F475537
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 691 | 304 | 1382 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_100605782|Ga0307416_1006057822 |
| Length | 156 |
| Sequence | MPPHAPGIDVIPRWDGVMEALVPRVTATPAALALIAQLREKHGPLMFFQSGGCCDGSSPMCYAAGEFNVGDEDVYLGNLDGVPFYIGADQFEYWQHTQLIIDAVPGRGSGFSLESPEGLRFLTRSRVYTEEEFAELDRMGPPARGPQAAAGATAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 70 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 126 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 127 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 128 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 129 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 130 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 131 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 136 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 146 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 271 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 272 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 275 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 276 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 294 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 295 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 296 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 297 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 298 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 299 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 300 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 301 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 302 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 303 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 304 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.91 |
| Metatranscriptomes | 5.35 |
| Isolates | 1.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.16 |
| Nodule | 0.14 |
| Rhizoplane | 4.78 |
| Rhizosphere | 78.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_100605782 | 3300032002 | Bacteria | 1176 |
| 2 | JGI25158J39367_1000578 | 3300002739 | Bacteria | 7298 |
| 3 | JGI25152J39213_1005039 | 3300002773 | Bacteria | 3980 |
| 4 | JGI25150J39212_1000509 | 3300002774 | Bacteria | 16087 |
| 5 | JGI25150J39212_1001656 | 3300002774 | Bacteria | 6033 |
| 6 | JGI25159J45721_1003229 | 3300002987 | Bacteria | 5844 |
| 7 | JGI25159J45721_1015699 | 3300002987 | Bacteria | 1647 |
| 8 | JGI25153J46596_10007048 | 3300003215 | Bacteria | 5593 |
| 9 | JGI25160J50197_1025127 | 3300003354 | Bacteria | 1673 |
| 10 | JGI25161J50226_1003175 | 3300003374 | Bacteria | 3880 |
| 11 | JGI25161J50226_1005709 | 3300003374 | Bacteria | 2365 |
| 12 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 13 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 14 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 15 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 16 | Ga0055542_1025791 | 3300003762 | Bacteria | 797 |
| 17 | Ga0055526_1004169 | 3300003771 | Bacteria | 8795 |
| 18 | Ga0055526_1006747 | 3300003771 | Bacteria | 6146 |
| 19 | Ga0055537_1003209 | 3300003773 | Bacteria | 5104 |
| 20 | Ga0055524_1004765 | 3300003775 | Bacteria | 6194 |
| 21 | Ga0055524_1005260 | 3300003775 | Bacteria | 5817 |
| 22 | Ga0055524_1017011 | 3300003775 | Bacteria | 2580 |
| 23 | Ga0055534_1003757 | 3300003784 | Bacteria | 4673 |
| 24 | Ga0055528_1005492 | 3300003790 | Bacteria | 5891 |
| 25 | Ga0055530_10005444 | 3300003791 | Bacteria | 6048 |
| 26 | Ga0055530_10010016 | 3300003791 | Bacteria | 3563 |
| 27 | Ga0055530_10017989 | 3300003791 | Bacteria | 2195 |
| 28 | Ga0055531_10015533 | 3300003794 | Bacteria | 3347 |
| 29 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 30 | Ga0055541_1000043 | 3300003841 | Bacteria | 161703 |
| 31 | Ga0055543_1000518 | 3300004625 | Bacteria | 21978 |
| 32 | Ga0055543_1077650 | 3300004625 | Bacteria | 514 |
| 33 | Ga0065165_1001717 | 3300005262 | Bacteria | 21978 |
| 34 | Ga0065165_1162550 | 3300005262 | Bacteria | 514 |
| 35 | Ga0070658_10216907 | 3300005327 | Bacteria | 1617 |
| 36 | Ga0070676_10482501 | 3300005328 | Bacteria | 877 |
| 37 | Ga0070683_101884753 | 3300005329 | Bacteria | 575 |
| 38 | Ga0068869_101848552 | 3300005334 | Bacteria | 541 |
| 39 | Ga0068869_102025119 | 3300005334 | Bacteria | 517 |
| 40 | Ga0070680_100335884 | 3300005336 | Bacteria | 1283 |
| 41 | Ga0068868_101909078 | 3300005338 | Bacteria | 562 |
| 42 | Ga0070660_100309320 | 3300005339 | Bacteria | 1296 |
| 43 | Ga0070660_100340308 | 3300005339 | Bacteria | 1234 |
| 44 | Ga0070660_100341887 | 3300005339 | Bacteria | 1231 |
| 45 | Ga0070660_100984305 | 3300005339 | Bacteria | 712 |
| 46 | Ga0070675_100765352 | 3300005354 | Bacteria | 881 |
| 47 | Ga0070659_100241668 | 3300005366 | Bacteria | 1494 |
| 48 | Ga0070662_100245715 | 3300005457 | Bacteria | 1437 |
| 49 | Ga0068853_101008241 | 3300005539 | Bacteria | 802 |
| 50 | Ga0070672_100421381 | 3300005543 | Bacteria | 1147 |
| 51 | Ga0068855_100229074 | 3300005563 | Bacteria | 2082 |
| 52 | Ga0068855_100336816 | 3300005563 | Bacteria | 1664 |
| 53 | Ga0068855_100677306 | 3300005563 | Bacteria | 1105 |
| 54 | Ga0068855_101952588 | 3300005563 | Bacteria | 594 |
| 55 | Ga0068857_100217477 | 3300005577 | Bacteria | 1744 |
| 56 | Ga0068857_101141948 | 3300005577 | Bacteria | 753 |
| 57 | Ga0068854_100389309 | 3300005578 | Bacteria | 1151 |
| 58 | Ga0068856_101234158 | 3300005614 | Bacteria | 764 |
| 59 | Ga0068852_100048813 | 3300005616 | Bacteria | 3618 |
| 60 | Ga0068851_10196460 | 3300005834 | Bacteria | 1124 |
| 61 | Ga0081539_10175986 | 3300005985 | Bacteria | 1007 |
| 62 | Ga0075363_100065324 | 3300006048 | Bacteria | 1967 |
| 63 | Ga0075362_10006557 | 3300006177 | Bacteria | 4347 |
| 64 | Ga0068871_101328346 | 3300006358 | Bacteria | 677 |
| 65 | Ga0105244_10002419 | 3300009036 | Bacteria | 14091 |
| 66 | Ga0105244_10079813 | 3300009036 | Bacteria | 1621 |
| 67 | Ga0105245_10064167 | 3300009098 | Bacteria | 3319 |
| 68 | Ga0105243_10171459 | 3300009148 | Bacteria | 1880 |
| 69 | Ga0105241_10070405 | 3300009174 | Bacteria | 2713 |
| 70 | Ga0105242_10295346 | 3300009176 | Bacteria | 1477 |
| 71 | Ga0105248_13188084 | 3300009177 | Bacteria | 522 |
| 72 | Ga0105237_10098555 | 3300009545 | Bacteria | 2914 |
| 73 | Ga0105237_10110075 | 3300009545 | Bacteria | 2746 |
| 74 | Ga0105238_10425902 | 3300009551 | Bacteria | 1322 |
| 75 | Ga0105239_10256194 | 3300010375 | Bacteria | 1966 |
| 76 | Ga0105239_12399031 | 3300010375 | Bacteria | 614 |
| 77 | Ga0105246_10081174 | 3300011119 | Bacteria | 2310 |
| 78 | Ga0157327_1030384 | 3300012512 | Bacteria | 671 |
| 79 | Ga0157373_10194288 | 3300013100 | Bacteria | 1430 |
| 80 | Ga0157371_11092390 | 3300013102 | Bacteria | 611 |
| 81 | Ga0157370_10638962 | 3300013104 | Bacteria | 973 |
| 82 | Ga0157374_10342786 | 3300013296 | Bacteria | 1484 |
| 83 | Ga0157378_10697203 | 3300013297 | Bacteria | 1034 |
| 84 | Ga0157372_12095516 | 3300013307 | Bacteria | 650 |
| 85 | Ga0157375_10524197 | 3300013308 | Bacteria | 1348 |
| 86 | Ga0182008_10001536 | 3300014497 | Bacteria | 15362 |
| 87 | Ga0182006_1001143 | 3300015261 | Bacteria | 16891 |
| 88 | Ga0182006_1008837 | 3300015261 | Bacteria | 4551 |
| 89 | Ga0182007_10000877 | 3300015262 | Bacteria | 16671 |
| 90 | Ga0182007_10007549 | 3300015262 | Bacteria | 4546 |
| 91 | Ga0182005_1000619 | 3300015265 | Bacteria | 17139 |
| 92 | Ga0182005_1000667 | 3300015265 | Bacteria | 16238 |
| 93 | Ga0182005_1000793 | 3300015265 | Bacteria | 14398 |
| 94 | Ga0163161_10006789 | 3300017792 | Bacteria | 7910 |
| 95 | Ga0163161_10012970 | 3300017792 | Bacteria | 5790 |
| 96 | Ga0163161_10550204 | 3300017792 | Bacteria | 946 |
| 97 | Ga0213872_10002773 | 3300021361 | Bacteria | 10030 |
| 98 | Ga0209436_100313 | 3300025208 | Bacteria | 22303 |
| 99 | Ga0209436_107678 | 3300025208 | Bacteria | 2225 |
| 100 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 101 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 102 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 103 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 104 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 105 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 106 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 107 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 108 | Ga0207427_100887 | 3300025231 | Bacteria | 13037 |
