F475605

General Info

Members Datasets Scaffolds Average Seq Length
692 286 1384 131

Family's Representative Sequence

Representative Sequence 3300047315|Ga0495581_0529819|Ga0495581_0529819_152_511
Length 119
Sequence MTKSSTHTTLSRRERQIMDVLYRRGRAIAADVMAELPGEPNYKGHVRHEEEGGRYVYAPAVPRHAARKSALKHLVETFFDGSAEQVVAAVLGGEASRLSDEDLERISGLIDKARKDGSR

Samples

Sample ID Description Type Environment
1 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 1.88
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 30.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495581_0529819 3300047315 Bacteria 684
2 JGI24749J21850_1027405 3300002076 Bacteria 813
3 JGI25406J46586_10001877 3300003203 Bacteria 9875
4 Ga0065712_10011019 3300005290 Bacteria 2889
5 Ga0065715_10647077 3300005293 Unclassified 680
6 Ga0065707_10037617 3300005295 Bacteria 1378
7 Ga0065707_10087131 3300005295 Bacteria 5137
8 Ga0070676_10080082 3300005328 Unclassified 1979
9 Ga0070676_10278467 3300005328 Unclassified 1126
10 Ga0070676_10295884 3300005328 Bacteria 1096
11 Ga0070676_10948899 3300005328 Unclassified 643
12 Ga0070683_100933070 3300005329 Unclassified 833
13 Ga0070690_100006239 3300005330 Bacteria 6764
14 Ga0070690_101306213 3300005330 Unclassified 581
15 Ga0070670_100047733 3300005331 Bacteria 3685
16 Ga0070670_100498057 3300005331 Unclassified 1083
17 Ga0070670_100642463 3300005331 Unclassified 952
18 Ga0070670_101538400 3300005331 Unclassified 611
19 Ga0070677_10005391 3300005333 Bacteria 4211
20 Ga0070677_10060878 3300005333 Unclassified 1557
21 Ga0070677_10133203 3300005333 Bacteria 1137
22 Ga0070677_10317139 3300005333 Unclassified 797
23 Ga0068869_100014923 3300005334 Bacteria 5194
24 Ga0068869_100021682 3300005334 Bacteria 4421
25 Ga0068869_100047647 3300005334 Bacteria 3096
26 Ga0070666_10086334 3300005335 Bacteria 2150
27 Ga0070666_10356900 3300005335 Bacteria 1047
28 Ga0070666_10688440 3300005335 Bacteria 749
29 Ga0070666_10834804 3300005335 Unclassified 680
30 Ga0070680_100074435 3300005336 Unclassified 2794
31 Ga0070682_101159706 3300005337 Bacteria 650
32 Ga0068868_100072354 3300005338 Unclassified 2751
33 Ga0068868_100146867 3300005338 Unclassified 1939
34 Ga0070660_100011473 3300005339 Bacteria 6298
35 Ga0070689_100018439 3300005340 Bacteria 5141
36 Ga0070689_100050709 3300005340 Bacteria 3207
37 Ga0070689_100139028 3300005340 Bacteria 1952
38 Ga0070689_100716880 3300005340 Unclassified 874
39 Ga0070661_100016901 3300005344 Bacteria 5165
40 Ga0070661_100018034 3300005344 Bacteria 5015
41 Ga0070661_101041496 3300005344 Unclassified 680
42 Ga0070692_10796454 3300005345 Bacteria 645
43 Ga0070668_100650695 3300005347 Unclassified 926
44 Ga0070668_102010298 3300005347 Bacteria 533
45 Ga0070669_100051468 3300005353 Bacteria 3010
46 Ga0070669_100240763 3300005353 Bacteria 1437
47 Ga0070669_101108482 3300005353 Unclassified 682
48 Ga0070675_100000107 3300005354 Bacteria 48865
49 Ga0070675_100000193 3300005354 Bacteria 38339
50 Ga0070675_100019586 3300005354 Bacteria 5394
51 Ga0070675_100053387 3300005354 Unclassified 3324
52 Ga0070675_100121849 3300005354 Bacteria 2216
53 Ga0070675_100132602 3300005354 Bacteria 2124
54 Ga0070675_100133300 3300005354 Bacteria 2119
55 Ga0070675_100185626 3300005354 Bacteria 1799
56 Ga0070675_100252066 3300005354 Unclassified 1545
57 Ga0070675_100623763 3300005354 Unclassified 979
58 Ga0070675_100767811 3300005354 Bacteria 880
59 Ga0070671_100022507 3300005355 Bacteria 5146
60 Ga0070671_100088895 3300005355 Bacteria 2586
61 Ga0070671_100750789 3300005355 Unclassified 848
62 Ga0070671_100954950 3300005355 Bacteria 750
63 Ga0070674_100001260 3300005356 Bacteria 13307
64 Ga0070674_100027170 3300005356 Bacteria 3747
65 Ga0070674_100179539 3300005356 Unclassified 1620
66 Ga0070674_100285890 3300005356 Bacteria 1309
67 Ga0070674_100743762 3300005356 Unclassified 842
68 Ga0070674_101877689 3300005356 Unclassified 544
69 Ga0070673_100034896 3300005364 Bacteria 3811
70 Ga0070673_100049478 3300005364 Bacteria 3282
71 Ga0070673_100058374 3300005364 Bacteria 3051
72 Ga0070673_100130882 3300005364 Bacteria 2105
73 Ga0070673_100170280 3300005364 Unclassified 1858
74 Ga0070688_100377455 3300005365 Bacteria 1044
75 Ga0070688_100679154 3300005365 Unclassified 796
76 Ga0070688_101567324 3300005365 Bacteria 537
77 Ga0070659_100132575 3300005366 Unclassified 2024
78 Ga0070659_100171155 3300005366 Bacteria 1779
79 Ga0070659_100214158 3300005366 Bacteria 1588
80 Ga0070659_100313139 3300005366 Bacteria 1311
81 Ga0070659_101008023 3300005366 Bacteria 731
82 Ga0070667_100178096 3300005367 Unclassified 1879
83 Ga0070667_100185181 3300005367 Unclassified 1842
84 Ga0070667_100244639 3300005367 Bacteria 1603
85 Ga0070667_100456383 3300005367 Bacteria 1168
86 Ga0070667_100462003 3300005367 Bacteria 1161
87 Ga0070709_10365065 3300005434 Unclassified 1070
88 Ga0070705_100418671 3300005440 Bacteria 997
89 Ga0070705_100841558 3300005440 Unclassified 733
90 Ga0070700_100932241 3300005441 Unclassified 709
91 Ga0070700_100956549 3300005441 Bacteria 701
92 Ga0070700_101897668 3300005441 Bacteria 515
93 Ga0070694_100512272 3300005444 Bacteria 956
94 Ga0070694_100573197 3300005444 Unclassified 906
95 Ga0070694_101472119 3300005444 Unclassified 576
96 Ga0070694_101488194 3300005444 Unclassified 573
97 Ga0070708_100152042 3300005445 Bacteria 2153
98 Ga0070708_100457719 3300005445 Bacteria 1204
99 Ga0070708_101327413 3300005445 Bacteria 672
100 Ga0070663_100066516 3300005455 Bacteria 2611
101 Ga0070678_100009155 3300005456 Bacteria 5980
102 Ga0070678_100117351 3300005456 Unclassified 2093
103 Ga0070678_100330848 3300005456 Bacteria 1304
104 Ga0070678_100381384 3300005456 Bacteria 1220
105 Ga0070678_101427863 3300005456 Bacteria 647
106 Ga0070678_101440348 3300005456 Bacteria 644
107 Ga0070662_100048201 3300005457 Unclassified 3068
108 Ga0070662_100171859 3300005457 Bacteria 1702
109 Ga0070662_100260287 3300005457 Unclassified 1397
110 Ga0070662_100277827 3300005457 Bacteria 1355
111 Ga0070681_10056175 3300005458 Bacteria 3918
112 Ga0068867_100009442 3300005459 Bacteria 6878
113 Ga0068867_100442858 3300005459 Bacteria 1105
114 Ga0068867_100778871 3300005459 Unclassified 851
115 Ga0068867_100792181 3300005459 Bacteria 844
116 Ga0068867_100954691 3300005459 Unclassified 775
117 Ga0070685_10132567 3300005466 Unclassified 1560
118 Ga0070706_100296921 3300005467 Bacteria 1508
119 Ga0070707_100274130 3300005468 Bacteria 1640
120 Ga0070707_100867348 3300005468 Bacteria 867
121 Ga0070698_100040015 3300005471 Bacteria 4820
122 Ga0070698_102060673 3300005471 Unclassified 524
