F475514

General Info

Members Datasets Scaffolds Average Seq Length
691 366 1382 236

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10001024|Ga0099795_100010245
Length 272
Sequence MGLAKMQIVPFDDAPEEGESEVDMRARPEELRLLEAMLFASAEPLAEKELAERLPQGVDVHAALVRLQLEYAPRGVNLVSVGGKWTYRTASDLAWLLSKESVESRKLSRAAIETLAIIAYHQPVTRTEIEEIRGVSTSKGSLDVLLQTGWVRPRGRRKAPGRPVTYGTTDAFLSHFGLDGVGDLPGLDELKGSGLLDGRLPAGFSVPLPSDDPTLREDEDPLEPGDLDLGLAPPAERIAEDSGEESSQPKNADGESPAVEDAXXESEPRNPG

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
336 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
337 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
338 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
348 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
349 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
358 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
359 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
360 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
361 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
362 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
363 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
364 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
365 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
366 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.14
Nodule 1.16
Rhizoplane 12.16
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10001024 3300007788 Bacteria 5761
2 JGI24034J26672_10005847 3300002239 Bacteria 1770
3 JGI25406J46586_10000029 3300003203 Bacteria 70143
4 JGI25153J46596_10004855 3300003215 Bacteria 7162
5 JGI25153J46596_10023514 3300003215 Bacteria 2244
6 JGI25160J50197_1005016 3300003354 Bacteria 5601
7 JGI25160J50197_1027075 3300003354 Bacteria 1567
8 Ga0055542_1003918 3300003762 Bacteria 3819
9 Ga0055531_10007266 3300003794 Bacteria 6083
10 Ga0055543_1009024 3300004625 Bacteria 2170
11 Ga0065165_1007664 3300005262 Bacteria 5241
12 Ga0065165_1008334 3300005262 Bacteria 4872
13 Ga0065165_1015852 3300005262 Bacteria 2854
14 Ga0070658_10045753 3300005327 Bacteria 3539
15 Ga0070683_100142137 3300005329 Bacteria 2274
16 Ga0070683_100222934 3300005329 Bacteria 1792
17 Ga0070690_100061281 3300005330 Bacteria 2423
18 Ga0070690_100103336 3300005330 Bacteria 1892
19 Ga0070670_100001723 3300005331 Bacteria 17816
20 Ga0070670_100009980 3300005331 Bacteria 8104
21 Ga0070670_100285050 3300005331 Bacteria 1443
22 Ga0070666_10179746 3300005335 Bacteria 1483
23 Ga0070680_100556095 3300005336 Bacteria 984
24 Ga0068868_100093818 3300005338 Bacteria 2420
25 Ga0070660_100149021 3300005339 Bacteria 1880
26 Ga0070689_100007935 3300005340 Bacteria 7449
27 Ga0070689_100012435 3300005340 Bacteria 6132
28 Ga0070661_100231010 3300005344 Bacteria 1421
29 Ga0070661_100287683 3300005344 Bacteria 1276
30 Ga0070668_100073413 3300005347 Bacteria 2667
31 Ga0070668_100194730 3300005347 Bacteria 1661
32 Ga0070669_100188894 3300005353 Bacteria 1615
33 Ga0070675_100072713 3300005354 Bacteria 2854
34 Ga0070671_100005712 3300005355 Bacteria 9910
35 Ga0070671_100065519 3300005355 Bacteria 3026
36 Ga0070671_100302616 3300005355 Bacteria 1362
37 Ga0070673_100006964 3300005364 Bacteria 7401
38 Ga0070688_100064347 3300005365 Bacteria 2327
39 Ga0070709_10007271 3300005434 Bacteria 6068
40 Ga0070709_10048386 3300005434 Bacteria 2653
41 Ga0070714_100029019 3300005435 Bacteria 4596
42 Ga0070714_100656226 3300005435 Bacteria 1010
43 Ga0070713_100002962 3300005436 Bacteria 11145
44 Ga0070713_100007940 3300005436 Bacteria 7494
45 Ga0070713_100050954 3300005436 Bacteria 3422
46 Ga0070713_100070268 3300005436 Bacteria 2955
47 Ga0070710_10002404 3300005437 Bacteria 8863
48 Ga0070710_10018577 3300005437 Bacteria 3578
49 Ga0070701_10181027 3300005438 Bacteria 1234
50 Ga0070711_100044065 3300005439 Bacteria 3026
51 Ga0070700_100242434 3300005441 Bacteria 1289
52 Ga0070708_100135785 3300005445 Bacteria 2278
53 Ga0070663_100040635 3300005455 Bacteria 3258
54 Ga0070663_100101477 3300005455 Bacteria 2147
55 Ga0070678_100008469 3300005456 Bacteria 6159
56 Ga0070678_100051847 3300005456 Bacteria 2976
57 Ga0070706_100540057 3300005467 Bacteria 1084
58 Ga0070679_100117988 3300005530 Bacteria 2638
59 Ga0070672_100347556 3300005543 Bacteria 1264
60 Ga0070672_100510517 3300005543 Bacteria 1041
61 Ga0070686_100091123 3300005544 Bacteria 2039
62 Ga0070665_100045631 3300005548 Bacteria 4401
63 Ga0068854_100255319 3300005578 Bacteria 1401
64 Ga0070702_100262211 3300005615 Bacteria 1177
65 Ga0068852_100013713 3300005616 Bacteria 6211
66 Ga0068863_100125887 3300005841 Bacteria 2444
67 Ga0068858_100037795 3300005842 Bacteria 4477