| 109 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 110 | Ga0207425_1000588 | 3300025245 | Bacteria | 21250 |
| 111 | Ga0207425_1001602 | 3300025245 | Bacteria | 9142 |
| 112 | Ga0207425_1034855 | 3300025245 | Bacteria | 984 |
| 113 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 114 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 115 | Ga0209148_1000948 | 3300025254 | Bacteria | 19020 |
| 116 | Ga0209129_1000722 | 3300025258 | Bacteria | 21252 |
| 117 | Ga0209129_1007515 | 3300025258 | Bacteria | 3228 |
| 118 | Ga0209129_1014595 | 3300025258 | Bacteria | 1666 |
| 119 | Ga0209129_1041744 | 3300025258 | Bacteria | 724 |
| 120 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 121 | Ga0209565_1001735 | 3300025263 | Bacteria | 8914 |
| 122 | Ga0209673_1029848 | 3300025273 | Bacteria | 1728 |
| 123 | Ga0209673_1125077 | 3300025273 | Bacteria | 519 |
| 124 | Ga0209130_1001107 | 3300025284 | Bacteria | 19845 |
| 125 | Ga0209130_1002788 | 3300025284 | Bacteria | 8202 |
| 126 | Ga0209675_1005968 | 3300025291 | Bacteria | 4985 |
| 127 | Ga0209675_1010959 | 3300025291 | Bacteria | 3048 |
| 128 | Ga0209564_1001069 | 3300025295 | Bacteria | 33056 |
| 129 | Ga0209564_1003957 | 3300025295 | Bacteria | 9435 |
| 130 | Ga0209758_1002100 | 3300025297 | Bacteria | 21160 |
| 131 | Ga0209050_1001138 | 3300025298 | Bacteria | 32017 |
| 132 | Ga0209050_1005947 | 3300025298 | Bacteria | 7421 |
| 133 | Ga0209256_1001697 | 3300025299 | Bacteria | 21250 |
| 134 | Ga0209256_1003025 | 3300025299 | Bacteria | 12431 |
| 135 | Ga0209256_1005137 | 3300025299 | Bacteria | 7736 |
| 136 | Ga0209256_1005283 | 3300025299 | Bacteria | 7525 |
| 137 | Ga0207426_1014480 | 3300025302 | Bacteria | 2887 |
| 138 | Ga0209051_1044737 | 3300025303 | Bacteria | 1539 |
| 139 | Ga0209257_1001218 | 3300025304 | Bacteria | 32221 |
| 140 | Ga0209257_1018630 | 3300025304 | Bacteria | 2657 |
| 141 | Ga0207656_10131508 | 3300025321 | Bacteria | 1173 |
| 142 | Ga0207705_10002296 | 3300025909 | Bacteria | 14795 |
| 143 | Ga0207705_10328443 | 3300025909 | Bacteria | 1176 |
| 144 | Ga0207654_10002735 | 3300025911 | Bacteria | 8951 |
| 145 | Ga0207695_10000475 | 3300025913 | Bacteria | 86957 |
| 146 | Ga0207695_10360875 | 3300025913 | Bacteria | 1339 |
| 147 | Ga0207671_10013593 | 3300025914 | Bacteria | 6476 |
| 148 | Ga0207671_10919763 | 3300025914 | Bacteria | 691 |
| 149 | Ga0207657_10164045 | 3300025919 | Bacteria | 1803 |
| 150 | Ga0207657_10867826 | 3300025919 | Bacteria | 696 |
| 151 | Ga0207657_11035412 | 3300025919 | Bacteria | 629 |
| 152 | Ga0207694_10020740 | 3300025924 | Bacteria | 4975 |
| 153 | Ga0207694_11296194 | 3300025924 | Bacteria | 616 |
| 154 | Ga0207650_10304890 | 3300025925 | Bacteria | 1301 |
| 155 | Ga0207659_10555746 | 3300025926 | Bacteria | 976 |
| 156 | Ga0207687_10481971 | 3300025927 | Bacteria | 1033 |
| 157 | Ga0207690_10022573 | 3300025932 | Bacteria | 3916 |
| 158 | Ga0207690_10253846 | 3300025932 | Bacteria | 1359 |
| 159 | Ga0207706_10257352 | 3300025933 | Bacteria | 1524 |
| 160 | Ga0207706_10463222 | 3300025933 | Bacteria | 1096 |
| 161 | Ga0207686_10113670 | 3300025934 | Bacteria | 1831 |
| 162 | Ga0207709_10078106 | 3300025935 | Bacteria | 2124 |
| 163 | Ga0207679_10971482 | 3300025945 | Bacteria | 778 |
| 164 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 165 | Ga0207667_10003222 | 3300025949 | Bacteria | 20156 |
| 166 | Ga0207667_10124041 | 3300025949 | Bacteria | 2661 |
| 167 | Ga0207702_11844499 | 3300026078 | Bacteria | 596 |
| 168 | Ga0207648_10822331 | 3300026089 | Bacteria | 865 |
| 169 | Ga0207674_11104449 | 3300026116 | Bacteria | 762 |
| 170 | Ga0207674_11296777 | 3300026116 | Bacteria | 698 |
| 171 | Ga0207683_10804677 | 3300026121 | Bacteria | 872 |
| 172 | Ga0207698_10397491 | 3300026142 | Bacteria | 1316 |
| 173 | Ga0209281_1013917 | 3300027111 | Bacteria | 1719 |
| 174 | Ga0207428_10023263 | 3300027907 | Bacteria | 5213 |
| 175 | Ga0307408_100000973 | 3300031548 | Bacteria | 22180 |
| 176 | Ga0307408_100024850 | 3300031548 | Bacteria | 4096 |
| 177 | Ga0307408_100118713 | 3300031548 | Bacteria | 2045 |
| 178 | Ga0307408_101803214 | 3300031548 | Bacteria | 585 |
| 179 | Ga0307518_10045141 | 3300031838 | Bacteria | 3205 |
| 180 | Ga0307414_10088716 | 3300032004 | Bacteria | 2289 |
| 181 | Ga0395899_0008066 | 3300037312 | Bacteria | 8108 |
| 182 | Ga0395899_0032076 | 3300037312 | Bacteria | 3946 |
| 183 | Ga0395899_0082799 | 3300037312 | Bacteria | 2333 |
| 184 | Ga0395899_0444314 | 3300037312 | Bacteria | 850 |
| 185 | Ga0395899_0503358 | 3300037312 | Bacteria | 785 |
| 186 | Ga0395900_0002082 | 3300037418 | Bacteria | 22434 |
| 187 | Ga0395900_0006153 | 3300037418 | Bacteria | 12529 |
| 188 | Ga0395900_0011090 | 3300037418 | Bacteria | 9211 |
| 189 | Ga0395900_0014146 | 3300037418 | Bacteria | 8148 |
| 190 | Ga0395900_0022691 | 3300037418 | Bacteria | 6423 |
| 191 | Ga0395900_0078262 | 3300037418 | Bacteria | 3397 |
| 192 | Ga0395900_0139377 | 3300037418 | Bacteria | 2484 |
| 193 | Ga0395900_0220533 | 3300037418 | Bacteria | 1911 |
| 194 | Ga0395900_0486826 | 3300037418 | Bacteria | 1185 |
| 195 | Ga0395900_1580083 | 3300037418 | Bacteria | 567 |
| 196 | Ga0395900_1687429 | 3300037418 | Bacteria | 544 |
| 197 | Ga0395898_0111383 | 3300037466 | Bacteria | 2623 |
| 198 | Ga0395898_0322613 | 3300037466 | Bacteria | 1473 |
| 199 | Ga0395898_0458011 | 3300037466 | Bacteria | 1214 |
| 200 | Ga0395898_0653895 | 3300037466 | Bacteria | 993 |
| 201 | Ga0395898_0749210 | 3300037466 | Bacteria | 918 |
| 202 | Ga0395898_0761538 | 3300037466 | Bacteria | 909 |
| 203 | Ga0395898_1559177 | 3300037466 | Bacteria | 585 |
| 204 | Ga0395905_0132477 | 3300037471 | Bacteria | 2344 |
| 205 | Ga0395905_0175747 | 3300037471 | Bacteria | 2010 |
| 206 | Ga0395905_0356374 | 3300037471 | Bacteria | 1355 |
| 207 | Ga0395905_0358621 | 3300037471 | Bacteria | 1350 |
| 208 | Ga0395905_0756524 | 3300037471 | Bacteria | 874 |
| 209 | Ga0395905_0921035 | 3300037471 | Bacteria | 777 |
| 210 | Ga0395905_1226885 | 3300037471 | Bacteria | 653 |
| 211 | Ga0395905_1557662 | 3300037471 | Bacteria | 565 |
| 212 | Ga0395901_0037857 | 3300038443 | Bacteria | 4987 |
| 213 | Ga0395901_0053700 | 3300038443 | Bacteria | 4187 |
| 214 | Ga0395901_0095957 | 3300038443 | Bacteria | 3107 |
| 215 | Ga0395901_0940856 | 3300038443 | Bacteria | 843 |
| 216 | Ga0395901_1414612 | 3300038443 | Bacteria | 653 |
| 217 | Ga0436361_0441966 | 3300039447 | Bacteria | 9274 |
| 218 | Ga0439450_014298 | 3300042008 | Bacteria | 1608 |
| 219 | Ga0439455_0035734 | 3300042012 | Bacteria | 1255 |
| 220 | Ga0450911_005124 | 3300042115 | Bacteria | 2064 |
| 221 | Ga0450923_167109 | 3300042125 | Unclassified | 538 |
| 222 | Ga0439458_0010255 | 3300042157 | Bacteria | 2087 |
| 223 | Ga0439458_0017830 | 3300042157 | Bacteria | 1623 |
| 224 | Ga0439458_0024586 | 3300042157 | Bacteria | 1409 |
| 225 | Ga0466969_0166534 | 3300044656 | Bacteria | 1011 |
| 226 | Ga0466969_0294178 | 3300044656 | Bacteria | 735 |
| 227 | Ga0466969_0475361 | 3300044656 | Bacteria | 569 |
| 228 | Ga0466972_0127143 | 3300044658 | Bacteria | 1201 |
| 229 | Ga0466972_0176410 | 3300044658 | Bacteria | 1002 |
| 230 | Ga0466965_0218349 | 3300044683 | Bacteria | 1015 |
| 231 | Ga0466965_0812545 | 3300044683 | Bacteria | 541 |
| 232 | Ga0466966_0008013 | 3300044684 | Bacteria | 6998 |
| 233 | Ga0466966_0104589 | 3300044684 | Bacteria | 1748 |
| 234 | Ga0466966_0324114 | 3300044684 | Bacteria | 926 |
| 235 | Ga0466966_0382674 | 3300044684 | Bacteria | 845 |
| 236 | Ga0466966_0545691 | 3300044684 | Bacteria | 697 |
| 237 | Ga0466961_0253867 | 3300044693 | Bacteria | 1079 |
| 238 | Ga0466961_0438180 | 3300044693 | Bacteria | 791 |
| 239 | Ga0466963_0302341 | 3300044694 | Bacteria | 1125 |
| 240 | Ga0466963_0832069 | 3300044694 | Bacteria | 651 |
| 241 | Ga0466964_0001242 | 3300044706 | Bacteria | 8651 |
| 242 | Ga0466964_0162664 | 3300044706 | Bacteria | 1044 |
| 243 | Ga0453684_0147550 | 3300044712 | Bacteria | 2800 |
| 244 | Ga0466971_0218208 | 3300044719 | Bacteria | 903 |
| 245 | Ga0466971_0372295 | 3300044719 | Bacteria | 693 |
| 246 | Ga0466968_0001885 | 3300044735 | Bacteria | 7585 |
| 247 | Ga0466968_0157702 | 3300044735 | Bacteria | 1046 |
| 248 | Ga0466970_0505460 | 3300044765 | Bacteria | 696 |