123 Ga0070699_100126883 3300005518 Bacteria 2247
124 Ga0070679_100039688 3300005530 Bacteria 4679
125 Ga0070684_100003808 3300005535 Bacteria 11401
126 Ga0070684_100887890 3300005535 Unclassified 835
127 Ga0070684_100963414 3300005535 Bacteria 800
128 Ga0070697_100216435 3300005536 Bacteria 1632
129 Ga0070697_100534178 3300005536 Bacteria 1027
130 Ga0068853_100450086 3300005539 Unclassified 1211
131 Ga0068853_102096157 3300005539 Unclassified 548
132 Ga0070672_100017016 3300005543 Bacteria 5221
133 Ga0070672_100141926 3300005543 Bacteria 1982
134 Ga0070672_100152116 3300005543 Unclassified 1915
135 Ga0070672_100643060 3300005543 Unclassified 926
136 Ga0070672_101007377 3300005543 Unclassified 738
137 Ga0070686_100004038 3300005544 Bacteria 8071
138 Ga0070686_100233734 3300005544 Bacteria 1335
139 Ga0070695_100688731 3300005545 Bacteria 810
140 Ga0070696_100347483 3300005546 Viruses 1148
141 Ga0070696_100355754 3300005546 Bacteria 1135
142 Ga0070696_100511438 3300005546 Unclassified 957
143 Ga0070696_100549451 3300005546 Bacteria 925
144 Ga0070696_101899810 3300005546 Unclassified 516
145 Ga0070696_101929535 3300005546 Unclassified 512
146 Ga0070665_100196198 3300005548 Unclassified 2020
147 Ga0070665_100313738 3300005548 Bacteria 1572
148 Ga0070665_100764982 3300005548 Unclassified 979
149 Ga0070665_102200515 3300005548 Bacteria 555
150 Ga0070704_100004623 3300005549 Bacteria 7965
151 Ga0070704_100954454 3300005549 Unclassified 774
152 Ga0070704_101689617 3300005549 Bacteria 585
153 Ga0068855_100012526 3300005563 Bacteria 10237
154 Ga0070664_100003576 3300005564 Bacteria 12546
155 Ga0070664_100107457 3300005564 Unclassified 2433
156 Ga0070664_100438053 3300005564 Unclassified 1198
157 Ga0070664_100529507 3300005564 Bacteria 1088
158 Ga0068857_100945793 3300005577 Bacteria 828
159 Ga0068857_101760565 3300005577 Unclassified 606
160 Ga0068854_100049749 3300005578 Unclassified 2996
161 Ga0070702_100165930 3300005615 Bacteria 1432
162 Ga0070702_100294335 3300005615 Bacteria 1120
163 Ga0070702_100323203 3300005615 Bacteria 1076
164 Ga0070702_100405614 3300005615 Unclassified 976
165 Ga0070702_100561729 3300005615 Unclassified 849
166 Ga0070702_100755618 3300005615 Bacteria 747
167 Ga0068852_100084975 3300005616 Unclassified 2818
168 Ga0068852_100380727 3300005616 Bacteria 1384
169 Ga0068859_100007749 3300005617 Bacteria 10900
170 Ga0068859_100120538 3300005617 Bacteria 2690
171 Ga0068859_100357767 3300005617 Unclassified 1555
172 Ga0068859_100453473 3300005617 Bacteria 1379
173 Ga0068859_102075001 3300005617 Bacteria 628
174 Ga0068864_100021678 3300005618 Bacteria 5381
175 Ga0068864_100157452 3300005618 Bacteria 2062
176 Ga0068864_100236331 3300005618 Unclassified 1692
177 Ga0068861_100463401 3300005719 Unclassified 1138
178 Ga0068861_100815834 3300005719 Unclassified 877
179 Ga0068870_10045775 3300005840 Bacteria 2292
180 Ga0068870_10078996 3300005840 Unclassified 1814
181 Ga0068870_11109988 3300005840 Unclassified 569
182 Ga0068863_100009062 3300005841 Bacteria 9716
183 Ga0068863_100367827 3300005841 Bacteria 1403
184 Ga0068858_100014541 3300005842 Bacteria 7415
185 Ga0068858_100051880 3300005842 Bacteria 3795
186 Ga0068858_100052631 3300005842 Bacteria 3767
187 Ga0068858_101230415 3300005842 Unclassified 736
188 Ga0068860_100019269 3300005843 Bacteria 6623
189 Ga0068860_100039019 3300005843 Bacteria 4543
190 Ga0068860_100103054 3300005843 Bacteria 2724
191 Ga0068860_100255975 3300005843 Bacteria 1705
192 Ga0068862_100409336 3300005844 Unclassified 1270
193 Ga0081539_10000056 3300005985 Bacteria 256522
194 Ga0075363_100352318 3300006048 Bacteria 860
195 Ga0075362_10180931 3300006177 Unclassified 1022
196 Ga0075367_10055839 3300006178 Unclassified 2345
197 Ga0075366_10136742 3300006195 Bacteria 1480
198 Ga0097621_100036402 3300006237 Bacteria 3938
199 Ga0097621_100081707 3300006237 Bacteria 2690
200 Ga0097621_100142642 3300006237 Bacteria 2048
201 Ga0097621_100753060 3300006237 Bacteria 900
202 Ga0097621_100865444 3300006237 Unclassified 840
203 Ga0097621_101995485 3300006237 Unclassified 554
204 Ga0068871_100117506 3300006358 Unclassified 2243
205 Ga0068871_100332427 3300006358 Bacteria 1340
206 Ga0068871_100486426 3300006358 Bacteria 1111
207 Ga0075428_100003026 3300006844 Bacteria 18353
208 Ga0075428_100149414 3300006844 Bacteria 2538
209 Ga0075428_100666418 3300006844 Unclassified 1109
210 Ga0075428_100772308 3300006844 Bacteria 1022
211 Ga0075428_101349215 3300006844 Unclassified 749
212 Ga0075430_100011515 3300006846 Bacteria 7518
213 Ga0075430_100016485 3300006846 Bacteria 6293
214 Ga0075430_100027098 3300006846 Bacteria 4871
215 Ga0075430_100036355 3300006846 Unclassified 4177
216 Ga0075430_100374234 3300006846 Bacteria 1176
217 Ga0075430_100801756 3300006846 Unclassified 776
218 Ga0075430_100904861 3300006846 Unclassified 727
219 Ga0075431_100000804 3300006847 Bacteria 27410
220 Ga0075431_100112182 3300006847 Unclassified 2814
221 Ga0075431_100158037 3300006847 Unclassified 2332
222 Ga0075431_100177343 3300006847 Bacteria 2188
223 Ga0075431_100746045 3300006847 Unclassified 955
224 Ga0075431_101154477 3300006847 Unclassified 738
225 Ga0075433_10030851 3300006852 Bacteria 4577
226 Ga0075433_10255874 3300006852 Bacteria 1553
227 Ga0075433_10283942 3300006852 Bacteria 1466
228 Ga0075433_10804833 3300006852 Bacteria 821
229 Ga0075434_100017800 3300006871 Bacteria 6853
230 Ga0075434_101265786 3300006871 Bacteria 749
231 Ga0075429_100007498 3300006880 Bacteria 9471
232 Ga0075429_100046351 3300006880 Bacteria 3782
233 Ga0075429_100213147 3300006880 Bacteria 1692
234 Ga0068865_100090794 3300006881 Bacteria 2215
235 Ga0075436_100116847 3300006914 Bacteria 1864
236 Ga0097620_100007749 3300006931 Bacteria 10900
237 Ga0097620_100120541 3300006931 Bacteria 2690
238 Ga0097620_100357735 3300006931 Unclassified 1555
239 Ga0097620_100453427 3300006931 Bacteria 1379
240 Ga0097620_102075005 3300006931 Bacteria 628
241 Ga0075435_100342547 3300007076 Unclassified 1281
242 Ga0105240_11467915 3300009093 Unclassified 716
243 Ga0111539_10000056 3300009094 Bacteria 114878
244 Ga0111539_10013747 3300009094 Bacteria 10113
245 Ga0111539_10131239 3300009094 Unclassified 2933
246 Ga0111539_10591288 3300009094 Bacteria 1292
247 Ga0111539_10627069 3300009094 Bacteria 1252
248 Ga0111539_10663193 3300009094 Bacteria 1215
249 Ga0111539_10814643 3300009094 Bacteria 1086
250 Ga0111539_10829274 3300009094 Bacteria 1076
251 Ga0111539_11040997 3300009094 Bacteria 951
252 Ga0111539_12618676 3300009094 Unclassified 585
253 Ga0105247_10164975 3300009101 Bacteria 1469
