Ga0495658_0132021_489_1097 202
536 3300046684 Ga0495669_0030683 Ga0495669_0030683_346_1029 202
537 3300046689 Ga0495613_0125834 Ga0495613_0125834_523_1131 202
538 3300046690 Ga0495624_0331798 Ga0495624_0331798_68_676 202
539 3300046691 Ga0495670_0019806 Ga0495670_0019806_16_624 202
540 3300046692 Ga0495671_0202001 Ga0495671_0202001_185_928 202
541 3300046694 Ga0495649_0115228 Ga0495649_0115228_123_806 202
542 3300047321 Ga0495676_0031293 Ga0495676_0031293_2557_3165 202
543 3300047321 Ga0495676_0418903 Ga0495676_0418903_86_694 202
544 3300047446 Ga0495679_009202 Ga0495679_009202_48_656 202
545 3300047447 Ga0495685_084819 Ga0495685_084819_32_715 202
546 3300047471 Ga0495684_0163033 Ga0495684_0163033_819_1427 202
547 3300048088 Ga0495602_0351830 Ga0495602_0351830_146_829 202
548 3300048089 Ga0495614_0308871 Ga0495614_0308871_58_666 202
549 3300048090 Ga0495615_0009836 Ga0495615_0009836_991_1605 202
550 3300048903 Ga0496100_0052828 Ga0496100_0052828_980_1663 202
551 3300048903 Ga0496100_0112909 Ga0496100_0112909_348_956 202
552 3300048903 Ga0496100_0212877 Ga0496100_0212877_56_664 202
553 3300048904 Ga0496101_0006039 Ga0496101_0006039_5729_6337 202
554 3300048904 Ga0496101_0022942 Ga0496101_0022942_661_1344 202
555 3300048904 Ga0496101_0213854 Ga0496101_0213854_250_858 202
556 3300048905 Ga0496102_0030424 Ga0496102_0030424_1268_1876 202
557 3300048905 Ga0496102_0038590 Ga0496102_0038590_2562_3245 202
558 3300048906 Ga0496103_0007690 Ga0496103_0007690_697_1380 202
559 3300048906 Ga0496103_0207773 Ga0496103_0207773_615_1223 202
560 3300048907 Ga0496104_0000671 Ga0496104_0000671_26349_26957 202
561 3300048907 Ga0496104_0013106 Ga0496104_0013106_6739_7347 202
562 3300048907 Ga0496104_0014367 Ga0496104_0014367_5127_5735 202
563 3300048907 Ga0496104_0175951 Ga0496104_0175951_1090_1698 202
564 3300048907 Ga0496104_0184912 Ga0496104_0184912_730_1413 202
565 3300048908 Ga0496105_0009471 Ga0496105_0009471_6800_7408 202
566 3300048908 Ga0496105_0010252 Ga0496105_0010252_1382_2065 202
567 3300048908 Ga0496105_0263459 Ga0496105_0263459_534_1142 202
568 3300048909 Ga0496106_0003496 Ga0496106_0003496_10190_10798 202
569 3300048909 Ga0496106_0006990 Ga0496106_0006990_7099_7782 202
570 3300048909 Ga0496106_0173641 Ga0496106_0173641_629_1237 202
571 3300048910 Ga0496107_0016347 Ga0496107_0016347_4475_5158 202
572 3300048910 Ga0496107_0016379 Ga0496107_0016379_4512_5120 202
573 3300048911 Ga0496108_0000347 Ga0496108_0000347_18202_18810 202
574 3300048911 Ga0496108_0001531 Ga0496108_0001531_12206_12814 202
575 3300048911 Ga0496108_0009690 Ga0496108_0009690_5239_5847 202
576 3300048911 Ga0496108_0049755 Ga0496108_0049755_1067_1750 202
577 3300048912 Ga0496109_0004728 Ga0496109_0004728_1463_2071 202
578 3300048912 Ga0496109_0008070 Ga0496109_0008070_1260_1868 202
579 3300048912 Ga0496109_0039283 Ga0496109_0039283_2286_2894 202
580 3300048912 Ga0496109_0109428 Ga0496109_0109428_819_1502 202