| 249 | Ga0466960_0264370 | 3300044901 | Bacteria | 959 |
| 250 | Ga0466960_0801366 | 3300044901 | Bacteria | 570 |
| 251 | Ga0466959_0306268 | 3300045049 | Bacteria | 1087 |
| 252 | Ga0466959_0485726 | 3300045049 | Bacteria | 835 |
| 253 | Ga0466959_0620807 | 3300045049 | Bacteria | 726 |
| 254 | Ga0466959_0662313 | 3300045049 | Bacteria | 700 |
| 255 | Ga0451576_1645749 | 3300045051 | Unclassified | 665 |
| 256 | Ga0466958_0182869 | 3300045836 | Bacteria | 1330 |
| 257 | Ga0466958_0470566 | 3300045836 | Bacteria | 814 |
| 258 | Ga0466967_0076531 | 3300045976 | Bacteria | 3010 |
| 259 | Ga0495617_002155 | 3300046452 | Bacteria | 8087 |
| 260 | Ga0495627_000872 | 3300046453 | Bacteria | 21373 |
| 261 | Ga0495627_002769 | 3300046453 | Bacteria | 8143 |
| 262 | Ga0495627_064645 | 3300046453 | Bacteria | 1076 |
| 263 | Ga0495603_0124494 | 3300046455 | Bacteria | 1502 |
| 264 | Ga0495590_0049511 | 3300046457 | Bacteria | 1466 |
| 265 | Ga0495591_003691 | 3300046458 | Bacteria | 7773 |
| 266 | Ga0495629_0274928 | 3300046459 | Bacteria | 1156 |
| 267 | Ga0495638_0297938 | 3300046460 | Bacteria | 870 |
| 268 | Ga0495651_0302355 | 3300046462 | Bacteria | 1072 |
| 269 | Ga0495653_0062640 | 3300046463 | Bacteria | 2809 |
| 270 | Ga0495653_0460432 | 3300046463 | Bacteria | 798 |
| 271 | Ga0495650_0001092 | 3300046471 | Bacteria | 29735 |
| 272 | Ga0495650_0092726 | 3300046471 | Bacteria | 1146 |
| 273 | Ga0495580_0006528 | 3300046472 | Bacteria | 9489 |
| 274 | Ga0495582_0004946 | 3300046473 | Bacteria | 7466 |
| 275 | Ga0495582_0019535 | 3300046473 | Bacteria | 3705 |
| 276 | Ga0495605_0000948 | 3300046474 | Bacteria | 19782 |
| 277 | Ga0495605_0004587 | 3300046474 | Bacteria | 8087 |
| 278 | Ga0495605_0138953 | 3300046474 | Bacteria | 1091 |
| 279 | Ga0495605_0154689 | 3300046474 | Bacteria | 1021 |
| 280 | Ga0495605_0209945 | 3300046474 | Bacteria | 845 |
| 281 | Ga0495639_0222641 | 3300046475 | Bacteria | 928 |
| 282 | Ga0495584_0001330 | 3300046491 | Bacteria | 15004 |
| 283 | Ga0495584_0004346 | 3300046491 | Bacteria | 7630 |
| 284 | Ga0495584_0013455 | 3300046491 | Bacteria | 4177 |
| 285 | Ga0495584_0019925 | 3300046491 | Bacteria | 3408 |
| 286 | Ga0495584_0095724 | 3300046491 | Bacteria | 1499 |
| 287 | Ga0495584_0133682 | 3300046491 | Bacteria | 1259 |
| 288 | Ga0495584_0153740 | 3300046491 | Bacteria | 1169 |
| 289 | Ga0495584_0167006 | 3300046491 | Bacteria | 1118 |
| 290 | Ga0495584_0170679 | 3300046491 | Bacteria | 1105 |
| 291 | Ga0495584_0306562 | 3300046491 | Bacteria | 806 |
| 292 | Ga0495585_0000775 | 3300046492 | Bacteria | 28225 |
| 293 | Ga0495585_0002380 | 3300046492 | Bacteria | 13492 |
| 294 | Ga0495585_0002489 | 3300046492 | Bacteria | 13134 |
| 295 | Ga0495585_0005664 | 3300046492 | Bacteria | 7843 |
| 296 | Ga0495585_0023187 | 3300046492 | Bacteria | 3561 |
| 297 | Ga0495585_0073957 | 3300046492 | Bacteria | 1854 |
| 298 | Ga0495585_0096797 | 3300046492 | Bacteria | 1583 |
| 299 | Ga0495585_0114729 | 3300046492 | Bacteria | 1429 |
| 300 | Ga0495585_0164641 | 3300046492 | Bacteria | 1149 |
| 301 | Ga0495585_0195842 | 3300046492 | Bacteria | 1031 |
| 302 | Ga0495594_0014358 | 3300046499 | Bacteria | 4148 |
| 303 | Ga0495594_0318350 | 3300046499 | Bacteria | 886 |
| 304 | Ga0495594_0566491 | 3300046499 | Bacteria | 644 |
| 305 | Ga0495596_0004425 | 3300046500 | Bacteria | 6850 |
| 306 | Ga0495596_0008004 | 3300046500 | Bacteria | 4727 |
| 307 | Ga0495596_0046330 | 3300046500 | Bacteria | 1708 |
| 308 | Ga0495596_0104956 | 3300046500 | Bacteria | 1097 |
| 309 | Ga0495596_0135318 | 3300046500 | Bacteria | 956 |
| 310 | Ga0495607_0002716 | 3300046501 | Bacteria | 14116 |
| 311 | Ga0495607_0002910 | 3300046501 | Bacteria | 13506 |
| 312 | Ga0495607_0003111 | 3300046501 | Bacteria | 12888 |
| 313 | Ga0495607_0003999 | 3300046501 | Bacteria | 11066 |
| 314 | Ga0495607_0007153 | 3300046501 | Bacteria | 7756 |
| 315 | Ga0495607_0008423 | 3300046501 | Bacteria | 7048 |
| 316 | Ga0495607_0022476 | 3300046501 | Bacteria | 3960 |
| 317 | Ga0495607_0036749 | 3300046501 | Bacteria | 2948 |
| 318 | Ga0495607_0137111 | 3300046501 | Bacteria | 1266 |
| 319 | Ga0495607_0138196 | 3300046501 | Bacteria | 1260 |
| 320 | Ga0495607_0313687 | 3300046501 | Bacteria | 734 |
| 321 | Ga0495583_0001441 | 3300046506 | Bacteria | 24155 |
| 322 | Ga0495583_0001454 | 3300046506 | Bacteria | 23965 |
| 323 | Ga0495583_0006351 | 3300046506 | Bacteria | 7748 |
| 324 | Ga0495583_0107738 | 3300046506 | Bacteria | 1183 |
| 325 | Ga0495583_0121795 | 3300046506 | Bacteria | 1097 |
| 326 | Ga0495606_0001574 | 3300046507 | Bacteria | 29902 |
| 327 | Ga0495606_0030905 | 3300046507 | Bacteria | 3732 |
| 328 | Ga0495606_0083463 | 3300046507 | Bacteria | 1981 |
| 329 | Ga0495606_0319966 | 3300046507 | Bacteria | 834 |
| 330 | Ga0495608_0004883 | 3300046511 | Bacteria | 9596 |
| 331 | Ga0495610_0019752 | 3300046512 | Bacteria | 3757 |
| 332 | Ga0495616_0002069 | 3300046513 | Bacteria | 13485 |
| 333 | Ga0495616_0002194 | 3300046513 | Bacteria | 13050 |
| 334 | Ga0495616_0003846 | 3300046513 | Bacteria | 9568 |
| 335 | Ga0495616_0006858 | 3300046513 | Bacteria | 6861 |
| 336 | Ga0495616_0020368 | 3300046513 | Bacteria | 3610 |
| 337 | Ga0495616_0024465 | 3300046513 | Bacteria | 3239 |
| 338 | Ga0495616_0027122 | 3300046513 | Bacteria | 3042 |
| 339 | Ga0495616_0062566 | 3300046513 | Bacteria | 1822 |
| 340 | Ga0495618_0030712 | 3300046514 | Bacteria | 3357 |
| 341 | Ga0495628_0008806 | 3300046516 | Bacteria | 8636 |
| 342 | Ga0495630_0254966 | 3300046517 | Bacteria | 1340 |
| 343 | Ga0495631_0007994 | 3300046518 | Bacteria | 5346 |
| 344 | Ga0495631_0011269 | 3300046518 | Bacteria | 4401 |
| 345 | Ga0495631_0025604 | 3300046518 | Bacteria | 2715 |
| 346 | Ga0495631_0043848 | 3300046518 | Bacteria | 1972 |
| 347 | Ga0495631_0102437 | 3300046518 | Bacteria | 1231 |
| 348 | Ga0495631_0163068 | 3300046518 | Bacteria | 956 |
| 349 | Ga0495632_0001583 | 3300046519 | Bacteria | 18767 |
| 350 | Ga0495632_0007738 | 3300046519 | Bacteria | 6706 |
| 351 | Ga0495632_0021346 | 3300046519 | Bacteria | 3490 |
| 352 | Ga0495632_0105999 | 3300046519 | Bacteria | 1322 |
| 353 | Ga0495637_0003984 | 3300046520 | Bacteria | 7720 |
| 354 | Ga0495637_0116523 | 3300046520 | Bacteria | 1031 |
| 355 | Ga0495643_0001730 | 3300046522 | Bacteria | 18877 |
| 356 | Ga0495643_0004146 | 3300046522 | Bacteria | 10298 |
| 357 | Ga0495643_0031616 | 3300046522 | Bacteria | 2945 |
| 358 | Ga0495643_0033760 | 3300046522 | Bacteria | 2827 |
| 359 | Ga0495643_0087120 | 3300046522 | Bacteria | 1616 |
| 360 | Ga0495643_0191701 | 3300046522 | Bacteria | 986 |
| 361 | Ga0495644_0000127 | 3300046523 | Bacteria | 36626 |
| 362 | Ga0495644_0008334 | 3300046523 | Bacteria | 3992 |
| 363 | Ga0495644_0019918 | 3300046523 | Bacteria | 2560 |
| 364 | Ga0495644_0020234 | 3300046523 | Bacteria | 2539 |
| 365 | Ga0495644_0058690 | 3300046523 | Bacteria | 1446 |
| 366 | Ga0495644_0060619 | 3300046523 | Bacteria | 1422 |
| 367 | Ga0495644_0096388 | 3300046523 | Bacteria | 1118 |
| 368 | Ga0495648_0003645 | 3300046524 | Bacteria | 13467 |
| 369 | Ga0495648_0007369 | 3300046524 | Bacteria | 8814 |
| 370 | Ga0495648_0008176 | 3300046524 | Bacteria | 8256 |
| 371 | Ga0495648_0044179 | 3300046524 | Bacteria | 2784 |
| 372 | Ga0495648_0069350 | 3300046524 | Bacteria | 2052 |
| 373 | Ga0495663_0098891 | 3300046525 | Bacteria | 958 |
| 374 | Ga0495666_0006575 | 3300046526 | Bacteria | 5847 |
| 375 | Ga0495666_0152381 | 3300046526 | Bacteria | 1074 |
| 376 | Ga0495642_0002195 | 3300046528 | Bacteria | 8005 |
| 377 | Ga0495642_0003161 | 3300046528 | Bacteria | 6531 |
| 378 | Ga0495642_0003572 | 3300046528 | Bacteria | 6123 |
| 379 | Ga0495642_0022397 | 3300046528 | Bacteria | 2489 |
| 380 | Ga0495642_0120058 | 3300046528 | Bacteria | 1127 |
| 381 | Ga0495642_0134223 | 3300046528 | Bacteria | 1066 |
| 382 | Ga0495642_0315796 | 3300046528 | Bacteria | 685 |
| 383 | Ga0495642_0407978 | 3300046528 | Bacteria | 599 |
| 384 | Ga0495652_0172819 | 3300046529 | Bacteria | 1666 |
| 385 | Ga0495654_0008955 | 3300046530 | Bacteria | 5500 |
| 386 | Ga0495654_0063156 | 3300046530 | Bacteria | 1774 |
| 387 | Ga0495654_0073298 | 3300046530 | Bacteria | 1619 |
| 388 | Ga0495654_0159538 | 3300046530 | Bacteria | 991 |
| 389 | Ga0495654_0184231 | 3300046530 | Bacteria | 902 |
| 390 | Ga0495665_0003695 | 3300046531 | Bacteria | 8296 |