254 Ga0114129_10006522 3300009147 Bacteria 16559
255 Ga0114129_10010650 3300009147 Bacteria 13111
256 Ga0114129_10011051 3300009147 Bacteria 12860
257 Ga0114129_10017449 3300009147 Bacteria 10220
258 Ga0114129_10020920 3300009147 Bacteria 9295
259 Ga0114129_10044424 3300009147 Bacteria 6251
260 Ga0114129_10118725 3300009147 Bacteria 3643
261 Ga0114129_10143879 3300009147 Bacteria 3267
262 Ga0114129_10265291 3300009147 Bacteria 2299
263 Ga0114129_10288678 3300009147 Bacteria 2190
264 Ga0114129_10346166 3300009147 Bacteria 1970
265 Ga0114129_10880335 3300009147 Bacteria 1136
266 Ga0114129_11008401 3300009147 Bacteria 1048
267 Ga0114129_12032295 3300009147 Bacteria 694
268 Ga0114129_12871494 3300009147 Bacteria 571
269 Ga0114129_13183485 3300009147 Unclassified 534
270 Ga0105243_11169251 3300009148 Bacteria 781
271 Ga0105242_10292374 3300009176 Unclassified 1484
272 Ga0105242_10295764 3300009176 Bacteria 1476
273 Ga0105242_11193204 3300009176 Unclassified 780
274 Ga0105248_10006564 3300009177 Bacteria 12756
275 Ga0105248_10030221 3300009177 Bacteria 6048
276 Ga0105248_10083398 3300009177 Bacteria 3596
277 Ga0105248_10148322 3300009177 Bacteria 2646
278 Ga0105248_10249918 3300009177 Unclassified 1996
279 Ga0105248_10317981 3300009177 Bacteria 1753
280 Ga0105248_11864846 3300009177 Unclassified 682
281 Ga0105238_10136252 3300009551 Bacteria 2433
282 Ga0105249_10022648 3300009553 Bacteria 5629
283 Ga0105249_10660268 3300009553 Bacteria 1104
284 Ga0105246_10241939 3300011119 Unclassified 1427
285 Ga0105246_10585340 3300011119 Unclassified 962
286 Ga0105246_10606086 3300011119 Bacteria 947
287 Ga0105246_12101391 3300011119 Unclassified 547
288 Ga0157325_1023617 3300012485 Bacteria 568
289 Ga0157374_10048504 3300013296 Unclassified 3940
290 Ga0157374_10272313 3300013296 Unclassified 1670
291 Ga0157374_11197781 3300013296 Unclassified 781
292 Ga0157374_11933077 3300013296 Bacteria 616
293 Ga0157378_10129016 3300013297 Bacteria 2339
294 Ga0157378_10761429 3300013297 Bacteria 992
295 Ga0157378_11409869 3300013297 Unclassified 740
296 Ga0157378_12410317 3300013297 Unclassified 578
297 Ga0163162_10013149 3300013306 Bacteria 8082
298 Ga0163162_10082498 3300013306 Bacteria 3287
299 Ga0163162_11373494 3300013306 Unclassified 803
300 Ga0163162_11615031 3300013306 Bacteria 740
301 Ga0163162_12760163 3300013306 Bacteria 565
302 Ga0157375_10043371 3300013308 Unclassified 4362
303 Ga0157375_10113232 3300013308 Bacteria 2814
304 Ga0157375_10171740 3300013308 Unclassified 2316
305 Ga0157375_10182805 3300013308 Bacteria 2249
306 Ga0157375_10501414 3300013308 Bacteria 1378
307 Ga0157375_11094769 3300013308 Unclassified 933
308 Ga0157375_12425179 3300013308 Unclassified 626
309 Ga0163163_10302020 3300014325 Bacteria 1653
310 Ga0163163_11062607 3300014325 Unclassified 873
311 Ga0157380_10052513 3300014326 Bacteria 3228
312 Ga0157380_10091328 3300014326 Bacteria 2514
313 Ga0157380_10335656 3300014326 Bacteria 1408
314 Ga0157380_10458220 3300014326 Bacteria 1227
315 Ga0157380_11070473 3300014326 Bacteria 844
316 Ga0157380_11498466 3300014326 Unclassified 728
317 Ga0157380_11602051 3300014326 Bacteria 707
318 Ga0157377_10028734 3300014745 Bacteria 2995
319 Ga0157377_10052241 3300014745 Bacteria 2307
320 Ga0157377_10405424 3300014745 Unclassified 930
321 Ga0157377_10502348 3300014745 Unclassified 848
322 Ga0157377_10508999 3300014745 Unclassified 843
323 Ga0157377_11635910 3300014745 Unclassified 517
324 Ga0157379_10023491 3300014968 Bacteria 5473
325 Ga0157376_10042880 3300014969 Bacteria 3710
326 Ga0157376_10103296 3300014969 Unclassified 2495
327 Ga0157376_10440333 3300014969 Unclassified 1269
328 Ga0157376_10945802 3300014969 Bacteria 882
329 Ga0163161_10293050 3300017792 Unclassified 1279
330 Ga0163161_10845385 3300017792 Bacteria 772
331 Ga0163161_11040686 3300017792 Unclassified 701
332 Ga0213876_10083391 3300021384 Bacteria 1691
333 Ga0207697_10242877 3300025315 Unclassified 796
334 Ga0207682_10001041 3300025893 Bacteria 12793
335 Ga0207682_10010361 3300025893 Bacteria 3653
336 Ga0207682_10057354 3300025893 Bacteria 1623
337 Ga0207682_10120094 3300025893 Bacteria 1165
338 Ga0207642_10063485 3300025899 Bacteria 1728
339 Ga0207710_10643552 3300025900 Unclassified 555
340 Ga0207688_10028330 3300025901 Bacteria 3081
341 Ga0207688_10274605 3300025901 Unclassified 1026
342 Ga0207680_10251383 3300025903 Bacteria 1221
343 Ga0207680_10430075 3300025903 Unclassified 935
344 Ga0207680_10946072 3300025903 Bacteria 617
345 Ga0207699_10319325 3300025906 Unclassified 1089
346 Ga0207645_10001335 3300025907 Bacteria 20268
347 Ga0207645_10068974 3300025907 Bacteria 2262
348 Ga0207645_10279685 3300025907 Bacteria 1108
349 Ga0207645_10430027 3300025907 Unclassified 890
350 Ga0207645_10722738 3300025907 Archaea 677
351 Ga0207643_10001209 3300025908 Bacteria 15266
352 Ga0207643_10016436 3300025908 Bacteria 4037
353 Ga0207643_11118068 3300025908 Unclassified 508
354 Ga0207705_10038281 3300025909 Bacteria 3433
355 Ga0207705_10490362 3300025909 Bacteria 954
356 Ga0207684_10302415 3300025910 Unclassified 1379
357 Ga0207684_11412796 3300025910 Unclassified 569
358 Ga0207654_10537146 3300025911 Unclassified 829
359 Ga0207707_10216468 3300025912 Bacteria 1668
360 Ga0207662_10939179 3300025918 Bacteria 613
361 Ga0207657_10012933 3300025919 Bacteria 8207
362 Ga0207657_11486621 3300025919 Bacteria 507
363 Ga0207649_11119325 3300025920 Unclassified 621
364 Ga0207652_10081332 3300025921 Bacteria 2833
365 Ga0207646_10439760 3300025922 Bacteria 1177
366 Ga0207681_10679253 3300025923 Unclassified 855
367 Ga0207694_10243159 3300025924 Bacteria 1471
368 Ga0207650_10363380 3300025925 Unclassified 1193
369 Ga0207650_10726227 3300025925 Unclassified 840
370 Ga0207650_11332790 3300025925 Unclassified 611
371 Ga0207659_10000925 3300025926 Bacteria 17486
372 Ga0207659_10013128 3300025926 Bacteria 5298
373 Ga0207659_10035018 3300025926 Unclassified 3467
374 Ga0207659_10092828 3300025926 Bacteria 2258
375 Ga0207659_10102971 3300025926 Unclassified 2156
376 Ga0207659_10477157 3300025926 Bacteria 1053
377 Ga0207659_10531537 3300025926 Bacteria 998
378 Ga0207659_10639488 3300025926 Bacteria 909
379 Ga0207659_11588063 3300025926 Bacteria 558
380 Ga0207659_11636883 3300025926 Bacteria 549
381 Ga0207687_10494209 3300025927 Bacteria 1020
382 Ga0207644_10211609 3300025931 Unclassified 1533
383 Ga0207644_10719682 3300025931 Bacteria 833
384 Ga0207690_10082484 3300025932 Bacteria 2249
385 Ga0207690_11108301 3300025932 Unclassified 660
386 Ga0207706_10001124 3300025933 Bacteria 27217