581 3300048912 Ga0496109_0413601 Ga0496109_0413601_119_727 202
582 3300048913 Ga0496110_0000339 Ga0496110_0000339_22375_22983 202
583 3300048913 Ga0496110_0001978 Ga0496110_0001978_5941_6549 202
584 3300048913 Ga0496110_0019355 Ga0496110_0019355_2557_3240 202
585 3300048913 Ga0496110_0057939 Ga0496110_0057939_488_1096 202
586 3300048913 Ga0496110_0102781 Ga0496110_0102781_866_1474 202
587 3300048913 Ga0496110_0264651 Ga0496110_0264651_724_1332 202
588 3300048913 Ga0496110_1188369 Ga0496110_1188369_13_621 202
589 3300048914 Ga0496111_0001676 Ga0496111_0001676_11138_11746 202
590 3300048914 Ga0496111_0012805 Ga0496111_0012805_2812_3495 202
591 3300048914 Ga0496111_0016270 Ga0496111_0016270_1464_2072 202
592 3300048914 Ga0496111_0082411 Ga0496111_0082411_1359_1967 202
593 3300048915 Ga0496112_0001338 Ga0496112_0001338_12208_12816 202
594 3300048915 Ga0496112_0004698 Ga0496112_0004698_10279_10887 202
595 3300048915 Ga0496112_0011100 Ga0496112_0011100_3211_3819 202
596 3300048915 Ga0496112_0129944 Ga0496112_0129944_964_1572 202
597 3300048915 Ga0496112_0165213 Ga0496112_0165213_819_1502 202
598 3300048915 Ga0496112_0467015 Ga0496112_0467015_560_1168 202
599 3300048916 Ga0496113_0000331 Ga0496113_0000331_7190_7798 202
600 3300048916 Ga0496113_0008812 Ga0496113_0008812_3183_3866 202
601 3300048916 Ga0496113_0144162 Ga0496113_0144162_1188_1796 202
602 3300048917 Ga0496114_0030874 Ga0496114_0030874_2779_3462 202
603 3300048917 Ga0496114_0333346 Ga0496114_0333346_222_830 202
604 3300048917 Ga0496114_0892541 Ga0496114_0892541_52_660 202
605 3300048918 Ga0496115_0036354 Ga0496115_0036354_569_1177 202
606 3300048918 Ga0496115_0047038 Ga0496115_0047038_1885_2493 202
607 3300048918 Ga0496115_0103894 Ga0496115_0103894_1067_1750 202
608 3300048918 Ga0496115_0273950 Ga0496115_0273950_444_1052 202
609 3300048924 Ga0496121_0000913 Ga0496121_0000913_13972_14655 202
610 3300048929 Ga0496126_0216097 Ga0496126_0216097_529_1212 202
611 3300049570 Ga0501033_0025950 Ga0501033_0025950_1882_2565 202
612 3300049570 Ga0501033_0086795 Ga0501033_0086795_223_906 202
613 3300049570 Ga0501033_0276946 Ga0501033_0276946_48_731 202
614 3300049570 Ga0501033_0737133 Ga0501033_0737133_29_637 202
615 3300049571 Ga0501034_0015949 Ga0501034_0015949_6454_7137 202
616 3300049572 Ga0501036_0036722 Ga0501036_0036722_1202_1885 202
617 3300049573 Ga0501037_0007536 Ga0501037_0007536_3441_4124 202
618 3300049573 Ga0501037_0128768 Ga0501037_0128768_700_1383 202
619 3300049574 Ga0501038_0095310 Ga0501038_0095310_314_997 202
620 3300049579 Ga0501043_0058645 Ga0501043_0058645_2317_3000 202
621 3300049580 Ga0501046_0021675 Ga0501046_0021675_2869_3552 202
622 3300049580 Ga0501046_0082042 Ga0501046_0082042_1673_2356 202
623 3300049581 Ga0501047_0006741 Ga0501047_0006741_3536_4219 202
624 3300049581 Ga0501047_0015028 Ga0501047_0015028_5411_6094 202
625 3300049581 Ga0501047_0090486 Ga0501047_0090486_698_1381 202
626 3300049581 Ga0501047_0156437 Ga0501047_0156437_251_934 202