| 391 | Ga0495586_0012303 | 3300046535 | Bacteria | 4541 |
| 392 | Ga0495586_0225912 | 3300046535 | Bacteria | 1064 |
| 393 | Ga0495587_0021626 | 3300046536 | Bacteria | 3968 |
| 394 | Ga0495609_0000373 | 3300046538 | Bacteria | 38466 |
| 395 | Ga0495609_0001008 | 3300046538 | Bacteria | 20025 |
| 396 | Ga0495609_0001055 | 3300046538 | Bacteria | 19326 |
| 397 | Ga0495609_0002502 | 3300046538 | Bacteria | 11290 |
| 398 | Ga0495609_0057413 | 3300046538 | Bacteria | 1723 |
| 399 | Ga0495609_0057807 | 3300046538 | Bacteria | 1716 |
| 400 | Ga0495609_0078259 | 3300046538 | Bacteria | 1447 |
| 401 | Ga0495621_0028684 | 3300046539 | Bacteria | 1894 |
| 402 | Ga0495597_0007625 | 3300046542 | Bacteria | 5476 |
| 403 | Ga0495597_0014544 | 3300046542 | Bacteria | 3744 |
| 404 | Ga0495597_0063794 | 3300046542 | Bacteria | 1601 |
| 405 | Ga0495597_0358751 | 3300046542 | Bacteria | 558 |
| 406 | Ga0495645_0043107 | 3300046543 | Bacteria | 3291 |
| 407 | Ga0495645_0118174 | 3300046543 | Bacteria | 1870 |
| 408 | Ga0495645_0144668 | 3300046543 | Bacteria | 1656 |
| 409 | Ga0495622_0000496 | 3300046557 | Bacteria | 24678 |
| 410 | Ga0495622_0012529 | 3300046557 | Bacteria | 3927 |
| 411 | Ga0495622_0017769 | 3300046557 | Bacteria | 3310 |
| 412 | Ga0495622_0169217 | 3300046557 | Bacteria | 983 |
| 413 | Ga0495633_0003417 | 3300046558 | Bacteria | 10575 |
| 414 | Ga0495633_0005842 | 3300046558 | Bacteria | 7410 |
| 415 | Ga0495633_0017395 | 3300046558 | Bacteria | 3678 |
| 416 | Ga0495633_0017460 | 3300046558 | Bacteria | 3668 |
| 417 | Ga0495633_0052117 | 3300046558 | Bacteria | 1928 |
| 418 | Ga0495633_0104713 | 3300046558 | Bacteria | 1312 |
| 419 | Ga0495633_0161307 | 3300046558 | Bacteria | 1034 |
| 420 | Ga0495633_0200093 | 3300046558 | Bacteria | 917 |
| 421 | Ga0495633_0285130 | 3300046558 | Bacteria | 751 |
| 422 | Ga0495656_0223029 | 3300046615 | Bacteria | 943 |
| 423 | Ga0495656_0263087 | 3300046615 | Bacteria | 874 |
| 424 | Ga0495668_0006426 | 3300046616 | Bacteria | 7697 |
| 425 | Ga0495668_0010902 | 3300046616 | Bacteria | 5473 |
| 426 | Ga0495668_0014280 | 3300046616 | Bacteria | 4660 |
| 427 | Ga0495668_0072899 | 3300046616 | Bacteria | 1886 |
| 428 | Ga0495668_0078434 | 3300046616 | Bacteria | 1813 |
| 429 | Ga0495668_0195538 | 3300046616 | Bacteria | 1107 |
| 430 | Ga0495668_0261462 | 3300046616 | Bacteria | 947 |
| 431 | Ga0495634_0023974 | 3300046642 | Bacteria | 4285 |
| 432 | Ga0495611_0002725 | 3300046648 | Bacteria | 7949 |
| 433 | Ga0495611_0002915 | 3300046648 | Bacteria | 7634 |
| 434 | Ga0495611_0058276 | 3300046648 | Bacteria | 1751 |
| 435 | Ga0495611_0078529 | 3300046648 | Bacteria | 1515 |
| 436 | Ga0495611_0135275 | 3300046648 | Bacteria | 1150 |
| 437 | Ga0495611_0240994 | 3300046648 | Bacteria | 839 |
| 438 | Ga0495625_0188611 | 3300046660 | Bacteria | 1367 |
| 439 | Ga0495625_0200807 | 3300046660 | Bacteria | 1316 |
| 440 | Ga0495635_0097145 | 3300046663 | Bacteria | 2013 |
| 441 | Ga0495635_0328664 | 3300046663 | Bacteria | 1022 |
| 442 | Ga0495659_0214836 | 3300046664 | Bacteria | 792 |
| 443 | Ga0495661_0001429 | 3300046665 | Bacteria | 19999 |
| 444 | Ga0495661_0001902 | 3300046665 | Bacteria | 16649 |
| 445 | Ga0495661_0002729 | 3300046665 | Bacteria | 13439 |
| 446 | Ga0495661_0006660 | 3300046665 | Bacteria | 8108 |
| 447 | Ga0495661_0008899 | 3300046665 | Bacteria | 6914 |
| 448 | Ga0495661_0011128 | 3300046665 | Bacteria | 6109 |
| 449 | Ga0495661_0011988 | 3300046665 | Bacteria | 5866 |
| 450 | Ga0495661_0027742 | 3300046665 | Bacteria | 3631 |
| 451 | Ga0495661_0027847 | 3300046665 | Bacteria | 3624 |
| 452 | Ga0495661_0042205 | 3300046665 | Bacteria | 2813 |
| 453 | Ga0495661_0105894 | 3300046665 | Bacteria | 1574 |
| 454 | Ga0495661_0161915 | 3300046665 | Bacteria | 1200 |
| 455 | Ga0495661_0209886 | 3300046665 | Bacteria | 1014 |
| 456 | Ga0495661_0272261 | 3300046665 | Bacteria | 856 |
| 457 | Ga0495661_0286650 | 3300046665 | Bacteria | 828 |
| 458 | Ga0495661_0290923 | 3300046665 | Bacteria | 820 |
| 459 | Ga0495661_0292055 | 3300046665 | Bacteria | 818 |
| 460 | Ga0495588_0000484 | 3300046674 | Bacteria | 19730 |
| 461 | Ga0495588_0084419 | 3300046674 | Bacteria | 1659 |
| 462 | Ga0495588_0329324 | 3300046674 | Bacteria | 803 |
| 463 | Ga0495588_0333575 | 3300046674 | Bacteria | 797 |
| 464 | Ga0495599_0114123 | 3300046678 | Bacteria | 1681 |
| 465 | Ga0495599_0431462 | 3300046678 | Bacteria | 782 |
| 466 | Ga0495623_0123378 | 3300046679 | Bacteria | 1557 |
| 467 | Ga0495623_0150100 | 3300046679 | Bacteria | 1378 |
| 468 | Ga0495646_0003851 | 3300046680 | Bacteria | 9378 |
| 469 | Ga0495646_0095438 | 3300046680 | Bacteria | 1711 |
| 470 | Ga0495658_0401568 | 3300046683 | Bacteria | 874 |
| 471 | Ga0495669_0001252 | 3300046684 | Bacteria | 10565 |
| 472 | Ga0495669_0003814 | 3300046684 | Bacteria | 6194 |
| 473 | Ga0495669_0017924 | 3300046684 | Bacteria | 3040 |
| 474 | Ga0495669_0056504 | 3300046684 | Bacteria | 1769 |
| 475 | Ga0495613_0217959 | 3300046689 | Bacteria | 1340 |
| 476 | Ga0495613_0418513 | 3300046689 | Bacteria | 912 |
| 477 | Ga0495624_0012132 | 3300046690 | Bacteria | 5902 |
| 478 | Ga0495670_0001826 | 3300046691 | Bacteria | 10467 |
| 479 | Ga0495670_0004671 | 3300046691 | Bacteria | 6718 |
| 480 | Ga0495670_0022311 | 3300046691 | Bacteria | 3125 |
| 481 | Ga0495670_0026447 | 3300046691 | Bacteria | 2872 |
| 482 | Ga0495670_0180871 | 3300046691 | Bacteria | 1113 |
| 483 | Ga0495670_0187105 | 3300046691 | Bacteria | 1094 |
| 484 | Ga0495670_0341986 | 3300046691 | Bacteria | 805 |
| 485 | Ga0495671_0000737 | 3300046692 | Bacteria | 23518 |
| 486 | Ga0495671_0056034 | 3300046692 | Bacteria | 1951 |
| 487 | Ga0495649_0005694 | 3300046694 | Bacteria | 7864 |
| 488 | Ga0495649_0023930 | 3300046694 | Bacteria | 3409 |
| 489 | Ga0495649_0130451 | 3300046694 | Bacteria | 1326 |
| 490 | Ga0495649_0139602 | 3300046694 | Bacteria | 1276 |
| 491 | Ga0495589_0000810 | 3300046794 | Bacteria | 19783 |
| 492 | Ga0495589_0002283 | 3300046794 | Bacteria | 10768 |
| 493 | Ga0495589_0098418 | 3300046794 | Bacteria | 1416 |
| 494 | Ga0495589_0118643 | 3300046794 | Bacteria | 1274 |
| 495 | Ga0495589_0186840 | 3300046794 | Bacteria | 981 |
| 496 | Ga0495589_0212087 | 3300046794 | Bacteria | 911 |
| 497 | Ga0495600_0000254 | 3300046809 | Bacteria | 29122 |
| 498 | Ga0495600_0085134 | 3300046809 | Bacteria | 2063 |
| 499 | Ga0495660_0001068 | 3300046810 | Bacteria | 19810 |
| 500 | Ga0495660_0005506 | 3300046810 | Bacteria | 7586 |
| 501 | Ga0495660_0007150 | 3300046810 | Bacteria | 6576 |
| 502 | Ga0495660_0009446 | 3300046810 | Bacteria | 5686 |
| 503 | Ga0495581_0114092 | 3300047315 | Bacteria | 1571 |
| 504 | Ga0495604_0044041 | 3300047317 | Bacteria | 3490 |
| 505 | Ga0495604_0065946 | 3300047317 | Bacteria | 2755 |
| 506 | Ga0495604_0370828 | 3300047317 | Bacteria | 947 |
| 507 | Ga0495636_0001853 | 3300047318 | Bacteria | 8095 |
| 508 | Ga0495636_0217654 | 3300047318 | Bacteria | 876 |
| 509 | Ga0495636_0318526 | 3300047318 | Bacteria | 730 |
| 510 | Ga0495672_0006282 | 3300047320 | Bacteria | 9253 |
| 511 | Ga0495672_0007925 | 3300047320 | Bacteria | 7920 |
| 512 | Ga0495672_0008153 | 3300047320 | Bacteria | 7773 |
| 513 | Ga0495672_0074397 | 3300047320 | Bacteria | 1913 |
| 514 | Ga0495672_0090407 | 3300047320 | Bacteria | 1682 |
| 515 | Ga0495672_0091840 | 3300047320 | Bacteria | 1665 |
| 516 | Ga0495672_0136841 | 3300047320 | Bacteria | 1283 |
| 517 | Ga0495676_0021228 | 3300047321 | Bacteria | 5677 |
| 518 | Ga0495676_0467099 | 3300047321 | Bacteria | 831 |
| 519 | Ga0495680_0049669 | 3300047322 | Bacteria | 3284 |
| 520 | Ga0495680_0339513 | 3300047322 | Bacteria | 1048 |
| 521 | Ga0495683_0001878 | 3300047323 | Bacteria | 13171 |
| 522 | Ga0495683_0004508 | 3300047323 | Bacteria | 7889 |
| 523 | Ga0495683_0004651 | 3300047323 | Bacteria | 7737 |
| 524 | Ga0495683_0027775 | 3300047323 | Bacteria | 2893 |
| 525 | Ga0495683_0033753 | 3300047323 | Bacteria | 2602 |
| 526 | Ga0495687_001655 | 3300047443 | Bacteria | 20019 |
| 527 | Ga0495687_003926 | 3300047443 | Bacteria | 10415 |
| 528 | Ga0495687_004241 | 3300047443 | Bacteria | 9826 |
| 529 | Ga0495687_004478 | 3300047443 | Bacteria | 9412 |
| 530 | Ga0495687_186795 | 3300047443 | Bacteria | 671 |
| 531 | Ga0495675_0004253 | 3300047444 | Bacteria | 8653 |