387 Ga0207706_10226965 3300025933 Bacteria 1634
388 Ga0207686_10462737 3300025934 Unclassified 978
389 Ga0207670_10045336 3300025936 Bacteria 2914
390 Ga0207670_10150115 3300025936 Unclassified 1728
391 Ga0207670_11729907 3300025936 Bacteria 532
392 Ga0207669_10000677 3300025937 Bacteria 14690
393 Ga0207669_10058705 3300025937 Bacteria 2349
394 Ga0207669_10120331 3300025937 Bacteria 1781
395 Ga0207669_10351826 3300025937 Bacteria 1138
396 Ga0207669_11316479 3300025937 Unclassified 614
397 Ga0207704_10124232 3300025938 Bacteria 1773
398 Ga0207704_11427993 3300025938 Unclassified 593
399 Ga0207691_10012757 3300025940 Bacteria 8045
400 Ga0207691_10024821 3300025940 Bacteria 5634
401 Ga0207691_10073346 3300025940 Bacteria 3087
402 Ga0207691_10209872 3300025940 Bacteria 1692
403 Ga0207691_10388181 3300025940 Bacteria 1191
404 Ga0207691_10588657 3300025940 Unclassified 942
405 Ga0207711_10028577 3300025941 Bacteria 4694
406 Ga0207711_10142789 3300025941 Bacteria 2155
407 Ga0207689_10034777 3300025942 Bacteria 4184
408 Ga0207689_10170555 3300025942 Bacteria 1793
409 Ga0207689_10240418 3300025942 Bacteria 1497
410 Ga0207689_10362789 3300025942 Unclassified 1205
411 Ga0207661_11680719 3300025944 Unclassified 580
412 Ga0207679_10112433 3300025945 Unclassified 2152
413 Ga0207679_10985887 3300025945 Bacteria 772
414 Ga0207667_10167366 3300025949 Bacteria 2259
415 Ga0207651_10017149 3300025960 Bacteria 4268
416 Ga0207651_10023469 3300025960 Bacteria 3795
417 Ga0207651_10049718 3300025960 Bacteria 2842
418 Ga0207651_10051639 3300025960 Bacteria 2799
419 Ga0207651_10064739 3300025960 Unclassified 2560
420 Ga0207651_10144493 3300025960 Bacteria 1842
421 Ga0207651_10190060 3300025960 Unclassified 1637
422 Ga0207651_10414316 3300025960 Bacteria 1149
423 Ga0207712_10591755 3300025961 Unclassified 959
424 Ga0207712_11455815 3300025961 Bacteria 613
425 Ga0207668_10328405 3300025972 Bacteria 1272
426 Ga0207640_10077733 3300025981 Bacteria 2257
427 Ga0207640_10085887 3300025981 Unclassified 2165
428 Ga0207658_10228663 3300025986 Bacteria 1569
429 Ga0207658_10246046 3300025986 Unclassified 1517
430 Ga0207658_11557500 3300025986 Bacteria 604
431 Ga0207677_10754550 3300026023 Bacteria 868
432 Ga0207703_10036715 3300026035 Bacteria 3901
433 Ga0207703_10038271 3300026035 Bacteria 3827
434 Ga0207703_10533430 3300026035 Unclassified 1105
435 Ga0207703_12159553 3300026035 Bacteria 533
436 Ga0207639_11260138 3300026041 Bacteria 694
437 Ga0207678_10104883 3300026067 Unclassified 2412
438 Ga0207708_10117783 3300026075 Bacteria 2067
439 Ga0207708_10645933 3300026075 Unclassified 900
440 Ga0207702_10593992 3300026078 Bacteria 1086
441 Ga0207641_10030170 3300026088 Bacteria 4490
442 Ga0207648_10011249 3300026089 Bacteria 8437
443 Ga0207648_10031771 3300026089 Bacteria 4666
444 Ga0207648_10175891 3300026089 Unclassified 1893
445 Ga0207648_10398594 3300026089 Bacteria 1246
446 Ga0207648_10532748 3300026089 Unclassified 1077
447 Ga0207648_10601658 3300026089 Bacteria 1013
448 Ga0207648_10669647 3300026089 Unclassified 960
449 Ga0207676_10022811 3300026095 Bacteria 4608
450 Ga0207676_10081397 3300026095 Bacteria 2631
451 Ga0207676_10129232 3300026095 Unclassified 2145
452 Ga0207674_10105673 3300026116 Bacteria 2793
453 Ga0207675_100459279 3300026118 Bacteria 1263
454 Ga0207675_100691950 3300026118 Unclassified 1028
455 Ga0207683_10003513 3300026121 Bacteria 13673
456 Ga0207683_10075577 3300026121 Bacteria 2982
457 Ga0207683_10112474 3300026121 Bacteria 2438
458 Ga0207683_10117505 3300026121 Bacteria 2385
459 Ga0207683_10380946 3300026121 Bacteria 1297
460 Ga0207698_10907617 3300026142 Unclassified 888
461 Ga0207698_10963931 3300026142 Unclassified 862
462 Ga0207698_11405405 3300026142 Bacteria 713
463 Ga0209981_1043577 3300027378 Unclassified 673
464 Ga0209983_1047510 3300027665 Unclassified 935
465 Ga0207428_10002483 3300027907 Bacteria 18414
466 Ga0268266_10099739 3300028379 Bacteria 2557
467 Ga0268266_10329906 3300028379 Bacteria 1430
468 Ga0268266_10577417 3300028379 Bacteria 1079
469 Ga0268265_10199219 3300028380 Bacteria 1736
470 Ga0268265_12331523 3300028380 Unclassified 542
471 Ga0268264_10056583 3300028381 Bacteria 3279
472 Ga0268264_10059743 3300028381 Bacteria 3195
473 Ga0268264_10781124 3300028381 Unclassified 953
474 Ga0307408_101887569 3300031548 Unclassified 572
475 Ga0307405_10591733 3300031731 Unclassified 904
476 Ga0307413_11027854 3300031824 Unclassified 708
477 Ga0307407_11641427 3300031903 Bacteria 511
478 Ga0307412_11284238 3300031911 Bacteria 658
479 Ga0307409_100269973 3300031995 Bacteria 1566
480 Ga0307416_100396903 3300032002 Bacteria 1415
481 Ga0307411_11221541 3300032005 Unclassified 682
482 Ga0307415_101016024 3300032126 Bacteria 772
483 Ga0373945_0160706 3300035116 Bacteria 916
484 Ga0373956_0394287 3300035119 Bacteria 660
485 Ga0373943_0056281 3300035170 Bacteria 1951
486 Ga0373955_0216570 3300035172 Bacteria 1143
487 Ga0373955_0495469 3300035172 Unclassified 746
488 Ga0373955_1031132 3300035172 Bacteria 507
489 Ga0373935_0499540 3300035692 Bacteria 883
490 Ga0373927_0674316 3300035695 Unclassified 683
491 Ga0373947_0196793 3300035725 Unclassified 1317
492 Ga0373947_0215753 3300035725 Bacteria 1260
493 Ga0373937_0125331 3300036401 Bacteria 2396
494 Ga0373937_0153757 3300036401 Unclassified 2156
495 Ga0373937_0549893 3300036401 Bacteria 1097
496 Ga0373937_0610388 3300036401 Bacteria 1035
497 Ga0395905_1144235 3300037471 Bacteria 682
498 Ga0436364_0627217 3300037853 Bacteria 6369
499 Ga0395901_1364144 3300038443 Bacteria 669
500 Ga0436365_1573372 3300039437 Bacteria 871
501 Ga0436365_1784715 3300039437 Unclassified 731
502 Ga0436360_0735281 3300039438 Bacteria 2144
503 Ga0451807_0831803 3300041486 Bacteria 563
504 Ga0439445_0255895 3300042004 Bacteria 523
505 Ga0439449_0258659 3300042007 Bacteria 655
506 Ga0439462_0175885 3300042015 Bacteria 606
507 Ga0450920_051942 3300042122 Bacteria 823
508 Ga0439434_0281985 3300042435 Bacteria 572
509 Ga0439435_0010420 3300042436 Bacteria 2207
510 Ga0439435_0071066 3300042436 Bacteria 1030
511 Ga0439444_0004617 3300042437 Bacteria 2011
512 Ga0451577_0060549 3300042876 Bacteria 3375
513 Ga0453684_0074567 3300044712 Bacteria 4270
514 Ga0466971_0329145 3300044719 Bacteria 737
515 Ga0466959_0115549 3300045049 Bacteria 1912
516 Ga0451576_0224467 3300045051 Bacteria 1961
517 Ga0451576_0526067 3300045051 Unclassified 1242
518 Ga0466958_0662926 3300045836 Bacteria 679
519 Ga0466967_1004699 3300045976 Bacteria 831
520 Ga0495603_0031800 3300046455 Bacteria 3177
521 Ga0495590_0157037 3300046457 Unclassified 826