68 Ga0068862_100115963 3300005844 Bacteria 2356
69 Ga0081455_10001441 3300005937 Bacteria 29425
70 Ga0081455_10015282 3300005937 Bacteria 7464
71 Ga0081455_10057180 3300005937 Bacteria 3307
72 Ga0081455_10065013 3300005937 Bacteria 3053
73 Ga0081538_10060137 3300005981 Bacteria 2188
74 Ga0081538_10080980 3300005981 Bacteria 1729
75 Ga0081540_1003191 3300005983 Bacteria 13056
76 Ga0081540_1064912 3300005983 Bacteria 1720
77 Ga0081540_1098558 3300005983 Bacteria 1265
78 Ga0081539_10000379 3300005985 Bacteria 97134
79 Ga0081539_10042642 3300005985 Bacteria 2640
80 Ga0081539_10099414 3300005985 Bacteria 1486
81 Ga0070717_10024222 3300006028 Bacteria 4817
82 Ga0070717_10114739 3300006028 Bacteria 2302
83 Ga0070717_10197365 3300006028 Bacteria 1761
84 Ga0070717_10296914 3300006028 Bacteria 1436
85 Ga0070717_10438953 3300006028 Bacteria 1175
86 Ga0075365_10015120 3300006038 Bacteria 4661
87 Ga0075365_10031998 3300006038 Bacteria 3378
88 Ga0075365_10152794 3300006038 Bacteria 1606
89 Ga0075365_10410701 3300006038 Bacteria 956
90 Ga0075363_100011461 3300006048 Bacteria 4245
91 Ga0075364_10019447 3300006051 Bacteria 4263
92 Ga0075364_10050907 3300006051 Bacteria 2704
93 Ga0075364_10069912 3300006051 Bacteria 2310
94 Ga0070715_10001501 3300006163 Bacteria 6813
95 Ga0070716_100015888 3300006173 Bacteria 3878
96 Ga0070712_100076144 3300006175 Bacteria 2415
97 Ga0070712_100111435 3300006175 Bacteria 2043
98 Ga0075362_10171698 3300006177 Bacteria 1048
99 Ga0075367_10025302 3300006178 Bacteria 3357
100 Ga0075367_10082158 3300006178 Bacteria 1950
101 Ga0075367_10253592 3300006178 Bacteria 1104
102 Ga0075369_10036032 3300006186 Bacteria 2104
103 Ga0075366_10008012 3300006195 Bacteria 5854
104 Ga0097621_100405728 3300006237 Bacteria 1221
105 Ga0075428_100005210 3300006844 Bacteria 14452
106 Ga0075428_100084789 3300006844 Bacteria 3456
107 Ga0075428_100114983 3300006844 Bacteria 2931
108 Ga0075428_100243302 3300006844 Bacteria 1941
109 Ga0075428_100515653 3300006844 Bacteria 1279
110 Ga0075428_100576475 3300006844 Bacteria 1202
111 Ga0075430_100002163 3300006846 Bacteria 16263
112 Ga0075430_100037690 3300006846 Bacteria 4098
113 Ga0075430_100066110 3300006846 Bacteria 3036
114 Ga0075430_100089651 3300006846 Bacteria 2573
115 Ga0075431_100000033 3300006847 Bacteria 72175
116 Ga0075431_100068406 3300006847 Bacteria 3665
117 Ga0075431_100103033 3300006847 Bacteria 2945
118 Ga0075431_100334241 3300006847 Bacteria 1525
119 Ga0075433_10078674 3300006852 Bacteria 2905
120 Ga0075433_10605373 3300006852 Bacteria 962
121 Ga0075434_100072479 3300006871 Bacteria 3437
122 Ga0075434_100155204 3300006871 Bacteria 2309
123 Ga0075429_100015660 3300006880 Bacteria 6570
124 Ga0075429_100228096 3300006880 Bacteria 1631
125 Ga0075429_100350372 3300006880 Bacteria 1293
126 Ga0075429_100449601 3300006880 Bacteria 1129
127 Ga0075436_100020081 3300006914 Bacteria 4585
128 Ga0075436_100124041 3300006914 Bacteria 1809
129 Ga0099823_1044187 3300006944 Bacteria 3033
130 Ga0075435_100051064 3300007076 Bacteria 3330
131 Ga0099794_10007633 3300007265 Bacteria 4453
132 Ga0105240_10024167 3300009093 Bacteria 8019
133 Ga0111539_10003260 3300009094 Bacteria 21453
134 Ga0111539_10080397 3300009094 Bacteria 3834
135 Ga0111539_10092686 3300009094 Bacteria 3550
136 Ga0105245_10071265 3300009098 Bacteria 3156
137 Ga0105245_10304654 3300009098 Bacteria 1564
138 Ga0105247_10034899 3300009101 Bacteria 3064
139 Ga0105247_10217467 3300009101 Bacteria 1292
140 Ga0105247_10391360 3300009101 Bacteria 988
141 Ga0114129_10001565 3300009147 Bacteria 31048
142 Ga0114129_10009125 3300009147 Bacteria 14137
143 Ga0114129_10029026 3300009147 Bacteria 7836
144 Ga0114129_10033913 3300009147 Bacteria 7210
145 Ga0114129_10072318 3300009147 Bacteria 4807
146 Ga0114129_10126542 3300009147 Bacteria 3513
147 Ga0114129_10534477 3300009147 Bacteria 1527
148 Ga0114129_10831737 3300009147 Bacteria 1175
149 Ga0105241_10043729 3300009174 Bacteria 3393
150 Ga0105242_10638451 3300009176 Bacteria 1034
151 Ga0105248_10077875 3300009177 Bacteria 3728
152 Ga0105248_10156966 3300009177 Bacteria 2567
153 Ga0105237_10014611 3300009545 Bacteria 8202
154 Ga0105237_10221333 3300009545 Bacteria 1893
155 Ga0105237_10287260 3300009545 Bacteria 1647
156 Ga0105237_10356708 3300009545 Bacteria 1466
157 Ga0105238_10031358 3300009551 Bacteria 5410
158 Ga0099796_10001212 3300010159 Bacteria 5032
159 Ga0099796_10013226 3300010159 Bacteria 2352
160 Ga0105239_10019731 3300010375 Bacteria 7440
161 Ga0105239_10240650 3300010375 Bacteria 2031
162 Ga0105239_11106523 3300010375 Bacteria 912
163 Ga0105246_10122272 3300011119 Bacteria 1931