| 532 | Ga0495675_0183704 | 3300047444 | Bacteria | 1279 |
| 533 | Ga0495677_0000341 | 3300047445 | Bacteria | 20129 |
| 534 | Ga0495677_0000345 | 3300047445 | Bacteria | 20006 |
| 535 | Ga0495677_0000903 | 3300047445 | Bacteria | 11963 |
| 536 | Ga0495677_0002260 | 3300047445 | Bacteria | 7607 |
| 537 | Ga0495677_0022832 | 3300047445 | Bacteria | 2270 |
| 538 | Ga0495677_0057600 | 3300047445 | Bacteria | 1436 |
| 539 | Ga0495677_0107967 | 3300047445 | Bacteria | 1056 |
| 540 | Ga0495685_058046 | 3300047447 | Bacteria | 1306 |
| 541 | Ga0495681_0000433 | 3300047470 | Bacteria | 32077 |
| 542 | Ga0495681_0024207 | 3300047470 | Bacteria | 3205 |
| 543 | Ga0495681_0074674 | 3300047470 | Bacteria | 1528 |
| 544 | Ga0495681_0147325 | 3300047470 | Bacteria | 990 |
| 545 | Ga0495681_0251235 | 3300047470 | Bacteria | 698 |
| 546 | Ga0495686_0014408 | 3300047472 | Bacteria | 5442 |
| 547 | Ga0495686_0209756 | 3300047472 | Bacteria | 1113 |
| 548 | Ga0495686_0228157 | 3300047472 | Bacteria | 1056 |
| 549 | Ga0495686_0265890 | 3300047472 | Bacteria | 958 |
| 550 | Ga0495593_0142647 | 3300047673 | Bacteria | 1213 |
| 551 | Ga0495593_0144239 | 3300047673 | Bacteria | 1205 |
| 552 | Ga0495602_0023318 | 3300048088 | Bacteria | 6031 |
| 553 | Ga0495602_0163618 | 3300048088 | Bacteria | 1734 |
| 554 | Ga0495614_0026615 | 3300048089 | Bacteria | 2493 |
| 555 | Ga0495614_0216110 | 3300048089 | Bacteria | 870 |
| 556 | Ga0495615_0159744 | 3300048090 | Bacteria | 676 |
| 557 | Ga0495615_0210148 | 3300048090 | Bacteria | 604 |
| 558 | Ga0495626_0001232 | 3300048091 | Bacteria | 21031 |
| 559 | Ga0495626_0001350 | 3300048091 | Bacteria | 19828 |
| 560 | Ga0495626_0001486 | 3300048091 | Bacteria | 18496 |
| 561 | Ga0495626_0002957 | 3300048091 | Bacteria | 11307 |
| 562 | Ga0495626_0022241 | 3300048091 | Bacteria | 3133 |
| 563 | Ga0495626_0061554 | 3300048091 | Bacteria | 1706 |
| 564 | Ga0495626_0105519 | 3300048091 | Bacteria | 1224 |
| 565 | Ga0495626_0128737 | 3300048091 | Bacteria | 1082 |
| 566 | Ga0495626_0141878 | 3300048091 | Bacteria | 1018 |
| 567 | Ga0495626_0145909 | 3300048091 | Bacteria | 1000 |
| 568 | Ga0495626_0191849 | 3300048091 | Bacteria | 842 |
| 569 | Ga0496100_0014891 | 3300048903 | Bacteria | 4528 |
| 570 | Ga0496100_0200016 | 3300048903 | Bacteria | 1456 |
| 571 | Ga0496100_0489498 | 3300048903 | Bacteria | 947 |
| 572 | Ga0496101_0464564 | 3300048904 | Bacteria | 999 |
| 573 | Ga0496101_0616725 | 3300048904 | Bacteria | 857 |
| 574 | Ga0496102_0055619 | 3300048905 | Bacteria | 3608 |
| 575 | Ga0496102_0483656 | 3300048905 | Bacteria | 1159 |
| 576 | Ga0496103_0146428 | 3300048906 | Bacteria | 1512 |
| 577 | Ga0496103_0253287 | 3300048906 | Bacteria | 1133 |
| 578 | Ga0496104_0113476 | 3300048907 | Bacteria | 2599 |
| 579 | Ga0496104_0342833 | 3300048907 | Bacteria | 1407 |
| 580 | Ga0496104_0634320 | 3300048907 | Bacteria | 978 |
| 581 | Ga0496105_0298747 | 3300048908 | Bacteria | 1295 |
| 582 | Ga0496106_0256202 | 3300048909 | Bacteria | 1400 |
| 583 | Ga0496106_0413520 | 3300048909 | Bacteria | 1084 |
| 584 | Ga0496107_0182602 | 3300048910 | Bacteria | 1558 |
| 585 | Ga0496107_0442258 | 3300048910 | Bacteria | 966 |
| 586 | Ga0496108_0282756 | 3300048911 | Bacteria | 1444 |
| 587 | Ga0496109_0060450 | 3300048912 | Bacteria | 3462 |
| 588 | Ga0496109_0065442 | 3300048912 | Bacteria | 3328 |
| 589 | Ga0496109_0200377 | 3300048912 | Bacteria | 1876 |
| 590 | Ga0496109_0837566 | 3300048912 | Bacteria | 858 |
| 591 | Ga0496109_0841712 | 3300048912 | Bacteria | 855 |
| 592 | Ga0496110_0056337 | 3300048913 | Bacteria | 3459 |
| 593 | Ga0496110_0164307 | 3300048913 | Bacteria | 2013 |
| 594 | Ga0496110_1202746 | 3300048913 | Bacteria | 667 |
| 595 | Ga0496110_1407530 | 3300048913 | Bacteria | 607 |
| 596 | Ga0496111_0292367 | 3300048914 | Bacteria | 1208 |
| 597 | Ga0496111_0408612 | 3300048914 | Bacteria | 1003 |
| 598 | Ga0496112_1486812 | 3300048915 | Bacteria | 591 |
| 599 | Ga0496113_0104551 | 3300048916 | Bacteria | 2197 |
| 600 | Ga0496113_0358187 | 3300048916 | Bacteria | 1170 |
| 601 | Ga0496116_0014858 | 3300048919 | Bacteria | 6187 |
| 602 | Ga0496117_0003807 | 3300048920 | Bacteria | 17188 |
| 603 | Ga0496118_0004224 | 3300048921 | Bacteria | 17244 |
| 604 | Ga0496121_0003604 | 3300048924 | Bacteria | 21861 |
| 605 | Ga0496121_0010128 | 3300048924 | Bacteria | 10682 |
| 606 | Ga0496121_0293032 | 3300048924 | Bacteria | 1108 |
| 607 | Ga0496122_0004942 | 3300048925 | Bacteria | 16167 |
| 608 | Ga0496122_0009599 | 3300048925 | Bacteria | 10137 |
| 609 | Ga0496122_0010568 | 3300048925 | Bacteria | 9485 |
| 610 | Ga0496122_0011954 | 3300048925 | Bacteria | 8709 |
| 611 | Ga0496123_0007936 | 3300048926 | Bacteria | 9852 |
| 612 | Ga0496123_0071867 | 3300048926 | Bacteria | 2155 |
| 613 | Ga0496123_0091081 | 3300048926 | Bacteria | 1810 |
| 614 | Ga0496123_0169736 | 3300048926 | Bacteria | 1152 |
| 615 | Ga0496124_0089847 | 3300048927 | Bacteria | 2507 |
| 616 | Ga0496124_0182387 | 3300048927 | Bacteria | 1614 |
| 617 | Ga0496124_0223154 | 3300048927 | Bacteria | 1415 |
| 618 | Ga0496124_0457628 | 3300048927 | Bacteria | 868 |
| 619 | Ga0496124_0575250 | 3300048927 | Bacteria | 738 |
| 620 | Ga0496125_0009226 | 3300048928 | Bacteria | 10191 |
| 621 | Ga0496125_0041530 | 3300048928 | Bacteria | 3930 |
| 622 | Ga0496125_0284182 | 3300048928 | Bacteria | 1023 |
| 623 | Ga0496126_0482867 | 3300048929 | Bacteria | 993 |
| 624 | Ga0501306_035202 | 3300049127 | Bacteria | 759 |
| 625 | Ga0501308_000053 | 3300049128 | Bacteria | 4677 |
| 626 | Ga0501304_000074 | 3300049160 | Bacteria | 3452 |
| 627 | Ga0501307_000954 | 3300049162 | Bacteria | 2250 |
| 628 | Ga0495678_001224 | 3300049459 | Bacteria | 21003 |
| 629 | Ga0495678_004702 | 3300049459 | Bacteria | 7801 |
| 630 | Ga0495682_0000287 | 3300049460 | Bacteria | 39287 |
| 631 | Ga0495682_0009479 | 3300049460 | Bacteria | 3798 |
| 632 | Ga0495682_0038282 | 3300049460 | Bacteria | 1763 |
| 633 | Ga0501315_005138 | 3300049531 | Bacteria | 1406 |
| 634 | Ga0501315_015530 | 3300049531 | Bacteria | 977 |
| 635 | Ga0501322_005591 | 3300049538 | Bacteria | 874 |
| 636 | Ga0501034_0534395 | 3300049571 | Bacteria | 1083 |
| 637 | Ga0501034_0995225 | 3300049571 | Bacteria | 723 |
| 638 | Ga0501036_0388301 | 3300049572 | Bacteria | 1165 |
| 639 | Ga0501047_0298160 | 3300049581 | Bacteria | 1455 |
| 640 | Ga0501222_053753 | 3300049662 | Bacteria | 596 |
| 641 | nmdc:mga08y16_16852_c1 | 3300050511 | Bacteria | 7692 |
| 642 | Ga0495601_0009599 | 3300053077 | Bacteria | 5728 |
| 643 | Ga0500583_0312066 | 3300053092 | Bacteria | 768 |
| 644 | Ga0500572_194954 | 3300053111 | Bacteria | 664 |
| 645 | Ga0500595_046579 | 3300053119 | Bacteria | 1362 |
| 646 | Ga0500618_000779 | 3300053125 | Bacteria | 17899 |
| 647 | Ga0500574_007523 | 3300053141 | Bacteria | 2266 |
| 648 | Ga0500619_014868 | 3300053154 | Bacteria | 2103 |
| 649 | Ga0587070_004279 | 3300059491 | Bacteria | 1790 |
| 650 | Ga0587070_018456 | 3300059491 | Bacteria | 1143 |
| 651 | Ga0587077_005597 | 3300059493 | Bacteria | 1729 |
| 652 | Ga0587077_017407 | 3300059493 | Bacteria | 1224 |
| 653 | Ga0587077_035373 | 3300059493 | Bacteria | 976 |
| 654 | Ga0587080_053225 | 3300059503 | Bacteria | 770 |
| 655 | Ga0587082_006398 | 3300059504 | Bacteria | 1573 |
| 656 | Ga0587083_0001521 | 3300059505 | Bacteria | 2635 |
| 657 | Ga0587083_0047405 | 3300059505 | Bacteria | 925 |
| 658 | Ga0587083_0099772 | 3300059505 | Bacteria | 721 |
| 659 | Ga0587092_052146 | 3300059512 | Bacteria | 744 |
| 660 | Ga0587101_049906 | 3300059623 | Bacteria | 717 |
| 661 | Ga0587067_054233 | 3300059640 | Bacteria | 821 |
| 662 | Ga0587068_003728 | 3300059641 | Bacteria | 1972 |
| 663 | Ga0587068_008639 | 3300059641 | Bacteria | 1482 |
| 664 | Ga0587068_009140 | 3300059641 | Bacteria | 1452 |
| 665 | Ga0587068_017743 | 3300059641 | Bacteria | 1140 |
| 666 | Ga0587068_044656 | 3300059641 | Bacteria | 812 |
| 667 | Ga0587072_003399 | 3300059643 | Bacteria | 2233 |
| 668 | Ga0587072_011385 | 3300059643 | Bacteria | 1455 |
| 669 | Ga0587072_018573 | 3300059643 | Bacteria | 1209 |
| 670 | Ga0587076_000201 | 3300059645 | Bacteria | 4157 |
| 671 | Ga0587076_010176 | 3300059645 | Bacteria | 1352 |
| 672 | Ga0587076_066298 | 3300059645 | Bacteria | 740 |
| 673 | Ga0587078_023578 | 3300059646 | Bacteria | 792 |
| 674 | Ga0587079_002432 | 3300059647 | Bacteria | 2275 |