522 Ga0495629_1088653 3300046459 Bacteria 517
523 Ga0495638_0095954 3300046460 Bacteria 1780
524 Ga0495580_0058076 3300046472 Bacteria 2723
525 Ga0495639_0024327 3300046475 Bacteria 2666
526 Ga0495594_0032745 3300046499 Bacteria 2823
527 Ga0495586_0060054 3300046535 Bacteria 2067
528 Ga0495598_0216924 3300046537 Bacteria 697
529 Ga0495598_0260163 3300046537 Unclassified 645
530 Ga0495621_0065301 3300046539 Bacteria 1329
531 Ga0495621_0097705 3300046539 Bacteria 1114
532 Ga0495656_0140006 3300046615 Bacteria 1160
533 Ga0495656_0347763 3300046615 Bacteria 768
534 Ga0495656_0353031 3300046615 Bacteria 762
535 Ga0495635_0147991 3300046663 Bacteria 1599
536 Ga0495659_0056994 3300046664 Bacteria 1435
537 Ga0495659_0166005 3300046664 Bacteria 893
538 Ga0495588_0287779 3300046674 Bacteria 866
539 Ga0495599_0552747 3300046678 Bacteria 674
540 Ga0495658_0173323 3300046683 Bacteria 1336
541 Ga0495670_0214416 3300046691 Bacteria 1022
542 Ga0495674_0348200 3300047319 Bacteria 1203
543 Ga0495676_0727590 3300047321 Bacteria 641
544 Ga0495675_0220786 3300047444 Bacteria 1147
545 Ga0496102_1044863 3300048905 Unclassified 737
546 Ga0496104_0280830 3300048907 Bacteria 1578
547 Ga0496105_1175988 3300048908 Bacteria 566
548 Ga0496106_0121479 3300048909 Bacteria 2042
549 Ga0496108_0658058 3300048911 Bacteria 910
550 Ga0496109_0190521 3300048912 Bacteria 1927
551 Ga0496109_0365360 3300048912 Unclassified 1363
552 Ga0496109_0632373 3300048912 Bacteria 1007
553 Ga0496109_1831088 3300048912 Bacteria 540
554 Ga0496110_1108163 3300048913 Bacteria 700
555 Ga0496113_0137539 3300048916 Bacteria 1920
556 Ga0496114_1773660 3300048917 Unclassified 505
557 Ga0501291_171953 3300049514 Bacteria 501
558 Ga0501031_0125244 3300049568 Bacteria 1678
559 Ga0501031_0175078 3300049568 Bacteria 1402
560 Ga0501033_0121742 3300049570 Unclassified 1893
561 Ga0501033_0728871 3300049570 Bacteria 673
562 Ga0501034_0188605 3300049571 Bacteria 2025
563 Ga0501039_0128158 3300049575 Bacteria 1991
564 Ga0501039_0169871 3300049575 Bacteria 1714
565 Ga0501039_0247032 3300049575 Bacteria 1403
566 Ga0501039_1003327 3300049575 Bacteria 649
567 Ga0501040_0008884 3300049576 Bacteria 6533
568 Ga0501040_0168715 3300049576 Bacteria 1549
569 Ga0501040_0716446 3300049576 Unclassified 724
570 Ga0501041_0032039 3300049577 Bacteria 3177
571 Ga0501041_0112275 3300049577 Bacteria 1691
572 Ga0501041_0814375 3300049577 Unclassified 599
573 Ga0501042_0004742 3300049578 Bacteria 8680
574 Ga0501042_0582566 3300049578 Bacteria 813
575 Ga0501043_0722649 3300049579 Unclassified 726
576 Ga0501046_0020141 3300049580 Bacteria 5522
577 Ga0501046_0963926 3300049580 Bacteria 593
578 Ga0501047_0048818 3300049581 Bacteria 4087
579 Ga0501047_0205863 3300049581 Bacteria 1827
580 Ga0501048_0081154 3300049582 Bacteria 2288
581 Ga0501048_0246255 3300049582 Unclassified 1268
582 Ga0501068_0085332 3300049584 Bacteria 1943
583 Ga0501068_0256125 3300049584 Unclassified 1116
584 Ga0501068_1130821 3300049584 Unclassified 518
585 Ga0501070_0856183 3300049586 Bacteria 711
586 Ga0501071_0094587 3300049587 Bacteria 2198
587 Ga0501071_0504247 3300049587 Unclassified 928
588 Ga0501072_0058925 3300049588 Bacteria 3027
589 Ga0501072_0101766 3300049588 Unclassified 2283
590 Ga0501072_0108370 3300049588 Bacteria 2210
591 Ga0501072_0141018 3300049588 Bacteria 1921
592 Ga0501072_0258397 3300049588 Unclassified 1387
593 Ga0501072_0542305 3300049588 Bacteria 919
594 Ga0501072_0940035 3300049588 Bacteria 675
595 Ga0501074_0064981 3300049590 Bacteria 2627
596 Ga0501074_1037766 3300049590 Unclassified 576
597 Ga0501075_0006605 3300049591 Bacteria 7993
598 Ga0501075_0007722 3300049591 Bacteria 7468
599 Ga0501075_0109865 3300049591 Bacteria 2096
600 Ga0501075_0273958 3300049591 Unclassified 1286
601 Ga0501076_0027446 3300049592 Bacteria 4416
602 Ga0501076_0031465 3300049592 Bacteria 4138
603 Ga0501076_0435472 3300049592 Bacteria 1079
604 Ga0501077_0087326 3300049593 Bacteria 1977
605 Ga0501077_0272436 3300049593 Bacteria 1077
606 Ga0501202_031298 3300049652 Unclassified 1111
607 Ga0501079_0094366 3300049741 Unclassified 2318
608 Ga0501080_0735213 3300049742 Unclassified 869
609 Ga0501081_0010128 3300049743 Bacteria 6151
610 Ga0501081_0318735 3300049743 Bacteria 1142
611 Ga0501081_0433806 3300049743 Unclassified 975
612 Ga0501083_0177623 3300049744 Unclassified 1391
613 Ga0501083_0441185 3300049744 Unclassified 847
614 Ga0501083_0529277 3300049744 Bacteria 767
615 Ga0501035_1407961 3300049822 Bacteria 534
616 Ga0501045_0130429 3300049824 Bacteria 1868
617 Ga0501045_0356571 3300049824 Bacteria 1088
618 Ga0501045_1254058 3300049824 Bacteria 540
619 nmdc:mga03n38_475640_c1 3300050490 Bacteria 698
620 nmdc:mga00v17_266342_c1 3300050491 Unclassified 1112
621 nmdc:mga06z11_127425_c1 3300050494 Unclassified 1426
622 nmdc:mga05p37_147825_c1 3300050507 Bacteria 2876
623 nmdc:mga05p37_162599_c1 3300050507 Bacteria 2726
624 nmdc:mga05p37_18473_c1 3300050507 Bacteria 8423
625 nmdc:mga05p37_21673_c1 3300050507 Bacteria 7784
626 nmdc:mga05p37_249633_c1 3300050507 Bacteria 2129
627 nmdc:mga05p37_279883_c1 3300050507 Unclassified 1990
628 nmdc:mga05p37_570537_c1 3300050507 Bacteria 1284
629 nmdc:mga05p37_6982_c1 3300050507 Bacteria 13308
630 nmdc:mga05p37_940374_c1 3300050507 Bacteria 926
631 nmdc:mga09592_103866_c1 3300050508 Unclassified 2435
632 nmdc:mga09592_282052_c1 3300050508 Bacteria 1441
633 nmdc:mga09592_45734_c2 3300050508 Bacteria 2740
634 nmdc:mga09592_5892_c1 3300050508 Bacteria 9998
635 nmdc:mga0qj67_197595_c1 3300050509 Unclassified 1634
636 nmdc:mga0qj67_272179_c1 3300050509 Bacteria 1373
637 nmdc:mga0qj67_292942_c1 3300050509 Bacteria 1319
638 nmdc:mga0qj67_41466_c1 3300050509 Bacteria 3621
639 nmdc:mga0qj67_5884_c1 3300050509 Bacteria 8984
640 nmdc:mga0qj67_78764_c1 3300050509 Unclassified 2638
641 nmdc:mga0qj67_802710_c1 3300050509 Unclassified 745
642 nmdc:mga06r32_13675_c1 3300050510 Bacteria 7360
643 nmdc:mga06r32_1410425_c1 3300050510 Bacteria 638
644 nmdc:mga06r32_146341_c1 3300050510 Unclassified 2340
645 nmdc:mga06r32_15513_c1 3300050510 Bacteria 6919
646 nmdc:mga06r32_23758_c1 3300050510 Bacteria 5678
647 nmdc:mga06r32_328374_c1 3300050510 Bacteria 1515
648 nmdc:mga06r32_34369_c1 3300050510 Bacteria 4780
649 nmdc:mga06r32_91349_c1 3300050510 Unclassified 2975
650 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
651 nmdc:mga08y16_166464_c1 3300050511 Bacteria 2290
652 nmdc:mga08y16_40988_c1 3300050511 Bacteria 4851
653 nmdc:mga08y16_543577_c1 3300050511 Bacteria 1176
654 nmdc:mga08y16_79329_c1 3300050511 Unclassified 3421