164 Ga0105246_10155154 3300011119 Bacteria 1738
165 Ga0105246_10226149 3300011119 Bacteria 1470
166 Ga0157374_10005795 3300013296 Bacteria 10432
167 Ga0163162_10089838 3300013306 Bacteria 3153
168 Ga0157375_10181555 3300013308 Bacteria 2256
169 Ga0157375_11600470 3300013308 Bacteria 770
170 Ga0163163_10011865 3300014325 Bacteria 7923
171 Ga0163163_10095553 3300014325 Bacteria 2991
172 Ga0163163_10260812 3300014325 Bacteria 1784
173 Ga0157377_10428404 3300014745 Bacteria 908
174 Ga0157379_10160369 3300014968 Bacteria 2030
175 Ga0157379_10412798 3300014968 Unclassified 1242
176 Ga0157376_10101005 3300014969 Bacteria 2520
177 Ga0157376_10443605 3300014969 Bacteria 1264
178 Ga0163161_10150742 3300017792 Bacteria 1767
179 Ga0213875_10000023 3300021388 Bacteria 213455
180 Ga0209148_1000258 3300025254 Bacteria 83390
181 Ga0209233_1011849 3300025261 Bacteria 2556
182 Ga0209233_1025318 3300025261 Bacteria 1469
183 Ga0209455_1001530 3300025272 Bacteria 10313
184 Ga0209673_1041100 3300025273 Bacteria 1316
185 Ga0209564_1005824 3300025295 Bacteria 6872
186 Ga0209758_1000021 3300025297 Bacteria 697691
187 Ga0209758_1009445 3300025297 Bacteria 6065
188 Ga0209758_1070492 3300025297 Bacteria 1102
189 Ga0209256_1004268 3300025299 Bacteria 9134
190 Ga0207426_1001694 3300025302 Bacteria 17003
191 Ga0207426_1002095 3300025302 Bacteria 13759
192 Ga0207426_1006111 3300025302 Bacteria 5305
193 Ga0207426_1027590 3300025302 Bacteria 1890
194 Ga0209257_1002487 3300025304 Bacteria 18212
195 Ga0209257_1031316 3300025304 Bacteria 1703
196 Ga0207697_10116334 3300025315 Bacteria 1148
197 Ga0207692_10381081 3300025898 Bacteria 875
198 Ga0207710_10063392 3300025900 Bacteria 1681
199 Ga0207688_10095986 3300025901 Bacteria 1707
200 Ga0207680_10076111 3300025903 Bacteria 2095
201 Ga0207685_10003051 3300025905 Bacteria 3988
202 Ga0207699_10028246 3300025906 Bacteria 3116
203 Ga0207699_10069449 3300025906 Bacteria 2148
204 Ga0207699_10107357 3300025906 Bacteria 1783
205 Ga0207699_10297871 3300025906 Bacteria 1125
206 Ga0207645_10023855 3300025907 Bacteria 3970
207 Ga0207654_10012739 3300025911 Bacteria 4315
208 Ga0207654_10163543 3300025911 Bacteria 1440
209 Ga0207707_10000311 3300025912 Bacteria 51163
210 Ga0207707_10340710 3300025912 Bacteria 1293
211 Ga0207695_10000015 3300025913 Bacteria 803205
212 Ga0207695_10084492 3300025913 Bacteria 3205
213 Ga0207671_10002600 3300025914 Bacteria 19063
214 Ga0207671_10063371 3300025914 Bacteria 2747
215 Ga0207693_10002979 3300025915 Bacteria 14660
216 Ga0207693_10010565 3300025915 Bacteria 7491
217 Ga0207693_10043742 3300025915 Bacteria 3521
218 Ga0207693_10070651 3300025915 Bacteria 2732
219 Ga0207693_10131213 3300025915 Bacteria 1970
220 Ga0207663_10007268 3300025916 Bacteria 5732
221 Ga0207663_10014885 3300025916 Bacteria 4275
222 Ga0207663_10071243 3300025916 Bacteria 2242
223 Ga0207663_10247011 3300025916 Bacteria 1311
224 Ga0207660_10108440 3300025917 Bacteria 2085
225 Ga0207660_10142166 3300025917 Bacteria 1835
226 Ga0207657_10011987 3300025919 Bacteria 8576
227 Ga0207649_10166766 3300025920 Bacteria 1530
228 Ga0207652_10017328 3300025921 Bacteria 5894
229 Ga0207652_10055414 3300025921 Bacteria 3410
230 Ga0207652_10245798 3300025921 Bacteria 1613
231 Ga0207652_10630896 3300025921 Bacteria 959
232 Ga0207646_10166456 3300025922 Bacteria 1990
233 Ga0207681_10184129 3300025923 Bacteria 1593
234 Ga0207681_10244988 3300025923 Bacteria 1397
235 Ga0207694_10017860 3300025924 Bacteria 5362
236 Ga0207694_10139056 3300025924 Bacteria 1952
237 Ga0207694_10368762 3300025924 Bacteria 1191
238 Ga0207650_10008082 3300025925 Bacteria 7168
239 Ga0207650_10243927 3300025925 Bacteria 1453
240 Ga0207659_10087585 3300025926 Bacteria 2318
241 Ga0207687_10062915 3300025927 Bacteria 2626
242 Ga0207687_10595549 3300025927 Bacteria 931
243 Ga0207700_10027994 3300025928 Bacteria 3954
244 Ga0207700_10029519 3300025928 Bacteria 3870
245 Ga0207700_10057709 3300025928 Bacteria 2929
246 Ga0207700_10160928 3300025928 Bacteria 1864
247 Ga0207664_10040433 3300025929 Bacteria 3626
248 Ga0207664_10455020 3300025929 Bacteria 1143
249 Ga0207644_10001240 3300025931 Bacteria 16406
250 Ga0207644_10085795 3300025931 Bacteria 2336
251 Ga0207644_10170359 3300025931 Bacteria 1699
252 Ga0207706_10243008 3300025933 Bacteria 1574
253 Ga0207709_10163324 3300025935 Bacteria 1556
254 Ga0207709_10164860 3300025935 Bacteria 1549
255 Ga0207665_10017584 3300025939 Bacteria 4698
256 Ga0207691_10148443 3300025940 Bacteria 2062
257 Ga0207711_10009916 3300025941 Bacteria 7917
258 Ga0207689_10375065 3300025942 Bacteria 1184