| 675 | Ga0587100_000135 | 3300059648 | Bacteria | 2873 |
| 676 | Ga0587100_000981 | 3300059648 | Bacteria | 1549 |
| 677 | Ga0587107_004869 | 3300059652 | Bacteria | 1391 |
| 678 | Ga0587111_0033122 | 3300060346 | Bacteria | 1066 |
| 679 | Ga0466962_0501155 | 3300061719 | Bacteria | 614 |
| 680 | 2521557857 | 2521172590 | Bacteria | 5047645 |
| 681 | 2601667169 | 2600255292 | Bacteria | 6300551 |
| 682 | 2643787962 | 2643221554 | Bacteria | 6603920 |
| 683 | 2809147745 | 2808606418 | Bacteria | 6724496 |
| 684 | 2809150780 | 2808606419 | Bacteria | 4576925 |
| 685 | 2819540726 | 2818991436 | Bacteria | 5376622 |
| 686 | 2852622298 | 2852618963 | Bacteria | 4577824 |
| 687 | 2857553199 | 2857547612 | Bacteria | 6179999 |
| 688 | 2885080325 | 2885080285 | Bacteria | 6355622 |
| 689 | 2919481473 | 2919476304 | Bacteria | 5888696 |
| 690 | 2932416669 | 2932410948 | Bacteria | 6312192 |
| 691 | 2932422416 | 2932416698 | Bacteria | 6315112 |
| 692 | Ga0307416_100605782 | |||
| 693 | JGI25158J39367_1000578 | |||
| 694 | JGI25152J39213_1005039 | |||
| 695 | JGI25150J39212_1000509 | |||
| 696 | JGI25150J39212_1001656 | |||
| 697 | JGI25159J45721_1003229 | |||
| 698 | JGI25159J45721_1015699 | |||
| 699 | JGI25153J46596_10007048 | |||
| 700 | JGI25160J50197_1025127 | |||
| 701 | JGI25161J50226_1003175 | |||
| 702 | JGI25161J50226_1005709 | |||
| 703 | Ga0055538_1000002 | |||
| 704 | Ga0055539_1000002 | |||
| 705 | Ga0055533_1000004 | |||
| 706 | Ga0055525_1000002 | |||
| 707 | Ga0055542_1025791 | |||
| 708 | Ga0055526_1004169 | |||
| 709 | Ga0055526_1006747 | |||
| 710 | Ga0055537_1003209 | |||
| 711 | Ga0055524_1004765 | |||
| 712 | Ga0055524_1005260 | |||
| 713 | Ga0055524_1017011 | |||
| 714 | Ga0055534_1003757 | |||
| 715 | Ga0055528_1005492 | |||
| 716 | Ga0055530_10005444 | |||
| 717 | Ga0055530_10010016 | |||
| 718 | Ga0055530_10017989 | |||
| 719 | Ga0055531_10015533 | |||
| 720 | Ga0055541_1000002 | |||
| 721 | Ga0055541_1000043 | |||
| 722 | Ga0055543_1000518 | |||
| 723 | Ga0055543_1077650 | |||
| 724 | Ga0065165_1001717 | |||
| 725 | Ga0065165_1162550 | |||
| 726 | Ga0070658_10216907 | |||
| 727 | Ga0070676_10482501 | |||
| 728 | Ga0070683_101884753 | |||
| 729 | Ga0068869_101848552 | |||
| 730 | Ga0068869_102025119 | |||
| 731 | Ga0070680_100335884 | |||
| 732 | Ga0068868_101909078 | |||
| 733 | Ga0070660_100309320 | |||
| 734 | Ga0070660_100340308 | |||
| 735 | Ga0070660_100341887 | |||
| 736 | Ga0070660_100984305 | |||
| 737 | Ga0070675_100765352 | |||
| 738 | Ga0070659_100241668 | |||
| 739 | Ga0070662_100245715 | |||
| 740 | Ga0068853_101008241 | |||
| 741 | Ga0070672_100421381 | |||
| 742 | Ga0068855_100229074 | |||
| 743 | Ga0068855_100336816 | |||
| 744 | Ga0068855_100677306 | |||
| 745 | Ga0068855_101952588 | |||
| 746 | Ga0068857_100217477 | |||
| 747 | Ga0068857_101141948 | |||
| 748 | Ga0068854_100389309 | |||
| 749 | Ga0068856_101234158 | |||
| 750 | Ga0068852_100048813 | |||
| 751 | Ga0068851_10196460 | |||
| 752 | Ga0081539_10175986 | |||
| 753 | Ga0075363_100065324 | |||
| 754 | Ga0075362_10006557 | |||
| 755 | Ga0068871_101328346 | |||
| 756 | Ga0105244_10002419 | |||
| 757 | Ga0105244_10079813 | |||
| 758 | Ga0105245_10064167 | |||
| 759 | Ga0105243_10171459 | |||
| 760 | Ga0105241_10070405 | |||
| 761 | Ga0105242_10295346 | |||
| 762 | Ga0105248_13188084 | |||
| 763 | Ga0105237_10098555 | |||
| 764 | Ga0105237_10110075 | |||
| 765 | Ga0105238_10425902 | |||
| 766 | Ga0105239_10256194 | |||
| 767 | Ga0105239_12399031 | |||
| 768 | Ga0105246_10081174 | |||
| 769 | Ga0157327_1030384 | |||
| 770 | Ga0157373_10194288 | |||
| 771 | Ga0157371_11092390 | |||
| 772 | Ga0157370_10638962 | |||
| 773 | Ga0157374_10342786 | |||
| 774 | Ga0157378_10697203 | |||
| 775 | Ga0157372_12095516 | |||
| 776 | Ga0157375_10524197 | |||
| 777 | Ga0182008_10001536 | |||
| 778 | Ga0182006_1001143 | |||
| 779 | Ga0182006_1008837 | |||
| 780 | Ga0182007_10000877 | |||
| 781 | Ga0182007_10007549 | |||
| 782 | Ga0182005_1000619 | |||
| 783 | Ga0182005_1000667 | |||
| 784 | Ga0182005_1000793 | |||
| 785 | Ga0163161_10006789 | |||
| 786 | Ga0163161_10012970 | |||
| 787 | Ga0163161_10550204 | |||
| 788 | Ga0213872_10002773 | |||
| 789 | Ga0209436_100313 | |||
| 790 | Ga0209436_107678 | |||
| 791 | Ga0209784_100002 | |||
| 792 | Ga0209784_100004 | |||
| 793 | Ga0209566_100003 | |||
| 794 | Ga0209566_100004 | |||
| 795 | Ga0209674_100004 | |||
| 796 | Ga0209674_100006 | |||
| 797 | Ga0209563_100006 | |||
| 798 | Ga0209563_100009 | |||
| 799 | Ga0207427_100887 | |||
| 800 | Ga0209437_100004 | |||
| 801 | Ga0207425_1000588 | |||
| 802 | Ga0207425_1001602 | |||
| 803 | Ga0207425_1034855 | |||
| 804 | Ga0209677_100003 | |||
| 805 | Ga0209677_100005 | |||
| 806 | Ga0209148_1000948 | |||
| 807 | Ga0209129_1000722 | |||
| 808 | Ga0209129_1007515 | |||
| 809 | Ga0209129_1014595 | |||
| 810 | Ga0209129_1041744 | |||
| 811 | Ga0209233_1000005 | |||
| 812 | Ga0209565_1001735 | |||
| 813 | Ga0209673_1029848 | |||
| 814 | Ga0209673_1125077 | |||
| 815 | Ga0209130_1001107 | |||
| 816 | Ga0209130_1002788 | |||
| 817 | Ga0209675_1005968 | |||
| 818 | Ga0209675_1010959 | |||
| 819 | Ga0209564_1001069 | |||
| 820 | Ga0209564_1003957 | |||
| 821 | Ga0209758_1002100 | |||
| 822 | Ga0209050_1001138 | |||
| 823 | Ga0209050_1005947 | |||
| 824 | Ga0209256_1001697 | |||
| 825 | Ga0209256_1003025 | |||
| 826 | Ga0209256_1005137 | |||
| 827 | Ga0209256_1005283 | |||
| 828 | Ga0207426_1014480 | |||
| 829 | Ga0209051_1044737 | |||
| 830 | Ga0209257_1001218 | |||
| 831 | Ga0209257_1018630 | |||
| 832 | Ga0207656_10131508 | |||
| 833 | Ga0207705_10002296 | |||
| 834 | Ga0207705_10328443 | |||
| 835 | Ga0207654_10002735 | |||
| 836 | Ga0207695_10000475 | |||
| 837 | Ga0207695_10360875 | |||
| 838 | Ga0207671_10013593 | |||
| 839 | Ga0207671_10919763 | |||
| 840 | Ga0207657_10164045 | |||
| 841 | Ga0207657_10867826 | |||
| 842 | Ga0207657_11035412 | |||
| 843 | Ga0207694_10020740 | |||
| 844 | Ga0207694_11296194 | |||
| 845 | Ga0207650_10304890 | |||
| 846 | Ga0207659_10555746 | |||
| 847 | Ga0207687_10481971 | |||
| 848 | Ga0207690_10022573 | |||
| 849 | Ga0207690_10253846 | |||
| 850 | Ga0207706_10257352 | |||
| 851 | Ga0207706_10463222 | |||
| 852 | Ga0207686_10113670 | |||
| 853 | Ga0207709_10078106 | |||
| 854 | Ga0207679_10971482 | |||
| 855 | Ga0207667_10000025 | |||
| 856 | Ga0207667_10003222 | |||
| 857 | Ga0207667_10124041 | |||
| 858 | Ga0207702_11844499 | |||
| 859 | Ga0207648_10822331 | |||
| 860 | Ga0207674_11104449 | |||
| 861 | Ga0207674_11296777 | |||
| 862 | Ga0207683_10804677 | |||
| 863 | Ga0207698_10397491 | |||
| 864 | Ga0209281_1013917 | |||
| 865 | Ga0207428_10023263 | |||
| 866 | Ga0307408_100000973 | |||
| 867 | Ga0307408_100024850 | |||
| 868 | Ga0307408_100118713 | |||
| 869 | Ga0307408_101803214 | |||
| 870 | Ga0307518_10045141 | |||
| 871 | Ga0307414_10088716 | |||
| 872 | Ga0395899_0008066 | |||
| 873 | Ga0395899_0032076 | |||
| 874 | Ga0395899_0082799 | |||
| 875 | Ga0395899_0444314 | |||
| 876 | Ga0395899_0503358 | |||
| 877 | Ga0395900_0002082 | |||
| 878 | Ga0395900_0006153 | |||
| 879 | Ga0395900_0011090 | |||
| 880 | Ga0395900_0014146 | |||
| 881 | Ga0395900_0022691 | |||
| 882 | Ga0395900_0078262 | |||
| 883 | Ga0395900_0139377 | |||
| 884 | Ga0395900_0220533 | |||
| 885 | Ga0395900_0486826 | |||
| 886 | Ga0395900_1580083 | |||
| 887 | Ga0395900_1687429 | |||
| 888 | Ga0395898_0111383 | |||
| 889 | Ga0395898_0322613 | |||
| 890 | Ga0395898_0458011 | |||
| 891 | Ga0395898_0653895 | |||
| 892 | Ga0395898_0749210 | |||
| 893 | Ga0395898_0761538 | |||
| 894 | Ga0395898_1559177 | |||
| 895 | Ga0395905_0132477 | |||
| 896 | Ga0395905_0175747 | |||
| 897 | Ga0395905_0356374 | |||
| 898 | Ga0395905_0358621 | |||
| 899 | Ga0395905_0756524 | |||
| 900 | Ga0395905_0921035 | |||
| 901 | Ga0395905_1226885 | |||
| 902 | Ga0395905_1557662 | |||
| 903 | Ga0395901_0037857 | |||
| 904 | Ga0395901_0053700 | |||
| 905 | Ga0395901_0095957 | |||
| 906 | Ga0395901_0940856 | |||
| 907 | Ga0395901_1414612 | |||
| 908 | Ga0436361_0441966 | |||
| 909 | Ga0439450_014298 | |||
| 910 | Ga0439455_0035734 | |||
| 911 | Ga0450911_005124 | |||
| 912 | Ga0450923_167109 | |||
| 913 | Ga0439458_0010255 | |||
| 914 | Ga0439458_0017830 | |||
| 915 | Ga0439458_0024586 | |||
| 916 | Ga0466969_0166534 | |||