655 nmdc:mga08y16_801129_c1 3300050511 Bacteria 935
656 nmdc:mga0n895_1075076_c1 3300050512 Bacteria 783
657 nmdc:mga0n895_1406937_c1 3300050512 Bacteria 666
658 nmdc:mga0n895_272820_c1 3300050512 Unclassified 1716
659 nmdc:mga0n895_475166_c1 3300050512 Bacteria 1261
660 nmdc:mga0rr50_181166_c1 3300050513 Unclassified 1722
661 nmdc:mga0rr50_284589_c1 3300050513 Bacteria 1380
662 nmdc:mga08x19_119768_c1 3300050514 Unclassified 1764
663 nmdc:mga08x19_276269_c1 3300050514 Bacteria 1163
664 nmdc:mga0a205_142561_c1 3300050515 Bacteria 2296
665 nmdc:mga0a205_200356_c2 3300050515 Bacteria 1589
666 nmdc:mga0a205_38006_c1 3300050515 Bacteria 4630
667 nmdc:mga0a205_631535_c1 3300050515 Bacteria 923
668 nmdc:mga0a205_68965_c1 3300050515 Bacteria 3415
669 Ga0495612_0413687 3300053078 Bacteria 614
670 Ga0495619_0154142 3300053085 Bacteria 1585
671 Ga0495619_0371143 3300053085 Bacteria 989
672 Ga0500641_0000772 3300053096 Bacteria 11618
673 Ga0500568_0018910 3300053139 Bacteria 3005
674 Ga0500616_0000188 3300053153 Bacteria 101183
675 Ga0500645_000164 3300053730 Bacteria 51803
676 Ga0501084_0015972 3300054114 Bacteria 6231
677 Ga0501084_0469648 3300054114 Bacteria 1063
678 Ga0501084_0476149 3300054114 Bacteria 1055
679 Ga0590071_013126 3300059421 Bacteria 1941
680 Ga0590071_017054 3300059421 Bacteria 1704
681 Ga0590074_040236 3300059423 Bacteria 840
682 Ga0590075_003202 3300059424 Bacteria 3895
683 Ga0590075_006059 3300059424 Bacteria 2862
684 Ga0590077_006077 3300059426 Bacteria 2476
685 Ga0590077_037794 3300059426 Unclassified 1067
686 Ga0501082_0057336 3300060353 Bacteria 3356
687 Ga0501082_0061054 3300060353 Bacteria 3245
688 Ga0501082_0774658 3300060353 Unclassified 839
689 Ga0466962_0202268 3300061719 Bacteria 971
690 Ga0530510_0026022 3300061734 Bacteria 4185
691 Ga0530510_0085223 3300061734 Bacteria 2302
692 Ga0530510_1027148 3300061734 Unclassified 631
693 Ga0495581_0529819
694 JGI24749J21850_1027405
695 JGI25406J46586_10001877
696 Ga0065712_10011019
697 Ga0065715_10647077
698 Ga0065707_10037617
699 Ga0065707_10087131
700 Ga0070676_10080082
701 Ga0070676_10278467
702 Ga0070676_10295884
703 Ga0070676_10948899
704 Ga0070683_100933070
705 Ga0070690_100006239
706 Ga0070690_101306213
707 Ga0070670_100047733
708 Ga0070670_100498057
709 Ga0070670_100642463
710 Ga0070670_101538400
711 Ga0070677_10005391
712 Ga0070677_10060878
713 Ga0070677_10133203
714 Ga0070677_10317139
715 Ga0068869_100014923
716 Ga0068869_100021682
717 Ga0068869_100047647
718 Ga0070666_10086334
719 Ga0070666_10356900
720 Ga0070666_10688440
721 Ga0070666_10834804
722 Ga0070680_100074435
723 Ga0070682_101159706
724 Ga0068868_100072354
725 Ga0068868_100146867
726 Ga0070660_100011473
727 Ga0070689_100018439
728 Ga0070689_100050709
729 Ga0070689_100139028
730 Ga0070689_100716880
731 Ga0070661_100016901
732 Ga0070661_100018034
733 Ga0070661_101041496
734 Ga0070692_10796454
735 Ga0070668_100650695
736 Ga0070668_102010298
737 Ga0070669_100051468
738 Ga0070669_100240763
739 Ga0070669_101108482
740 Ga0070675_100000107
741 Ga0070675_100000193
742 Ga0070675_100019586
743 Ga0070675_100053387
744 Ga0070675_100121849
745 Ga0070675_100132602
746 Ga0070675_100133300
747 Ga0070675_100185626
748 Ga0070675_100252066
749 Ga0070675_100623763
750 Ga0070675_100767811
751 Ga0070671_100022507
752 Ga0070671_100088895
753 Ga0070671_100750789
754 Ga0070671_100954950
755 Ga0070674_100001260
756 Ga0070674_100027170
757 Ga0070674_100179539
758 Ga0070674_100285890
759 Ga0070674_100743762
760 Ga0070674_101877689
761 Ga0070673_100034896
762 Ga0070673_100049478
763 Ga0070673_100058374
764 Ga0070673_100130882
765 Ga0070673_100170280
766 Ga0070688_100377455
767 Ga0070688_100679154
768 Ga0070688_101567324
769 Ga0070659_100132575
770 Ga0070659_100171155
771 Ga0070659_100214158
772 Ga0070659_100313139
773 Ga0070659_101008023
774 Ga0070667_100178096
775 Ga0070667_100185181
776 Ga0070667_100244639
777 Ga0070667_100456383
778 Ga0070667_100462003
779 Ga0070709_10365065
780 Ga0070705_100418671
781 Ga0070705_100841558
782 Ga0070700_100932241
783 Ga0070700_100956549
784 Ga0070700_101897668
785 Ga0070694_100512272
786 Ga0070694_100573197
787 Ga0070694_101472119
788 Ga0070694_101488194
789 Ga0070708_100152042
790 Ga0070708_100457719
791 Ga0070708_101327413
792 Ga0070663_100066516
793 Ga0070678_100009155
794 Ga0070678_100117351
795 Ga0070678_100330848
796 Ga0070678_100381384
797 Ga0070678_101427863
798 Ga0070678_101440348
799 Ga0070662_100048201
800 Ga0070662_100171859
801 Ga0070662_100260287
802 Ga0070662_100277827
803 Ga0070681_10056175
804 Ga0068867_100009442
805 Ga0068867_100442858
806 Ga0068867_100778871
807 Ga0068867_100792181
808 Ga0068867_100954691
809 Ga0070685_10132567
810 Ga0070706_100296921
811 Ga0070707_100274130
812 Ga0070707_100867348
813 Ga0070698_100040015
814 Ga0070698_102060673
815 Ga0070699_100126883
816 Ga0070679_100039688
817 Ga0070684_100003808
818 Ga0070684_100887890
819 Ga0070684_100963414
820 Ga0070697_100216435
821 Ga0070697_100534178
822 Ga0068853_100450086
823 Ga0068853_102096157
824 Ga0070672_100017016
825 Ga0070672_100141926
826 Ga0070672_100152116
827 Ga0070672_100643060
828 Ga0070672_101007377
829 Ga0070686_100004038
830 Ga0070686_100233734
831 Ga0070695_100688731
832 Ga0070696_100347483
833 Ga0070696_100355754
834 Ga0070696_100511438
835 Ga0070696_100549451
836 Ga0070696_101899810
837 Ga0070696_101929535
838 Ga0070665_100196198
839 Ga0070665_100313738
840 Ga0070665_100764982
841 Ga0070665_102200515
842 Ga0070704_100004623
843 Ga0070704_100954454
844 Ga0070704_101689617
845 Ga0068855_100012526
846 Ga0070664_100003576
847 Ga0070664_100107457
848 Ga0070664_100438053
849 Ga0070664_100529507
850 Ga0068857_100945793
851 Ga0068857_101760565
852 Ga0068854_100049749
853 Ga0070702_100165930
854 Ga0070702_100294335
855 Ga0070702_100323203
856 Ga0070702_100405614
857 Ga0070702_100561729
858 Ga0070702_100755618
859 Ga0068852_100084975
860 Ga0068852_100380727
861 Ga0068859_100007749
862 Ga0068859_100120538
863 Ga0068859_100357767
864 Ga0068859_100453473
865 Ga0068859_102075001
866 Ga0068864_100021678
867 Ga0068864_100157452
868 Ga0068864_100236331
869 Ga0068861_100463401
870 Ga0068861_100815834
871 Ga0068870_10045775
872 Ga0068870_10078996
873 Ga0068870_11109988
874 Ga0068863_100009062
875 Ga0068863_100367827
876 Ga0068858_100014541
877 Ga0068858_100051880
878 Ga0068858_100052631
879 Ga0068858_101230415
880 Ga0068860_100019269
881 Ga0068860_100039019
882 Ga0068860_100103054
883 Ga0068860_100255975
884 Ga0068862_100409336
885 Ga0081539_10000056
886 Ga0075363_100352318
887 Ga0075362_10180931
888 Ga0075367_10055839