259 Ga0207661_10072662 3300025944 Bacteria 2814
260 Ga0207661_10277288 3300025944 Bacteria 1498
261 Ga0207661_10414919 3300025944 Bacteria 1222
262 Ga0207661_10469333 3300025944 Bacteria 1148
263 Ga0207661_10735193 3300025944 Bacteria 908
264 Ga0207679_10044696 3300025945 Bacteria 3198
265 Ga0207651_10011493 3300025960 Bacteria 4960
266 Ga0207668_10507928 3300025972 Bacteria 1038
267 Ga0207640_10029680 3300025981 Bacteria 3360
268 Ga0207640_10445775 3300025981 Bacteria 1065
269 Ga0207658_10130152 3300025986 Bacteria 2021
270 Ga0207678_10018096 3300026067 Bacteria 6188
271 Ga0207678_10212336 3300026067 Bacteria 1656
272 Ga0207708_10114277 3300026075 Bacteria 2098
273 Ga0207641_10082469 3300026088 Bacteria 2794
274 Ga0207641_10435395 3300026088 Bacteria 1265
275 Ga0207676_10147446 3300026095 Bacteria 2022
276 Ga0207683_10035409 3300026121 Bacteria 4342
277 Ga0209389_1000041 3300027296 Bacteria 123983
278 Ga0209489_105228 3300027361 Bacteria 22869
279 Ga0209700_100010 3300027363 Bacteria 395269
280 Ga0209179_1009079 3300027512 Bacteria 1694
281 Ga0209588_1043768 3300027671 Bacteria 1447
282 Ga0207428_10003754 3300027907 Bacteria 14582
283 Ga0207428_10670779 3300027907 Bacteria 743
284 Ga0268266_10086002 3300028379 Bacteria 2748
285 Ga0268264_10183975 3300028381 Bacteria 1900
286 Ga0265330_10159980 3300031235 Bacteria 956
287 Ga0265332_10047054 3300031238 Bacteria 1857
288 Ga0265332_10054308 3300031238 Bacteria 1719
289 Ga0265320_10011784 3300031240 Bacteria 5128
290 Ga0265325_10001321 3300031241 Bacteria 17544
291 Ga0265339_10080814 3300031249 Bacteria 1719
292 Ga0265331_10034617 3300031250 Bacteria 2490
293 Ga0265316_10023436 3300031344 Bacteria 5186
294 Ga0265313_10031858 3300031595 Bacteria 2699
295 Ga0265314_10011738 3300031711 Bacteria 7206
296 Ga0265342_10017105 3300031712 Bacteria 4722
297 Ga0316583_10002219 3300032133 Bacteria 6697
298 Ga0307510_10023325 3300033180 Bacteria 7174
299 Ga0373928_0015573 3300035084 Bacteria 1549
300 Ga0373929_0027327 3300035085 Bacteria 1198
301 Ga0373923_0008206 3300035111 Bacteria 3711
302 Ga0373923_0111554 3300035111 Bacteria 1215
303 Ga0373932_0025327 3300035112 Bacteria 1605
304 Ga0373932_0062317 3300035112 Bacteria 1137
305 Ga0373941_0078548 3300035115 Bacteria 1110
306 Ga0373953_0036386 3300035117 Bacteria 1939
307 Ga0373957_0052073 3300035120 Bacteria 1567
308 Ga0373960_0008815 3300035121 Bacteria 2428
309 Ga0373960_0096100 3300035121 Bacteria 954
310 Ga0373943_0029361 3300035170 Bacteria 2597
311 Ga0373943_0166346 3300035170 Bacteria 1204
312 Ga0373946_0004816 3300035171 Bacteria 4857
313 Ga0373961_0007413 3300035241 Bacteria 2653
314 Ga0373961_0011190 3300035241 Bacteria 2224
315 Ga0373924_0024204 3300035410 Bacteria 2391
316 Ga0373931_0028701 3300035691 Bacteria 2851
317 Ga0373931_0068849 3300035691 Bacteria 1927
318 Ga0373931_0202494 3300035691 Bacteria 1186
319 Ga0373927_0003031 3300035695 Bacteria 12185
320 Ga0373927_0077817 3300035695 Bacteria 2148
321 Ga0373933_0001146 3300035724 Bacteria 15729
322 Ga0373947_0018683 3300035725 Bacteria 3991
323 Ga0373947_0026170 3300035725 Bacteria 3407
324 Ga0373947_0313956 3300035725 Bacteria 1047
325 Ga0373947_0453407 3300035725 Bacteria 869
326 Ga0373937_0006789 3300036401 Bacteria 9883
327 Ga0373937_0049672 3300036401 Bacteria 3841
328 Ga0373937_0240847 3300036401 Bacteria 1704
329 Ga0373925_0015942 3300037068 Bacteria 5440
330 Ga0373925_0151565 3300037068 Bacteria 1821
331 Ga0373925_0243693 3300037068 Bacteria 1440
332 Ga0373925_0304406 3300037068 Bacteria 1287
333 Ga0395899_0076582 3300037312 Bacteria 2441
334 Ga0395900_0031724 3300037418 Bacteria 5431
335 Ga0395900_0265941 3300037418 Bacteria 1711
336 Ga0395898_0113276 3300037466 Bacteria 2600
337 Ga0395898_0159109 3300037466 Bacteria 2160
338 Ga0395898_0342027 3300037466 Bacteria 1427
339 Ga0395905_0004439 3300037471 Bacteria 14583
340 Ga0395905_0014655 3300037471 Bacteria 7478
341 Ga0395905_0060259 3300037471 Bacteria 3549
342 Ga0436364_0294605 3300037853 Bacteria 8914
343 Ga0436364_1354913 3300037853 Bacteria 909
344 Ga0436365_1103520 3300039437 Bacteria 1111
345 Ga0436360_0655491 3300039438 Bacteria 1024
346 Ga0436361_0327575 3300039447 Bacteria 1512
347 Ga0451789_0631626 3300041443 Bacteria 1771
348 Ga0451795_0402816 3300041456 Bacteria 1161
349 Ga0451849_0742029 3300041505 Bacteria 2196
350 Ga0451853_4052471 3300041512 Bacteria 749
351 Ga0439435_0036925 3300042436 Bacteria 1352
352 Ga0466965_0003867 3300044683 Bacteria 6616
353 Ga0466957_0071774 3300044842 Bacteria 2142
354 Ga0466960_0115939 3300044901 Bacteria 1397
355 Ga0466960_0166421 3300044901 Bacteria 1187
356 Ga0466967_0018550 3300045976 Bacteria 5565