| 917 | Ga0466969_0294178 | |||
| 918 | Ga0466969_0475361 | |||
| 919 | Ga0466972_0127143 | |||
| 920 | Ga0466972_0176410 | |||
| 921 | Ga0466965_0218349 | |||
| 922 | Ga0466965_0812545 | |||
| 923 | Ga0466966_0008013 | |||
| 924 | Ga0466966_0104589 | |||
| 925 | Ga0466966_0324114 | |||
| 926 | Ga0466966_0382674 | |||
| 927 | Ga0466966_0545691 | |||
| 928 | Ga0466961_0253867 | |||
| 929 | Ga0466961_0438180 | |||
| 930 | Ga0466963_0302341 | |||
| 931 | Ga0466963_0832069 | |||
| 932 | Ga0466964_0001242 | |||
| 933 | Ga0466964_0162664 | |||
| 934 | Ga0453684_0147550 | |||
| 935 | Ga0466971_0218208 | |||
| 936 | Ga0466971_0372295 | |||
| 937 | Ga0466968_0001885 | |||
| 938 | Ga0466968_0157702 | |||
| 939 | Ga0466970_0505460 | |||
| 940 | Ga0466960_0264370 | |||
| 941 | Ga0466960_0801366 | |||
| 942 | Ga0466959_0306268 | |||
| 943 | Ga0466959_0485726 | |||
| 944 | Ga0466959_0620807 | |||
| 945 | Ga0466959_0662313 | |||
| 946 | Ga0451576_1645749 | |||
| 947 | Ga0466958_0182869 | |||
| 948 | Ga0466958_0470566 | |||
| 949 | Ga0466967_0076531 | |||
| 950 | Ga0495617_002155 | |||
| 951 | Ga0495627_000872 | |||
| 952 | Ga0495627_002769 | |||
| 953 | Ga0495627_064645 | |||
| 954 | Ga0495603_0124494 | |||
| 955 | Ga0495590_0049511 | |||
| 956 | Ga0495591_003691 | |||
| 957 | Ga0495629_0274928 | |||
| 958 | Ga0495638_0297938 | |||
| 959 | Ga0495651_0302355 | |||
| 960 | Ga0495653_0062640 | |||
| 961 | Ga0495653_0460432 | |||
| 962 | Ga0495650_0001092 | |||
| 963 | Ga0495650_0092726 | |||
| 964 | Ga0495580_0006528 | |||
| 965 | Ga0495582_0004946 | |||
| 966 | Ga0495582_0019535 | |||
| 967 | Ga0495605_0000948 | |||
| 968 | Ga0495605_0004587 | |||
| 969 | Ga0495605_0138953 | |||
| 970 | Ga0495605_0154689 | |||
| 971 | Ga0495605_0209945 | |||
| 972 | Ga0495639_0222641 | |||
| 973 | Ga0495584_0001330 | |||
| 974 | Ga0495584_0004346 | |||
| 975 | Ga0495584_0013455 | |||
| 976 | Ga0495584_0019925 | |||
| 977 | Ga0495584_0095724 | |||
| 978 | Ga0495584_0133682 | |||
| 979 | Ga0495584_0153740 | |||
| 980 | Ga0495584_0167006 | |||
| 981 | Ga0495584_0170679 | |||
| 982 | Ga0495584_0306562 | |||
| 983 | Ga0495585_0000775 | |||
| 984 | Ga0495585_0002380 | |||
| 985 | Ga0495585_0002489 | |||
| 986 | Ga0495585_0005664 | |||
| 987 | Ga0495585_0023187 | |||
| 988 | Ga0495585_0073957 | |||
| 989 | Ga0495585_0096797 | |||
| 990 | Ga0495585_0114729 | |||
| 991 | Ga0495585_0164641 | |||
| 992 | Ga0495585_0195842 | |||
| 993 | Ga0495594_0014358 | |||
| 994 | Ga0495594_0318350 | |||
| 995 | Ga0495594_0566491 | |||
| 996 | Ga0495596_0004425 | |||
| 997 | Ga0495596_0008004 | |||
| 998 | Ga0495596_0046330 | |||
| 999 | Ga0495596_0104956 | |||
| 1000 | Ga0495596_0135318 | |||
| 1001 | Ga0495607_0002716 | |||
| 1002 | Ga0495607_0002910 | |||
| 1003 | Ga0495607_0003111 | |||
| 1004 | Ga0495607_0003999 | |||
| 1005 | Ga0495607_0007153 | |||
| 1006 | Ga0495607_0008423 | |||
| 1007 | Ga0495607_0022476 | |||
| 1008 | Ga0495607_0036749 | |||
| 1009 | Ga0495607_0137111 | |||
| 1010 | Ga0495607_0138196 | |||
| 1011 | Ga0495607_0313687 | |||
| 1012 | Ga0495583_0001441 | |||
| 1013 | Ga0495583_0001454 | |||
| 1014 | Ga0495583_0006351 | |||
| 1015 | Ga0495583_0107738 | |||
| 1016 | Ga0495583_0121795 | |||
| 1017 | Ga0495606_0001574 | |||
| 1018 | Ga0495606_0030905 | |||
| 1019 | Ga0495606_0083463 | |||
| 1020 | Ga0495606_0319966 | |||
| 1021 | Ga0495608_0004883 | |||
| 1022 | Ga0495610_0019752 | |||
| 1023 | Ga0495616_0002069 | |||
| 1024 | Ga0495616_0002194 | |||
| 1025 | Ga0495616_0003846 | |||
| 1026 | Ga0495616_0006858 | |||
| 1027 | Ga0495616_0020368 | |||
| 1028 | Ga0495616_0024465 | |||
| 1029 | Ga0495616_0027122 | |||
| 1030 | Ga0495616_0062566 | |||
| 1031 | Ga0495618_0030712 | |||
| 1032 | Ga0495628_0008806 | |||
| 1033 | Ga0495630_0254966 | |||
| 1034 | Ga0495631_0007994 | |||
| 1035 | Ga0495631_0011269 | |||
| 1036 | Ga0495631_0025604 | |||
| 1037 | Ga0495631_0043848 | |||
| 1038 | Ga0495631_0102437 | |||
| 1039 | Ga0495631_0163068 | |||
| 1040 | Ga0495632_0001583 | |||
| 1041 | Ga0495632_0007738 | |||
| 1042 | Ga0495632_0021346 | |||
| 1043 | Ga0495632_0105999 | |||
| 1044 | Ga0495637_0003984 | |||
| 1045 | Ga0495637_0116523 | |||
| 1046 | Ga0495643_0001730 | |||
| 1047 | Ga0495643_0004146 | |||
| 1048 | Ga0495643_0031616 | |||
| 1049 | Ga0495643_0033760 | |||
| 1050 | Ga0495643_0087120 | |||
| 1051 | Ga0495643_0191701 | |||
| 1052 | Ga0495644_0000127 | |||
| 1053 | Ga0495644_0008334 | |||
| 1054 | Ga0495644_0019918 | |||
| 1055 | Ga0495644_0020234 | |||
| 1056 | Ga0495644_0058690 | |||
| 1057 | Ga0495644_0060619 | |||
| 1058 | Ga0495644_0096388 | |||
| 1059 | Ga0495648_0003645 | |||
| 1060 | Ga0495648_0007369 | |||
| 1061 | Ga0495648_0008176 | |||
| 1062 | Ga0495648_0044179 | |||
| 1063 | Ga0495648_0069350 | |||
| 1064 | Ga0495663_0098891 | |||
| 1065 | Ga0495666_0006575 | |||
| 1066 | Ga0495666_0152381 | |||
| 1067 | Ga0495642_0002195 | |||
| 1068 | Ga0495642_0003161 | |||
| 1069 | Ga0495642_0003572 | |||
| 1070 | Ga0495642_0022397 | |||
| 1071 | Ga0495642_0120058 | |||
| 1072 | Ga0495642_0134223 | |||
| 1073 | Ga0495642_0315796 | |||
| 1074 | Ga0495642_0407978 | |||
| 1075 | Ga0495652_0172819 | |||
| 1076 | Ga0495654_0008955 | |||
| 1077 | Ga0495654_0063156 | |||
| 1078 | Ga0495654_0073298 | |||
| 1079 | Ga0495654_0159538 | |||
| 1080 | Ga0495654_0184231 | |||
| 1081 | Ga0495665_0003695 | |||
| 1082 | Ga0495586_0012303 | |||
| 1083 | Ga0495586_0225912 | |||
| 1084 | Ga0495587_0021626 | |||
| 1085 | Ga0495609_0000373 | |||
| 1086 | Ga0495609_0001008 | |||
| 1087 | Ga0495609_0001055 | |||
| 1088 | Ga0495609_0002502 | |||
| 1089 | Ga0495609_0057413 | |||
| 1090 | Ga0495609_0057807 | |||
| 1091 | Ga0495609_0078259 | |||
| 1092 | Ga0495621_0028684 | |||
| 1093 | Ga0495597_0007625 | |||
| 1094 | Ga0495597_0014544 | |||
| 1095 | Ga0495597_0063794 | |||
| 1096 | Ga0495597_0358751 | |||
| 1097 | Ga0495645_0043107 | |||
| 1098 | Ga0495645_0118174 | |||
| 1099 | Ga0495645_0144668 | |||
| 1100 | Ga0495622_0000496 | |||
| 1101 | Ga0495622_0012529 | |||
| 1102 | Ga0495622_0017769 | |||
| 1103 | Ga0495622_0169217 | |||
| 1104 | Ga0495633_0003417 | |||
| 1105 | Ga0495633_0005842 | |||
| 1106 | Ga0495633_0017395 | |||
| 1107 | Ga0495633_0017460 | |||
| 1108 | Ga0495633_0052117 | |||
| 1109 | Ga0495633_0104713 | |||
| 1110 | Ga0495633_0161307 | |||
| 1111 | Ga0495633_0200093 | |||
| 1112 | Ga0495633_0285130 | |||
| 1113 | Ga0495656_0223029 | |||
| 1114 | Ga0495656_0263087 | |||
| 1115 | Ga0495668_0006426 | |||
| 1116 | Ga0495668_0010902 | |||
| 1117 | Ga0495668_0014280 | |||
| 1118 | Ga0495668_0072899 | |||
| 1119 | Ga0495668_0078434 | |||
| 1120 | Ga0495668_0195538 | |||
| 1121 | Ga0495668_0261462 | |||
| 1122 | Ga0495634_0023974 | |||
| 1123 | Ga0495611_0002725 | |||
| 1124 | Ga0495611_0002915 | |||
| 1125 | Ga0495611_0058276 | |||
| 1126 | Ga0495611_0078529 | |||
| 1127 | Ga0495611_0135275 | |||
| 1128 | Ga0495611_0240994 | |||
| 1129 | Ga0495625_0188611 | |||
| 1130 | Ga0495625_0200807 | |||
| 1131 | Ga0495635_0097145 | |||
| 1132 | Ga0495635_0328664 | |||
| 1133 | Ga0495659_0214836 | |||
| 1134 | Ga0495661_0001429 | |||
| 1135 | Ga0495661_0001902 | |||
| 1136 | Ga0495661_0002729 | |||
| 1137 | Ga0495661_0006660 | |||
| 1138 | Ga0495661_0008899 | |||
| 1139 | Ga0495661_0011128 | |||
| 1140 | Ga0495661_0011988 | |||
| 1141 | Ga0495661_0027742 | |||
| 1142 | Ga0495661_0027847 | |||
| 1143 | Ga0495661_0042205 | |||
| 1144 | Ga0495661_0105894 | |||
| 1145 | Ga0495661_0161915 | |||
| 1146 | Ga0495661_0209886 | |||
| 1147 | Ga0495661_0272261 | |||
| 1148 | Ga0495661_0286650 | |||
| 1149 | Ga0495661_0290923 | |||
| 1150 | Ga0495661_0292055 | |||
| 1151 | Ga0495588_0000484 | |||
| 1152 | Ga0495588_0084419 | |||
| 1153 | Ga0495588_0329324 | |||
| 1154 | Ga0495588_0333575 | |||
| 1155 | Ga0495599_0114123 | |||
| 1156 | Ga0495599_0431462 | |||
| 1157 | Ga0495623_0123378 | |||
| 1158 | Ga0495623_0150100 | |||
| 1159 | Ga0495646_0003851 | |||
| 1160 | Ga0495646_0095438 | |||
| 1161 | Ga0495658_0401568 | |||
| 1162 | Ga0495669_0001252 | |||
| 1163 | Ga0495669_0003814 | |||
| 1164 | Ga0495669_0017924 | |||
| 1165 | Ga0495669_0056504 | |||
| 1166 | Ga0495613_0217959 | |||
| 1167 | Ga0495613_0418513 | |||
| 1168 | Ga0495624_0012132 | |||
| 1169 | Ga0495670_0001826 | |||
| 1170 | Ga0495670_0004671 | |||
| 1171 | Ga0495670_0022311 | |||