627 3300049581 Ga0501047_0547428 Ga0501047_0547428_266_949 202
628 3300049582 Ga0501048_0162337 Ga0501048_0162337_144_758 202
629 3300049584 Ga0501068_0017115 Ga0501068_0017115_828_1511 202
630 3300049585 Ga0501069_0187862 Ga0501069_0187862_137_820 202
631 3300049586 Ga0501070_0131921 Ga0501070_0131921_682_1365 202
632 3300049588 Ga0501072_0392977 Ga0501072_0392977_409_1017 202
633 3300049589 Ga0501073_0026353 Ga0501073_0026353_2003_2686 202
634 3300049589 Ga0501073_0126980 Ga0501073_0126980_749_1432 202
635 3300049589 Ga0501073_0237454 Ga0501073_0237454_481_1164 202
636 3300049589 Ga0501073_0465259 Ga0501073_0465259_245_853 202
637 3300049590 Ga0501074_0088247 Ga0501074_0088247_474_1157 202
638 3300049591 Ga0501075_0399341 Ga0501075_0399341_325_939 202
639 3300049592 Ga0501076_0435345 Ga0501076_0435345_166_774 202
640 3300049744 Ga0501083_0050476 Ga0501083_0050476_1545_2228 202
641 3300049744 Ga0501083_0143271 Ga0501083_0143271_163_771 202
642 3300049744 Ga0501083_0345837 Ga0501083_0345837_142_750 202
643 3300049822 Ga0501035_0005667 Ga0501035_0005667_10431_11114 202
644 3300049822 Ga0501035_0047019 Ga0501035_0047019_2563_3246 202
645 3300049822 Ga0501035_0107410 Ga0501035_0107410_628_1311 202
646 3300049823 Ga0501044_0001467 Ga0501044_0001467_5466_6149 202
647 3300049823 Ga0501044_0448684 Ga0501044_0448684_123_809 202
648 3300049824 Ga0501045_0177915 Ga0501045_0177915_280_888 202
649 3300050492 nmdc:mga0yw44_49284_c1 nmdc:mga0yw44_49284_c1_1656_2264 202
650 3300050494 nmdc:mga06z11_110086_c1 nmdc:mga06z11_110086_c1_801_1484 202
651 3300050494 nmdc:mga06z11_367188_c1 nmdc:mga06z11_367188_c1_130_741 202
652 3300050495 nmdc:mga04h51_205716_c1 nmdc:mga04h51_205716_c1_125_736 202
653 3300050496 nmdc:mga07m45_81351_c1 nmdc:mga07m45_81351_c1_423_1106 202
654 3300050507 nmdc:mga05p37_136974_c1 nmdc:mga05p37_136974_c1_651_1259 202
655 3300050507 nmdc:mga05p37_17333_c1 nmdc:mga05p37_17333_c1_4740_5348 202
656 3300050507 nmdc:mga05p37_46172_c1 nmdc:mga05p37_46172_c1_2809_3417 202
657 3300050507 nmdc:mga05p37_532395_c1 nmdc:mga05p37_532395_c1_36_698 202
658 3300050508 nmdc:mga09592_502414_c1 nmdc:mga09592_502414_c1_312_920 202
659 3300050508 nmdc:mga09592_727214_c1 nmdc:mga09592_727214_c1_37_651 202
660 3300050509 nmdc:mga0qj67_345665_c1 nmdc:mga0qj67_345665_c1_65_679 202
661 3300050510 nmdc:mga06r32_108563_c1 nmdc:mga06r32_108563_c1_1404_2018 202
662 3300050510 nmdc:mga06r32_1264791_c1 nmdc:mga06r32_1264791_c1_58_666 202
663 3300050510 nmdc:mga06r32_1271946_c1 nmdc:mga06r32_1271946_c1_40_648 202
664 3300050510 nmdc:mga06r32_48157_c1 nmdc:mga06r32_48157_c1_1756_2364 202
665 3300050510 nmdc:mga06r32_487534_c1 nmdc:mga06r32_487534_c1_381_989 202
666 3300050511 nmdc:mga08y16_39967_c1 nmdc:mga08y16_39967_c1_3391_4008 202
667 3300050511 nmdc:mga08y16_87901_c1 nmdc:mga08y16_87901_c1_2471_3154 202
668 3300050511 nmdc:mga08y16_97049_c1 nmdc:mga08y16_97049_c1_1501_2109 202
669 3300050512 nmdc:mga0n895_1105057_c1 nmdc:mga0n895_1105057_c1_83_691 202