357 Ga0466967_0832879 3300045976 Bacteria 916
358 Ga0495592_0004263 3300046454 Bacteria 10450
359 Ga0495603_0002833 3300046455 Bacteria 10245
360 Ga0495629_0000409 3300046459 Bacteria 35959
361 Ga0495629_0140501 3300046459 Bacteria 1680
362 Ga0495629_0163022 3300046459 Bacteria 1548
363 Ga0495641_0014960 3300046461 Bacteria 4174
364 Ga0495651_0000765 3300046462 Bacteria 24883
365 Ga0495653_0017238 3300046463 Bacteria 5874
366 Ga0495580_0025173 3300046472 Bacteria 4350
367 Ga0495605_0039277 3300046474 Bacteria 2372
368 Ga0495639_0012682 3300046475 Bacteria 3635
369 Ga0495662_0251986 3300046476 Bacteria 869
370 Ga0495664_0042760 3300046477 Bacteria 2685
371 Ga0495664_0061157 3300046477 Bacteria 2243
372 Ga0495584_0065866 3300046491 Bacteria 1822
373 Ga0495584_0080709 3300046491 Bacteria 1637
374 Ga0495585_0076688 3300046492 Bacteria 1815
375 Ga0495585_0274904 3300046492 Bacteria 834
376 Ga0495594_0134644 3300046499 Bacteria 1400
377 Ga0495594_0146221 3300046499 Bacteria 1341
378 Ga0495583_0076981 3300046506 Bacteria 1456
379 Ga0495606_0049064 3300046507 Bacteria 2771
380 Ga0495608_0001595 3300046511 Bacteria 16230
381 Ga0495608_0236736 3300046511 Bacteria 1142
382 Ga0495610_0072280 3300046512 Bacteria 1606
383 Ga0495616_0164149 3300046513 Bacteria 997
384 Ga0495618_0000463 3300046514 Bacteria 29042
385 Ga0495630_0108772 3300046517 Bacteria 2100
386 Ga0495630_0158934 3300046517 Bacteria 1721
387 Ga0495637_0047787 3300046520 Bacteria 1805
388 Ga0495637_0097436 3300046520 Bacteria 1153
389 Ga0495643_0101453 3300046522 Bacteria 1474
390 Ga0495644_0177558 3300046523 Bacteria 818
391 Ga0495648_0104913 3300046524 Bacteria 1551
392 Ga0495648_0158827 3300046524 Bacteria 1171
393 Ga0495663_0013862 3300046525 Bacteria 2255
394 Ga0495666_0179025 3300046526 Bacteria 979
395 Ga0495652_0002799 3300046529 Bacteria 17599
396 Ga0495652_0197449 3300046529 Bacteria 1530
397 Ga0495652_0271634 3300046529 Bacteria 1246
398 Ga0495665_0065150 3300046531 Bacteria 1923
399 Ga0495640_0001726 3300046533 Bacteria 17329
400 Ga0495640_0237841 3300046533 Bacteria 1144
401 Ga0495640_0431665 3300046533 Bacteria 806
402 Ga0495587_0001870 3300046536 Bacteria 14006
403 Ga0495587_0192330 3300046536 Bacteria 1155
404 Ga0495598_0009046 3300046537 Bacteria 2340
405 Ga0495645_0130849 3300046543 Bacteria 1758
406 Ga0495633_0090780 3300046558 Bacteria 1420
407 Ga0495667_0000449 3300046559 Bacteria 26331
408 Ga0495656_0014167 3300046615 Bacteria 2984
409 Ga0495656_0040527 3300046615 Bacteria 1941
410 Ga0495656_0087485 3300046615 Bacteria 1419
411 Ga0495668_0141416 3300046616 Bacteria 1317
412 Ga0495634_0007434 3300046642 Bacteria 8231
413 Ga0495634_0154528 3300046642 Bacteria 1449
414 Ga0495635_0001992 3300046663 Bacteria 13867
415 Ga0495635_0108088 3300046663 Bacteria 1900
416 Ga0495635_0147339 3300046663 Bacteria 1602
417 Ga0495659_0016048 3300046664 Bacteria 2467
418 Ga0495661_0037465 3300046665 Bacteria 3028
419 Ga0495657_0023229 3300046675 Bacteria 4433
420 Ga0495657_0065562 3300046675 Bacteria 2388
421 Ga0495623_0003787 3300046679 Bacteria 9962
422 Ga0495646_0005008 3300046680 Bacteria 8354
423 Ga0495647_0072544 3300046681 Bacteria 1381
424 Ga0495658_0004246 3300046683 Bacteria 7047
425 Ga0495613_0103037 3300046689 Bacteria 2060
426 Ga0495613_0172035 3300046689 Bacteria 1537
427 Ga0495613_0196170 3300046689 Bacteria 1425
428 Ga0495613_0465399 3300046689 Bacteria 855
429 Ga0495624_0186894 3300046690 Bacteria 1261
430 Ga0495670_0113427 3300046691 Bacteria 1404
431 Ga0495671_0051534 3300046692 Bacteria 2047
432 Ga0495671_0067020 3300046692 Bacteria 1766
433 Ga0495589_0227529 3300046794 Bacteria 875
434 Ga0495600_0017964 3300046809 Bacteria 4502
435 Ga0495660_0108639 3300046810 Bacteria 1418
436 Ga0495581_0063090 3300047315 Bacteria 2141
437 Ga0495581_0093740 3300047315 Bacteria 1743
438 Ga0495581_0312283 3300047315 Bacteria 919
439 Ga0495604_0001780 3300047317 Bacteria 17561
440 Ga0495604_0020747 3300047317 Bacteria 5246
441 Ga0495674_0001004 3300047319 Bacteria 27097
442 Ga0495674_0394514 3300047319 Bacteria 1118
443 Ga0495676_0077647 3300047321 Bacteria 2532
444 Ga0495676_0240211 3300047321 Bacteria 1240
445 Ga0495676_0373979 3300047321 Bacteria 949
446 Ga0495675_0023303 3300047444 Bacteria 3944
447 Ga0495677_0034633 3300047445 Bacteria 1842
448 Ga0495673_0040799 3300047469 Bacteria 2093
449 Ga0495681_0065291 3300047470 Bacteria 1665
450 Ga0495684_0005592 3300047471 Bacteria 9790
451 Ga0495684_0070662 3300047471 Bacteria 2654
452 Ga0495602_0014319 3300048088 Bacteria 8054
453 Ga0495614_0096179 3300048089 Bacteria 1291