| 1172 | Ga0495670_0026447 | |||
| 1173 | Ga0495670_0180871 | |||
| 1174 | Ga0495670_0187105 | |||
| 1175 | Ga0495670_0341986 | |||
| 1176 | Ga0495671_0000737 | |||
| 1177 | Ga0495671_0056034 | |||
| 1178 | Ga0495649_0005694 | |||
| 1179 | Ga0495649_0023930 | |||
| 1180 | Ga0495649_0130451 | |||
| 1181 | Ga0495649_0139602 | |||
| 1182 | Ga0495589_0000810 | |||
| 1183 | Ga0495589_0002283 | |||
| 1184 | Ga0495589_0098418 | |||
| 1185 | Ga0495589_0118643 | |||
| 1186 | Ga0495589_0186840 | |||
| 1187 | Ga0495589_0212087 | |||
| 1188 | Ga0495600_0000254 | |||
| 1189 | Ga0495600_0085134 | |||
| 1190 | Ga0495660_0001068 | |||
| 1191 | Ga0495660_0005506 | |||
| 1192 | Ga0495660_0007150 | |||
| 1193 | Ga0495660_0009446 | |||
| 1194 | Ga0495581_0114092 | |||
| 1195 | Ga0495604_0044041 | |||
| 1196 | Ga0495604_0065946 | |||
| 1197 | Ga0495604_0370828 | |||
| 1198 | Ga0495636_0001853 | |||
| 1199 | Ga0495636_0217654 | |||
| 1200 | Ga0495636_0318526 | |||
| 1201 | Ga0495672_0006282 | |||
| 1202 | Ga0495672_0007925 | |||
| 1203 | Ga0495672_0008153 | |||
| 1204 | Ga0495672_0074397 | |||
| 1205 | Ga0495672_0090407 | |||
| 1206 | Ga0495672_0091840 | |||
| 1207 | Ga0495672_0136841 | |||
| 1208 | Ga0495676_0021228 | |||
| 1209 | Ga0495676_0467099 | |||
| 1210 | Ga0495680_0049669 | |||
| 1211 | Ga0495680_0339513 | |||
| 1212 | Ga0495683_0001878 | |||
| 1213 | Ga0495683_0004508 | |||
| 1214 | Ga0495683_0004651 | |||
| 1215 | Ga0495683_0027775 | |||
| 1216 | Ga0495683_0033753 | |||
| 1217 | Ga0495687_001655 | |||
| 1218 | Ga0495687_003926 | |||
| 1219 | Ga0495687_004241 | |||
| 1220 | Ga0495687_004478 | |||
| 1221 | Ga0495687_186795 | |||
| 1222 | Ga0495675_0004253 | |||
| 1223 | Ga0495675_0183704 | |||
| 1224 | Ga0495677_0000341 | |||
| 1225 | Ga0495677_0000345 | |||
| 1226 | Ga0495677_0000903 | |||
| 1227 | Ga0495677_0002260 | |||
| 1228 | Ga0495677_0022832 | |||
| 1229 | Ga0495677_0057600 | |||
| 1230 | Ga0495677_0107967 | |||
| 1231 | Ga0495685_058046 | |||
| 1232 | Ga0495681_0000433 | |||
| 1233 | Ga0495681_0024207 | |||
| 1234 | Ga0495681_0074674 | |||
| 1235 | Ga0495681_0147325 | |||
| 1236 | Ga0495681_0251235 | |||
| 1237 | Ga0495686_0014408 | |||
| 1238 | Ga0495686_0209756 | |||
| 1239 | Ga0495686_0228157 | |||
| 1240 | Ga0495686_0265890 | |||
| 1241 | Ga0495593_0142647 | |||
| 1242 | Ga0495593_0144239 | |||
| 1243 | Ga0495602_0023318 | |||
| 1244 | Ga0495602_0163618 | |||
| 1245 | Ga0495614_0026615 | |||
| 1246 | Ga0495614_0216110 | |||
| 1247 | Ga0495615_0159744 | |||
| 1248 | Ga0495615_0210148 | |||
| 1249 | Ga0495626_0001232 | |||
| 1250 | Ga0495626_0001350 | |||
| 1251 | Ga0495626_0001486 | |||
| 1252 | Ga0495626_0002957 | |||
| 1253 | Ga0495626_0022241 | |||
| 1254 | Ga0495626_0061554 | |||
| 1255 | Ga0495626_0105519 | |||
| 1256 | Ga0495626_0128737 | |||
| 1257 | Ga0495626_0141878 | |||
| 1258 | Ga0495626_0145909 | |||
| 1259 | Ga0495626_0191849 | |||
| 1260 | Ga0496100_0014891 | |||
| 1261 | Ga0496100_0200016 | |||
| 1262 | Ga0496100_0489498 | |||
| 1263 | Ga0496101_0464564 | |||
| 1264 | Ga0496101_0616725 | |||
| 1265 | Ga0496102_0055619 | |||
| 1266 | Ga0496102_0483656 | |||
| 1267 | Ga0496103_0146428 | |||
| 1268 | Ga0496103_0253287 | |||
| 1269 | Ga0496104_0113476 | |||
| 1270 | Ga0496104_0342833 | |||
| 1271 | Ga0496104_0634320 | |||
| 1272 | Ga0496105_0298747 | |||
| 1273 | Ga0496106_0256202 | |||
| 1274 | Ga0496106_0413520 | |||
| 1275 | Ga0496107_0182602 | |||
| 1276 | Ga0496107_0442258 | |||
| 1277 | Ga0496108_0282756 | |||
| 1278 | Ga0496109_0060450 | |||
| 1279 | Ga0496109_0065442 | |||
| 1280 | Ga0496109_0200377 | |||
| 1281 | Ga0496109_0837566 | |||
| 1282 | Ga0496109_0841712 | |||
| 1283 | Ga0496110_0056337 | |||
| 1284 | Ga0496110_0164307 | |||
| 1285 | Ga0496110_1202746 | |||
| 1286 | Ga0496110_1407530 | |||
| 1287 | Ga0496111_0292367 | |||
| 1288 | Ga0496111_0408612 | |||
| 1289 | Ga0496112_1486812 | |||
| 1290 | Ga0496113_0104551 | |||
| 1291 | Ga0496113_0358187 | |||
| 1292 | Ga0496116_0014858 | |||
| 1293 | Ga0496117_0003807 | |||
| 1294 | Ga0496118_0004224 | |||
| 1295 | Ga0496121_0003604 | |||
| 1296 | Ga0496121_0010128 | |||
| 1297 | Ga0496121_0293032 | |||
| 1298 | Ga0496122_0004942 | |||
| 1299 | Ga0496122_0009599 | |||
| 1300 | Ga0496122_0010568 | |||
| 1301 | Ga0496122_0011954 | |||
| 1302 | Ga0496123_0007936 | |||
| 1303 | Ga0496123_0071867 | |||
| 1304 | Ga0496123_0091081 | |||
| 1305 | Ga0496123_0169736 | |||
| 1306 | Ga0496124_0089847 | |||
| 1307 | Ga0496124_0182387 | |||
| 1308 | Ga0496124_0223154 | |||
| 1309 | Ga0496124_0457628 | |||
| 1310 | Ga0496124_0575250 | |||
| 1311 | Ga0496125_0009226 | |||
| 1312 | Ga0496125_0041530 | |||
| 1313 | Ga0496125_0284182 | |||
| 1314 | Ga0496126_0482867 | |||
| 1315 | Ga0501306_035202 | |||
| 1316 | Ga0501308_000053 | |||
| 1317 | Ga0501304_000074 | |||
| 1318 | Ga0501307_000954 | |||
| 1319 | Ga0495678_001224 | |||
| 1320 | Ga0495678_004702 | |||
| 1321 | Ga0495682_0000287 | |||
| 1322 | Ga0495682_0009479 | |||
| 1323 | Ga0495682_0038282 | |||
| 1324 | Ga0501315_005138 | |||
| 1325 | Ga0501315_015530 | |||
| 1326 | Ga0501322_005591 | |||
| 1327 | Ga0501034_0534395 | |||
| 1328 | Ga0501034_0995225 | |||
| 1329 | Ga0501036_0388301 | |||
| 1330 | Ga0501047_0298160 | |||
| 1331 | Ga0501222_053753 | |||
| 1332 | nmdc:mga08y16_16852_c1 | |||
| 1333 | Ga0495601_0009599 | |||
| 1334 | Ga0500583_0312066 | |||
| 1335 | Ga0500572_194954 | |||
| 1336 | Ga0500595_046579 | |||
| 1337 | Ga0500618_000779 | |||
| 1338 | Ga0500574_007523 | |||
| 1339 | Ga0500619_014868 | |||
| 1340 | Ga0587070_004279 | |||
| 1341 | Ga0587070_018456 | |||
| 1342 | Ga0587077_005597 | |||
| 1343 | Ga0587077_017407 | |||
| 1344 | Ga0587077_035373 | |||
| 1345 | Ga0587080_053225 | |||
| 1346 | Ga0587082_006398 | |||
| 1347 | Ga0587083_0001521 | |||
| 1348 | Ga0587083_0047405 | |||
| 1349 | Ga0587083_0099772 | |||
| 1350 | Ga0587092_052146 | |||
| 1351 | Ga0587101_049906 | |||
| 1352 | Ga0587067_054233 | |||
| 1353 | Ga0587068_003728 | |||
| 1354 | Ga0587068_008639 | |||
| 1355 | Ga0587068_009140 | |||
| 1356 | Ga0587068_017743 | |||
| 1357 | Ga0587068_044656 | |||
| 1358 | Ga0587072_003399 | |||
| 1359 | Ga0587072_011385 | |||
| 1360 | Ga0587072_018573 | |||
| 1361 | Ga0587076_000201 | |||
| 1362 | Ga0587076_010176 | |||
| 1363 | Ga0587076_066298 | |||
| 1364 | Ga0587078_023578 | |||
| 1365 | Ga0587079_002432 | |||
| 1366 | Ga0587100_000135 | |||
| 1367 | Ga0587100_000981 | |||
| 1368 | Ga0587107_004869 | |||
| 1369 | Ga0587111_0033122 | |||
| 1370 | Ga0466962_0501155 | |||
| 1371 | 2521557857 | |||
| 1372 | 2601667169 | |||
| 1373 | 2643787962 | |||
| 1374 | 2809147745 | |||
| 1375 | 2809150780 | |||
| 1376 | 2819540726 | |||
| 1377 | 2852622298 | |||
| 1378 | 2857553199 | |||
| 1379 | 2885080325 | |||
| 1380 | 2919481473 | |||
| 1381 | 2932416669 | |||
| 1382 | 2932422416 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2plk-assembly1.cif.gz_A | crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus | 0.656 | 11 | 35 |
| 2j8q-assembly1.cif.gz_A | crystal structure of human cleavage and polyadenylation specificity factor 5 (cpsf5) in complex with a sulphate ion. | 0.6343 | 7 | 33 |
| 1x0g-assembly1.cif.gz_A | crystal structure of isca with the [2fe-2s] cluster | 0.6286 | 8 | 107 |
| 3q2s-assembly1.cif.gz_B | crystal structure of cfim68 rrm/cfim25 complex | 0.6177 | 7 | 33 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.6163 | 8 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53744_16_113_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9182 | 18 | 110 | 2.60.300.12 |
| af_O53744_16_113_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8645 | 18 | 110 | 2.60.300.12 |
| af_O96161_49_160_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.666 | 8 | 110 | 2.60.300.12 |
| af_D4A4L5_49_154_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.6651 | 8 | 106 | 2.60.300.12 |
| 1x0gA00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.6286 | 8 | 107 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C8LIF5-F1-model_v4 | DUF779 domain-containing protein | 0.9802 | 45 | 111 |
|
| AF-A0A6N4U5X5-F1-model_v4 | deleted | 0.9711 | 5 | 122 |
|
| AF-A0A7Y5UDI1-F1-model_v4 | deleted | 0.9706 | 5 | 121 |
|
| AF-A0A1E7X869-F1-model_v4 | DUF779 domain-containing protein | 0.9706 | 45 | 117 |
|
| AF-A0A2E9G6M5-F1-model_v4 | deleted | 0.9704 | 5 | 117 |
|