889 Ga0075366_10136742
890 Ga0097621_100036402
891 Ga0097621_100081707
892 Ga0097621_100142642
893 Ga0097621_100753060
894 Ga0097621_100865444
895 Ga0097621_101995485
896 Ga0068871_100117506
897 Ga0068871_100332427
898 Ga0068871_100486426
899 Ga0075428_100003026
900 Ga0075428_100149414
901 Ga0075428_100666418
902 Ga0075428_100772308
903 Ga0075428_101349215
904 Ga0075430_100011515
905 Ga0075430_100016485
906 Ga0075430_100027098
907 Ga0075430_100036355
908 Ga0075430_100374234
909 Ga0075430_100801756
910 Ga0075430_100904861
911 Ga0075431_100000804
912 Ga0075431_100112182
913 Ga0075431_100158037
914 Ga0075431_100177343
915 Ga0075431_100746045
916 Ga0075431_101154477
917 Ga0075433_10030851
918 Ga0075433_10255874
919 Ga0075433_10283942
920 Ga0075433_10804833
921 Ga0075434_100017800
922 Ga0075434_101265786
923 Ga0075429_100007498
924 Ga0075429_100046351
925 Ga0075429_100213147
926 Ga0068865_100090794
927 Ga0075436_100116847
928 Ga0097620_100007749
929 Ga0097620_100120541
930 Ga0097620_100357735
931 Ga0097620_100453427
932 Ga0097620_102075005
933 Ga0075435_100342547
934 Ga0105240_11467915
935 Ga0111539_10000056
936 Ga0111539_10013747
937 Ga0111539_10131239
938 Ga0111539_10591288
939 Ga0111539_10627069
940 Ga0111539_10663193
941 Ga0111539_10814643
942 Ga0111539_10829274
943 Ga0111539_11040997
944 Ga0111539_12618676
945 Ga0105247_10164975
946 Ga0114129_10006522
947 Ga0114129_10010650
948 Ga0114129_10011051
949 Ga0114129_10017449
950 Ga0114129_10020920
951 Ga0114129_10044424
952 Ga0114129_10118725
953 Ga0114129_10143879
954 Ga0114129_10265291
955 Ga0114129_10288678
956 Ga0114129_10346166
957 Ga0114129_10880335
958 Ga0114129_11008401
959 Ga0114129_12032295
960 Ga0114129_12871494
961 Ga0114129_13183485
962 Ga0105243_11169251
963 Ga0105242_10292374
964 Ga0105242_10295764
965 Ga0105242_11193204
966 Ga0105248_10006564
967 Ga0105248_10030221
968 Ga0105248_10083398
969 Ga0105248_10148322
970 Ga0105248_10249918
971 Ga0105248_10317981
972 Ga0105248_11864846
973 Ga0105238_10136252
974 Ga0105249_10022648
975 Ga0105249_10660268
976 Ga0105246_10241939
977 Ga0105246_10585340
978 Ga0105246_10606086
979 Ga0105246_12101391
980 Ga0157325_1023617
981 Ga0157374_10048504
982 Ga0157374_10272313
983 Ga0157374_11197781
984 Ga0157374_11933077
985 Ga0157378_10129016
986 Ga0157378_10761429
987 Ga0157378_11409869
988 Ga0157378_12410317
989 Ga0163162_10013149
990 Ga0163162_10082498
991 Ga0163162_11373494
992 Ga0163162_11615031
993 Ga0163162_12760163
994 Ga0157375_10043371
995 Ga0157375_10113232
996 Ga0157375_10171740
997 Ga0157375_10182805
998 Ga0157375_10501414
999 Ga0157375_11094769
1000 Ga0157375_12425179
1001 Ga0163163_10302020
1002 Ga0163163_11062607
1003 Ga0157380_10052513
1004 Ga0157380_10091328
1005 Ga0157380_10335656
1006 Ga0157380_10458220
1007 Ga0157380_11070473
1008 Ga0157380_11498466
1009 Ga0157380_11602051
1010 Ga0157377_10028734
1011 Ga0157377_10052241
1012 Ga0157377_10405424
1013 Ga0157377_10502348
1014 Ga0157377_10508999
1015 Ga0157377_11635910
1016 Ga0157379_10023491
1017 Ga0157376_10042880
1018 Ga0157376_10103296
1019 Ga0157376_10440333
1020 Ga0157376_10945802
1021 Ga0163161_10293050
1022 Ga0163161_10845385
1023 Ga0163161_11040686
1024 Ga0213876_10083391
1025 Ga0207697_10242877
1026 Ga0207682_10001041
1027 Ga0207682_10010361
1028 Ga0207682_10057354
1029 Ga0207682_10120094
1030 Ga0207642_10063485
1031 Ga0207710_10643552
1032 Ga0207688_10028330
1033 Ga0207688_10274605
1034 Ga0207680_10251383
1035 Ga0207680_10430075
1036 Ga0207680_10946072
1037 Ga0207699_10319325
1038 Ga0207645_10001335
1039 Ga0207645_10068974
1040 Ga0207645_10279685
1041 Ga0207645_10430027
1042 Ga0207645_10722738
1043 Ga0207643_10001209
1044 Ga0207643_10016436
1045 Ga0207643_11118068
1046 Ga0207705_10038281
1047 Ga0207705_10490362
1048 Ga0207684_10302415
1049 Ga0207684_11412796
1050 Ga0207654_10537146
1051 Ga0207707_10216468
1052 Ga0207662_10939179
1053 Ga0207657_10012933
1054 Ga0207657_11486621
1055 Ga0207649_11119325
1056 Ga0207652_10081332
1057 Ga0207646_10439760
1058 Ga0207681_10679253
1059 Ga0207694_10243159
1060 Ga0207650_10363380
1061 Ga0207650_10726227
1062 Ga0207650_11332790
1063 Ga0207659_10000925
1064 Ga0207659_10013128
1065 Ga0207659_10035018
1066 Ga0207659_10092828
1067 Ga0207659_10102971
1068 Ga0207659_10477157
1069 Ga0207659_10531537
1070 Ga0207659_10639488
1071 Ga0207659_11588063
1072 Ga0207659_11636883
1073 Ga0207687_10494209
1074 Ga0207644_10211609
1075 Ga0207644_10719682
1076 Ga0207690_10082484
1077 Ga0207690_11108301
1078 Ga0207706_10001124
1079 Ga0207706_10226965
1080 Ga0207686_10462737
1081 Ga0207670_10045336
1082 Ga0207670_10150115
1083 Ga0207670_11729907
1084 Ga0207669_10000677
1085 Ga0207669_10058705
1086 Ga0207669_10120331
1087 Ga0207669_10351826
1088 Ga0207669_11316479
1089 Ga0207704_10124232
1090 Ga0207704_11427993
1091 Ga0207691_10012757
1092 Ga0207691_10024821
1093 Ga0207691_10073346
1094 Ga0207691_10209872
1095 Ga0207691_10388181
1096 Ga0207691_10588657
1097 Ga0207711_10028577
1098 Ga0207711_10142789
1099 Ga0207689_10034777
1100 Ga0207689_10170555
1101 Ga0207689_10240418
1102 Ga0207689_10362789
1103 Ga0207661_11680719
1104 Ga0207679_10112433
1105 Ga0207679_10985887
1106 Ga0207667_10167366
1107 Ga0207651_10017149
1108 Ga0207651_10023469
1109 Ga0207651_10049718
1110 Ga0207651_10051639
1111 Ga0207651_10064739
1112 Ga0207651_10144493
1113 Ga0207651_10190060
1114 Ga0207651_10414316
1115 Ga0207712_10591755
1116 Ga0207712_11455815
1117 Ga0207668_10328405
1118 Ga0207640_10077733
1119 Ga0207640_10085887
1120 Ga0207658_10228663
1121 Ga0207658_10246046
1122 Ga0207658_11557500
1123 Ga0207677_10754550
1124 Ga0207703_10036715
1125 Ga0207703_10038271
1126 Ga0207703_10533430
1127 Ga0207703_12159553
1128 Ga0207639_11260138
1129 Ga0207678_10104883
1130 Ga0207708_10117783
1131 Ga0207708_10645933
1132 Ga0207702_10593992
1133 Ga0207641_10030170
1134 Ga0207648_10011249
1135 Ga0207648_10031771
1136 Ga0207648_10175891
1137 Ga0207648_10398594
1138 Ga0207648_10532748
1139 Ga0207648_10601658
1140 Ga0207648_10669647
1141 Ga0207676_10022811
1142 Ga0207676_10081397
1143 Ga0207676_10129232
1144 Ga0207674_10105673
1145 Ga0207675_100459279
1146 Ga0207675_100691950
1147 Ga0207683_10003513
1148 Ga0207683_10075577
1149 Ga0207683_10112474
1150 Ga0207683_10117505
1151 Ga0207683_10380946
1152 Ga0207698_10907617
1153 Ga0207698_10963931
1154 Ga0207698_11405405
1155 Ga0209981_1043577
1156 Ga0209983_1047510
1157 Ga0207428_10002483
1158 Ga0268266_10099739
1159 Ga0268266_10329906
1160 Ga0268266_10577417
1161 Ga0268265_10199219
1162 Ga0268265_12331523
1163 Ga0268264_10056583
1164 Ga0268264_10059743