454 Ga0496100_0022641 3300048903 Bacteria 3804
455 Ga0496100_0026198 3300048903 Bacteria 3573
456 Ga0496100_0047880 3300048903 Bacteria 2757
457 Ga0496100_0754057 3300048903 Bacteria 761
458 Ga0496101_0014208 3300048904 Bacteria 5348
459 Ga0496101_0052219 3300048904 Bacteria 2947
460 Ga0496101_0114964 3300048904 Bacteria 2029
461 Ga0496101_0153105 3300048904 Bacteria 1765
462 Ga0496101_0272326 3300048904 Bacteria 1322
463 Ga0496102_0002555 3300048905 Bacteria 15524
464 Ga0496102_0072324 3300048905 Bacteria 3168
465 Ga0496102_0144252 3300048905 Bacteria 2234
466 Ga0496102_0520075 3300048905 Bacteria 1112
467 Ga0496103_0021945 3300048906 Bacteria 3843
468 Ga0496103_0051627 3300048906 Bacteria 2545
469 Ga0496103_0183151 3300048906 Bacteria 1346
470 Ga0496103_0395262 3300048906 Bacteria 888
471 Ga0496104_0000730 3300048907 Bacteria 28293
472 Ga0496104_0001076 3300048907 Bacteria 23319
473 Ga0496104_0009331 3300048907 Bacteria 8725
474 Ga0496104_0021681 3300048907 Bacteria 5899
475 Ga0496104_0036020 3300048907 Bacteria 4623
476 Ga0496104_0040425 3300048907 Bacteria 4370
477 Ga0496104_0069299 3300048907 Bacteria 3352
478 Ga0496104_0075277 3300048907 Bacteria 3215
479 Ga0496105_0000364 3300048908 Bacteria 30030
480 Ga0496105_0004848 3300048908 Bacteria 10161
481 Ga0496105_0010760 3300048908 Bacteria 7203
482 Ga0496105_0034986 3300048908 Bacteria 4133
483 Ga0496105_0053112 3300048908 Bacteria 3346
484 Ga0496105_0066848 3300048908 Bacteria 2968
485 Ga0496106_0089281 3300048909 Bacteria 2377
486 Ga0496106_0139145 3300048909 Bacteria 1909
487 Ga0496106_0148582 3300048909 Bacteria 1847
488 Ga0496106_0293767 3300048909 Bacteria 1303
489 Ga0496106_0340155 3300048909 Bacteria 1205
490 Ga0496107_0007274 3300048910 Bacteria 7628
491 Ga0496107_0072336 3300048910 Bacteria 2507
492 Ga0496107_0112982 3300048910 Bacteria 1997
493 Ga0496107_0357767 3300048910 Bacteria 1086
494 Ga0496108_0006618 3300048911 Bacteria 9394
495 Ga0496108_0014300 3300048911 Bacteria 6477
496 Ga0496108_0114663 3300048911 Bacteria 2307
497 Ga0496108_0189088 3300048911 Bacteria 1784
498 Ga0496108_0358069 3300048911 Bacteria 1273
499 Ga0496109_0005006 3300048912 Bacteria 11063
500 Ga0496109_0092353 3300048912 Bacteria 2800
501 Ga0496109_0139277 3300048912 Bacteria 2268
502 Ga0496109_0145720 3300048912 Bacteria 2215
503 Ga0496109_0149472 3300048912 Bacteria 2187
504 Ga0496110_0005635 3300048913 Bacteria 9826
505 Ga0496110_0019042 3300048913 Bacteria 5769
506 Ga0496110_0027225 3300048913 Bacteria 4900
507 Ga0496110_0039508 3300048913 Bacteria 4109
508 Ga0496110_0052318 3300048913 Bacteria 3589
509 Ga0496111_0006431 3300048914 Bacteria 7627
510 Ga0496111_0014626 3300048914 Bacteria 5368
511 Ga0496111_0015562 3300048914 Bacteria 5225
512 Ga0496111_0203614 3300048914 Bacteria 1471
513 Ga0496111_0205955 3300048914 Bacteria 1462
514 Ga0496112_0006633 3300048915 Bacteria 10190
515 Ga0496112_0017533 3300048915 Bacteria 6729
516 Ga0496112_0020955 3300048915 Bacteria 6207
517 Ga0496112_0202311 3300048915 Bacteria 1945
518 Ga0496112_0319005 3300048915 Bacteria 1498
519 Ga0496112_0454430 3300048915 Bacteria 1218
520 Ga0496112_0518685 3300048915 Bacteria 1126
521 Ga0496113_0000048 3300048916 Bacteria 50958
522 Ga0496113_0027751 3300048916 Bacteria 4062
523 Ga0496113_0118262 3300048916 Bacteria 2070
524 Ga0496113_0362959 3300048916 Bacteria 1162
525 Ga0496113_0427460 3300048916 Bacteria 1064
526 Ga0496114_0007248 3300048917 Bacteria 8760
527 Ga0496114_0034706 3300048917 Bacteria 4162
528 Ga0496114_0142850 3300048917 Bacteria 2073
529 Ga0496114_0343802 3300048917 Bacteria 1319
530 Ga0496114_0644646 3300048917 Bacteria 932
531 Ga0496115_0000736 3300048918 Bacteria 24226
532 Ga0496115_0045914 3300048918 Bacteria 3488
533 Ga0496115_0048181 3300048918 Bacteria 3408
534 Ga0496115_0079506 3300048918 Bacteria 2669
535 Ga0496115_0240653 3300048918 Bacteria 1491
536 Ga0496116_0016469 3300048919 Bacteria 5782
537 Ga0496116_0069456 3300048919 Bacteria 2240
538 Ga0496119_0042892 3300048922 Bacteria 2864
539 Ga0496120_0044351 3300048923 Bacteria 2584
540 Ga0496121_0000612 3300048924 Bacteria 66397
541 Ga0496121_0022465 3300048924 Bacteria 6121
542 Ga0496121_0410790 3300048924 Bacteria 884
543 Ga0496125_0089378 3300048928 Bacteria 2317
544 Ga0496125_0101780 3300048928 Bacteria 2113
545 Ga0496126_0026422 3300048929 Bacteria 5567
546 Ga0496126_0054381 3300048929 Bacteria 3626
547 Ga0496126_0160947 3300048929 Bacteria 1918
548 Ga0496126_0439053 3300048929 Bacteria 1052
549 Ga0501033_0187837 3300049570 Bacteria 1480
550 Ga0501034_0103459 3300049571 Bacteria 2841
551 Ga0501034_0147456 3300049571 Bacteria 2330