670 3300050512 nmdc:mga0n895_215953_c2 nmdc:mga0n895_215953_c2_295_903 202
671 3300050513 nmdc:mga0rr50_738155_c1 nmdc:mga0rr50_738155_c1_96_704 202
672 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_147339_147950 202
673 3300050514 nmdc:mga08x19_338883_c1 nmdc:mga08x19_338883_c1_154_762 202
674 3300050515 nmdc:mga0a205_261691_c1 nmdc:mga0a205_261691_c1_875_1492 202
675 3300053077 Ga0495601_0035347 Ga0495601_0035347_2330_3013 202
676 3300053083 Ga0495655_0000668 Ga0495655_0000668_4389_4997 202
677 3300053085 Ga0495619_0009907 Ga0495619_0009907_4080_4688 202
678 3300053085 Ga0495619_0065055 Ga0495619_0065055_880_1488 202
679 3300053085 Ga0495619_0098107 Ga0495619_0098107_327_1010 202
680 3300053087 Ga0500643_074680 Ga0500643_074680_63_860 202
681 3300053090 Ga0500646_0060895 Ga0500646_0060895_78_692 202
682 3300053096 Ga0500641_0018330 Ga0500641_0018330_1435_2049 202
683 3300053119 Ga0500595_016745 Ga0500595_016745_911_1594 202
684 3300053139 Ga0500568_0025794 Ga0500568_0025794_181_864 202
685 3300053139 Ga0500568_0071634 Ga0500568_0071634_261_872 202
686 3300053140 Ga0500573_0000008 Ga0500573_0000008_18068_18751 202
687 3300053142 Ga0500577_0106815 Ga0500577_0106815_487_1101 202
688 3300053163 Ga0500639_036474 Ga0500639_036474_228_911 202
689 3300054114 Ga0501084_0020727 Ga0501084_0020727_1695_2462 202
690 3300060353 Ga0501082_0063296 Ga0501082_0063296_274_957 202
691 3300060353 Ga0501082_0318909 Ga0501082_0318909_716_1324 202
692 3300061734 Ga0530510_0264563 Ga0530510_0264563_95_703 202
693 3300061734 Ga0530510_0625729 Ga0530510_0625729_191_805 202

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8666 1 201
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8233 1 201
3ptj-assembly1.cif.gz_A structural and functional analysis of arabidopsis thaliana thylakoid lumen protein attlp18.3 0.7657 2 188
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.7489 1 185
7e1v-assembly1.cif.gz_J cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.7415 2 181
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8666 1 201 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8233 1 201 3.10.310.50
af_P55140_17_164_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8164 2 188 3.10.310.50
3ptjA00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7691 2 188 3.10.310.50
af_P9WLA7_26_161_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.7454 2 176 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A3A9VYL9-F1-model_v4 Uncharacterized protein 0.9284 120 182
AF-F8JGA9-F1-model_v4 TPM domain-containing protein 0.9237 2 202 GO:0016020
AF-F8JGA9-F1-model_v4 TPM domain-containing protein 0.915 2 202 GO:0016020
AF-A0A0B0Q7C9-F1-model_v4 TPM domain-containing protein 0.9098 1 202 GO:0016020
AF-A0A1M3NQU2-F1-model_v4 TPM domain-containing protein 0.9087 1 202 GO:0016020

Feature Viewer

pLDDT pTM Quality
76.17 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map