1165 Ga0268264_10781124
1166 Ga0307408_101887569
1167 Ga0307405_10591733
1168 Ga0307413_11027854
1169 Ga0307407_11641427
1170 Ga0307412_11284238
1171 Ga0307409_100269973
1172 Ga0307416_100396903
1173 Ga0307411_11221541
1174 Ga0307415_101016024
1175 Ga0373945_0160706
1176 Ga0373956_0394287
1177 Ga0373943_0056281
1178 Ga0373955_0216570
1179 Ga0373955_0495469
1180 Ga0373955_1031132
1181 Ga0373935_0499540
1182 Ga0373927_0674316
1183 Ga0373947_0196793
1184 Ga0373947_0215753
1185 Ga0373937_0125331
1186 Ga0373937_0153757
1187 Ga0373937_0549893
1188 Ga0373937_0610388
1189 Ga0395905_1144235
1190 Ga0436364_0627217
1191 Ga0395901_1364144
1192 Ga0436365_1573372
1193 Ga0436365_1784715
1194 Ga0436360_0735281
1195 Ga0451807_0831803
1196 Ga0439445_0255895
1197 Ga0439449_0258659
1198 Ga0439462_0175885
1199 Ga0450920_051942
1200 Ga0439434_0281985
1201 Ga0439435_0010420
1202 Ga0439435_0071066
1203 Ga0439444_0004617
1204 Ga0451577_0060549
1205 Ga0453684_0074567
1206 Ga0466971_0329145
1207 Ga0466959_0115549
1208 Ga0451576_0224467
1209 Ga0451576_0526067
1210 Ga0466958_0662926
1211 Ga0466967_1004699
1212 Ga0495603_0031800
1213 Ga0495590_0157037
1214 Ga0495629_1088653
1215 Ga0495638_0095954
1216 Ga0495580_0058076
1217 Ga0495639_0024327
1218 Ga0495594_0032745
1219 Ga0495586_0060054
1220 Ga0495598_0216924
1221 Ga0495598_0260163
1222 Ga0495621_0065301
1223 Ga0495621_0097705
1224 Ga0495656_0140006
1225 Ga0495656_0347763
1226 Ga0495656_0353031
1227 Ga0495635_0147991
1228 Ga0495659_0056994
1229 Ga0495659_0166005
1230 Ga0495588_0287779
1231 Ga0495599_0552747
1232 Ga0495658_0173323
1233 Ga0495670_0214416
1234 Ga0495674_0348200
1235 Ga0495676_0727590
1236 Ga0495675_0220786
1237 Ga0496102_1044863
1238 Ga0496104_0280830
1239 Ga0496105_1175988
1240 Ga0496106_0121479
1241 Ga0496108_0658058
1242 Ga0496109_0190521
1243 Ga0496109_0365360
1244 Ga0496109_0632373
1245 Ga0496109_1831088
1246 Ga0496110_1108163
1247 Ga0496113_0137539
1248 Ga0496114_1773660
1249 Ga0501291_171953
1250 Ga0501031_0125244
1251 Ga0501031_0175078
1252 Ga0501033_0121742
1253 Ga0501033_0728871
1254 Ga0501034_0188605
1255 Ga0501039_0128158
1256 Ga0501039_0169871
1257 Ga0501039_0247032
1258 Ga0501039_1003327
1259 Ga0501040_0008884
1260 Ga0501040_0168715
1261 Ga0501040_0716446
1262 Ga0501041_0032039
1263 Ga0501041_0112275
1264 Ga0501041_0814375
1265 Ga0501042_0004742
1266 Ga0501042_0582566
1267 Ga0501043_0722649
1268 Ga0501046_0020141
1269 Ga0501046_0963926
1270 Ga0501047_0048818
1271 Ga0501047_0205863
1272 Ga0501048_0081154
1273 Ga0501048_0246255
1274 Ga0501068_0085332
1275 Ga0501068_0256125
1276 Ga0501068_1130821
1277 Ga0501070_0856183
1278 Ga0501071_0094587
1279 Ga0501071_0504247
1280 Ga0501072_0058925
1281 Ga0501072_0101766
1282 Ga0501072_0108370
1283 Ga0501072_0141018
1284 Ga0501072_0258397
1285 Ga0501072_0542305
1286 Ga0501072_0940035
1287 Ga0501074_0064981
1288 Ga0501074_1037766
1289 Ga0501075_0006605
1290 Ga0501075_0007722
1291 Ga0501075_0109865
1292 Ga0501075_0273958
1293 Ga0501076_0027446
1294 Ga0501076_0031465
1295 Ga0501076_0435472
1296 Ga0501077_0087326
1297 Ga0501077_0272436
1298 Ga0501202_031298
1299 Ga0501079_0094366
1300 Ga0501080_0735213
1301 Ga0501081_0010128
1302 Ga0501081_0318735
1303 Ga0501081_0433806
1304 Ga0501083_0177623
1305 Ga0501083_0441185
1306 Ga0501083_0529277
1307 Ga0501035_1407961
1308 Ga0501045_0130429
1309 Ga0501045_0356571
1310 Ga0501045_1254058
1311 nmdc:mga03n38_475640_c1
1312 nmdc:mga00v17_266342_c1
1313 nmdc:mga06z11_127425_c1
1314 nmdc:mga05p37_147825_c1
1315 nmdc:mga05p37_162599_c1
1316 nmdc:mga05p37_18473_c1
1317 nmdc:mga05p37_21673_c1
1318 nmdc:mga05p37_249633_c1
1319 nmdc:mga05p37_279883_c1
1320 nmdc:mga05p37_570537_c1
1321 nmdc:mga05p37_6982_c1
1322 nmdc:mga05p37_940374_c1
1323 nmdc:mga09592_103866_c1
1324 nmdc:mga09592_282052_c1
1325 nmdc:mga09592_45734_c2
1326 nmdc:mga09592_5892_c1
1327 nmdc:mga0qj67_197595_c1
1328 nmdc:mga0qj67_272179_c1
1329 nmdc:mga0qj67_292942_c1
1330 nmdc:mga0qj67_41466_c1
1331 nmdc:mga0qj67_5884_c1
1332 nmdc:mga0qj67_78764_c1
1333 nmdc:mga0qj67_802710_c1
1334 nmdc:mga06r32_13675_c1
1335 nmdc:mga06r32_1410425_c1
1336 nmdc:mga06r32_146341_c1
1337 nmdc:mga06r32_15513_c1
1338 nmdc:mga06r32_23758_c1
1339 nmdc:mga06r32_328374_c1
1340 nmdc:mga06r32_34369_c1
1341 nmdc:mga06r32_91349_c1
1342 nmdc:mga08y16_1311_c1
1343 nmdc:mga08y16_166464_c1
1344 nmdc:mga08y16_40988_c1
1345 nmdc:mga08y16_543577_c1
1346 nmdc:mga08y16_79329_c1
1347 nmdc:mga08y16_801129_c1
1348 nmdc:mga0n895_1075076_c1
1349 nmdc:mga0n895_1406937_c1
1350 nmdc:mga0n895_272820_c1
1351 nmdc:mga0n895_475166_c1
1352 nmdc:mga0rr50_181166_c1
1353 nmdc:mga0rr50_284589_c1
1354 nmdc:mga08x19_119768_c1
1355 nmdc:mga08x19_276269_c1
1356 nmdc:mga0a205_142561_c1
1357 nmdc:mga0a205_200356_c2
1358 nmdc:mga0a205_38006_c1
1359 nmdc:mga0a205_631535_c1
1360 nmdc:mga0a205_68965_c1
1361 Ga0495612_0413687
1362 Ga0495619_0154142
1363 Ga0495619_0371143
1364 Ga0500641_0000772
1365 Ga0500568_0018910
1366 Ga0500616_0000188
1367 Ga0500645_000164
1368 Ga0501084_0015972
1369 Ga0501084_0469648
1370 Ga0501084_0476149
1371 Ga0590071_013126
1372 Ga0590071_017054
1373 Ga0590074_040236
1374 Ga0590075_003202
1375 Ga0590075_006059
1376 Ga0590077_006077
1377 Ga0590077_037794
1378 Ga0501082_0057336
1379 Ga0501082_0061054
1380 Ga0501082_0774658
1381 Ga0466962_0202268
1382 Ga0530510_0026022
1383 Ga0530510_0085223
1384 Ga0530510_1027148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

10

112

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9286 13 70
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9215 8 70
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9199 13 70
2xig-assembly2.cif.gz_A the structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites 0.9169 13 72
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9028 13 72
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9694 9 69 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9387 12 70 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 9 69 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9332 23 71 3.30.230.130
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 13 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C2ASF8-F1-model_v4 Orc1-like AAA ATPase domain-containing protein 0.954 7 73
AF-A0A7C4PNP8-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9434 9 70 GO:0003677
GO:0045892
AF-G9EPR1-F1-model_v4 ATP-dependent DNA helicase RecG C-terminal domain-containing protein 0.9339 7 72
AF-A0A2S5SWH3-F1-model_v4 Uncharacterized protein 0.9311 9 72
AF-A0A4R1RDV8-F1-model_v4 Uncharacterized protein 0.931 9 72

Map