552 Ga0501038_0012938 3300049574 Bacteria 7612
553 Ga0501038_0525325 3300049574 Bacteria 903
554 Ga0501039_0079188 3300049575 Bacteria 2556
555 Ga0501040_0108156 3300049576 Bacteria 1944
556 Ga0501040_0173432 3300049576 Bacteria 1528
557 Ga0501046_0054605 3300049580 Bacteria 3142
558 Ga0501047_0236876 3300049581 Bacteria 1677
559 Ga0501048_0246858 3300049582 Bacteria 1267
560 Ga0501068_0169170 3300049584 Bacteria 1379
561 Ga0501069_0171492 3300049585 Bacteria 1252
562 Ga0501070_0117300 3300049586 Bacteria 2199
563 Ga0501070_0336458 3300049586 Bacteria 1226
564 Ga0501071_0101577 3300049587 Bacteria 2120
565 Ga0501071_0111094 3300049587 Bacteria 2026
566 Ga0501071_0449976 3300049587 Bacteria 986
567 Ga0501072_0002871 3300049588 Bacteria 12951
568 Ga0501072_0006078 3300049588 Bacteria 9217
569 Ga0501072_0181606 3300049588 Bacteria 1678
570 Ga0501073_0043794 3300049589 Bacteria 3156
571 Ga0501075_0060915 3300049591 Bacteria 2843
572 Ga0501075_0065677 3300049591 Bacteria 2738
573 Ga0501075_0115519 3300049591 Bacteria 2041
574 Ga0501075_0302812 3300049591 Bacteria 1218
575 Ga0501076_0009864 3300049592 Bacteria 7060
576 Ga0501076_0098779 3300049592 Bacteria 2352
577 Ga0501077_0128720 3300049593 Bacteria 1605
578 Ga0501077_0222125 3300049593 Bacteria 1201
579 Ga0501079_0245463 3300049741 Bacteria 1399
580 Ga0501079_0480144 3300049741 Bacteria 977
581 Ga0501080_0376063 3300049742 Bacteria 1280
582 Ga0501081_0045257 3300049743 Bacteria 3022
583 Ga0501083_0029231 3300049744 Bacteria 3793
584 Ga0501083_0030684 3300049744 Bacteria 3691
585 Ga0501083_0047287 3300049744 Bacteria 2907
586 Ga0501035_0109447 3300049822 Bacteria 2422
587 Ga0501035_0216583 3300049822 Bacteria 1636
588 Ga0501044_0000519 3300049823 Bacteria 46905
589 Ga0501044_0206638 3300049823 Bacteria 1920
590 Ga0501044_0540096 3300049823 Bacteria 1064
591 Ga0501044_0911496 3300049823 Bacteria 753
592 Ga0501045_0240034 3300049824 Bacteria 1349
593 Ga0501045_0403587 3300049824 Bacteria 1017
594 nmdc:mga03n38_177255_c1 3300050490 Bacteria 1090
595 nmdc:mga03n38_65177_c1 3300050490 Bacteria 1670
596 nmdc:mga00v17_10946_c1 3300050491 Bacteria 4970
597 nmdc:mga00v17_313046_c1 3300050491 Bacteria 1020
598 nmdc:mga0yw44_116345_c1 3300050492 Bacteria 1718
599 nmdc:mga0yw44_11678_c1 3300050492 Bacteria 4548
600 nmdc:mga0yw44_273997_c1 3300050492 Bacteria 1127
601 nmdc:mga0yw44_77283_c1 3300050492 Bacteria 2079
602 nmdc:mga0k408_115398_c1 3300050493 Bacteria 1589
603 nmdc:mga0k408_6848_c1 3300050493 Bacteria 6079
604 nmdc:mga06z11_180588_c1 3300050494 Bacteria 1217
605 nmdc:mga06z11_261821_c1 3300050494 Bacteria 1021
606 nmdc:mga04h51_38628_c1 3300050495 Bacteria 1547
607 nmdc:mga07m45_213123_c1 3300050496 Bacteria 1124
608 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
609 nmdc:mga05p37_179019_c1 3300050507 Bacteria 2581
610 nmdc:mga05p37_218863_c1 3300050507 Bacteria 2299
611 nmdc:mga05p37_31880_c1 3300050507 Bacteria 6442
612 nmdc:mga05p37_56270_c1 3300050507 Bacteria 4842
613 nmdc:mga05p37_673952_c1 3300050507 Bacteria 1154
614 nmdc:mga05p37_75969_c1 3300050507 Bacteria 4136
615 nmdc:mga09592_104563_c1 3300050508 Bacteria 2426
616 nmdc:mga09592_14380_c1 3300050508 Bacteria 6461
617 nmdc:mga09592_193250_c1 3300050508 Bacteria 1762
618 nmdc:mga09592_263619_c1 3300050508 Bacteria 1494
619 nmdc:mga09592_274884_c1 3300050508 Bacteria 1461
620 nmdc:mga09592_566822_c1 3300050508 Bacteria 975
621 nmdc:mga0qj67_31734_c1 3300050509 Bacteria 4117
622 nmdc:mga0qj67_498550_c1 3300050509 Bacteria 979
623 nmdc:mga0qj67_6499_c1 3300050509 Bacteria 8592
624 nmdc:mga06r32_1042_c1 3300050510 Bacteria 25028
625 nmdc:mga06r32_236574_c1 3300050510 Bacteria 1814
626 nmdc:mga06r32_386383_c1 3300050510 Bacteria 1382
627 nmdc:mga06r32_790070_c1 3300050510 Bacteria 910
628 nmdc:mga08y16_317190_c1 3300050511 Bacteria 1605
629 nmdc:mga08y16_412_c1 3300050511 Bacteria 39249
630 nmdc:mga0n895_14811_c1 3300050512 Bacteria 7095
631 nmdc:mga0n895_205901_c1 3300050512 Bacteria 1998
632 nmdc:mga0n895_4804_c1 3300050512 Bacteria 11185
633 nmdc:mga08x19_58080_c1 3300050514 Bacteria 2502
634 nmdc:mga0a205_148701_c1 3300050515 Bacteria 2242
635 nmdc:mga0a205_20418_c1 3300050515 Bacteria 6248
636 nmdc:mga0a205_210297_c1 3300050515 Bacteria 1834
637 nmdc:mga0a205_329313_c1 3300050515 Bacteria 1397
638 Ga0495601_0002374 3300053077 Bacteria 10670
639 Ga0495601_0080425 3300053077 Bacteria 2091
640 Ga0495601_0121175 3300053077 Bacteria 1699
641 Ga0495601_0256659 3300053077 Bacteria 1141
642 Ga0495612_0004049 3300053078 Bacteria 6071
643 Ga0495655_0007901 3300053083 Bacteria 1999
644 Ga0495595_0001969 3300053084 Bacteria 7979
645 Ga0495619_0010572 3300053085 Bacteria 5808
646 Ga0495619_0013104 3300053085 Bacteria 5223
647 Ga0495619_0425219 3300053085 Bacteria 916
648 Ga0495619_0433686 3300053085 Bacteria 906
649 Ga0500643_000116 3300053087 Bacteria 83687
650 Ga0500566_0004414 3300053094 Bacteria 8399
651 Ga0500650_0180981 3300053098 Bacteria 966
652 Ga0500555_001167 3300053103 Bacteria 8624
653 Ga0500572_022800 3300053111 Bacteria 1674
654 Ga0500592_003684 3300053116 Bacteria 2443
655 Ga0500593_000557 3300053117 Bacteria 14449
656 Ga0500595_013385 3300053119 Bacteria 3144
657 Ga0500595_022110 3300053119 Bacteria 2258
658 Ga0500608_059289 3300053122 Bacteria 1831
659 Ga0500618_056947 3300053125 Bacteria 881
660 Ga0500642_0000098 3300053130 Bacteria 42383
661 Ga0500655_065420 3300053133 Bacteria 736
662 Ga0500568_0000001 3300053139 Bacteria 988705
663 Ga0500568_0003430 3300053139 Bacteria 8838
664 Ga0500588_0186373 3300053146 Bacteria 764
665 Ga0500589_056159 3300053147 Bacteria 1816
666 Ga0500604_0058392 3300053151 Bacteria 1206
667 Ga0500627_0001120 3300053158 Bacteria 7332
668 Ga0500636_0000468 3300053177 Bacteria 21977
669 Ga0500625_016887 3300053729 Bacteria 3406
670 Ga0500645_017117 3300053730 Bacteria 2275
671 Ga0500601_000104 3300053737 Bacteria 17603
672 Ga0501084_0333592 3300054114 Bacteria 1281
673 Ga0501084_0337363 3300054114 Bacteria 1273
674 Ga0501084_0422771 3300054114 Bacteria 1126
675 Ga0501082_0016050 3300060353 Bacteria 6443
676 Ga0501082_0207976 3300060353 Bacteria 1703
677 Ga0501082_0266119 3300060353 Bacteria 1492
678 Ga0501082_0297787 3300060353 Bacteria 1405
679 Ga0530510_0076131 3300061734 Bacteria 2438
680 Ga0530510_0088140 3300061734 Bacteria 2261
681 Ga0530510_0139319 3300061734 Bacteria 1787
682 2511396241 2511231028 Bacteria 8046582
683 2513892836 2513237141 Bacteria 8496279
684 2824708773 2824704595 Bacteria 9667483
685 2824761264 2824753945 Bacteria 9787441
686 2824773184 2824763712 Bacteria 9792355
687 2857513743 2857509624 Bacteria 7472071
688 2904717329 2904711408 Bacteria 9771557
689 3005598645 3005594810 Bacteria 8716512
690 8016513991 8016511872 Bacteria 9921665
691 8056683278 8056681323 Bacteria 8472857
692 Ga0099795_10001024
693 JGI24034J26672_10005847
694 JGI25406J46586_10000029
695 JGI25153J46596_10004855
696 JGI25153J46596_10023514
697 JGI25160J50197_1005016
698 JGI25160J50197_1027075
699 Ga0055542_1003918
700 Ga0055531_10007266
701 Ga0055543_1009024
702 Ga0065165_1007664
703 Ga0065165_1008334
704 Ga0065165_1015852
705 Ga0070658_10045753
706 Ga0070683_100142137
707 Ga0070683_100222934
708 Ga0070690_100061281
709 Ga0070690_100103336
710 Ga0070670_100001723
711 Ga0070670_100009980
712 Ga0070670_100285050
713 Ga0070666_10179746
714 Ga0070680_100556095
715 Ga0068868_100093818
716 Ga0070660_100149021
717 Ga0070689_100007935
718 Ga0070689_100012435
719 Ga0070661_100231010
720 Ga0070661_100287683
721 Ga0070668_100073413
722 Ga0070668_100194730
723 Ga0070669_100188894
724 Ga0070675_100072713
725 Ga0070671_100005712
726 Ga0070671_100065519
727 Ga0070671_100302616
728 Ga0070673_100006964
729 Ga0070688_100064347
730 Ga0070709_10007271
731 Ga0070709_10048386
732 Ga0070714_100029019
733 Ga0070714_100656226
734 Ga0070713_100002962
735 Ga0070713_100007940
736 Ga0070713_100050954
737 Ga0070713_100070268
738 Ga0070710_10002404
739 Ga0070710_10018577
740 Ga0070701_10181027
741 Ga0070711_100044065
742 Ga0070700_100242434
743 Ga0070708_100135785
744 Ga0070663_100040635
745 Ga0070663_100101477
746 Ga0070678_100008469
747 Ga0070678_100051847
748 Ga0070706_100540057
749 Ga0070679_100117988
750 Ga0070672_100347556
751 Ga0070672_100510517
752 Ga0070686_100091123
753 Ga0070665_100045631
754 Ga0068854_100255319
755 Ga0070702_100262211
756 Ga0068852_100013713
757 Ga0068863_100125887
758 Ga0068858_100037795
759 Ga0068862_100115963
760 Ga0081455_10001441
761 Ga0081455_10015282
762 Ga0081455_10057180
763 Ga0081455_10065013
764 Ga0081538_10060137
765 Ga0081538_10080980
766 Ga0081540_1003191
767 Ga0081540_1064912
768 Ga0081540_1098558
769 Ga0081539_10000379
770 Ga0081539_10042642
771 Ga0081539_10099414
772 Ga0070717_10024222
773 Ga0070717_10114739
774 Ga0070717_10197365
775 Ga0070717_10296914
776 Ga0070717_10438953
777 Ga0075365_10015120
778 Ga0075365_10031998
779 Ga0075365_10152794
780 Ga0075365_10410701
781 Ga0075363_100011461
782 Ga0075364_10019447
783 Ga0075364_10050907
784 Ga0075364_10069912
785 Ga0070715_10001501
786 Ga0070716_100015888
787 Ga0070712_100076144
788 Ga0070712_100111435
789 Ga0075362_10171698
790 Ga0075367_10025302
791 Ga0075367_10082158
792 Ga0075367_10253592
793 Ga0075369_10036032
794 Ga0075366_10008012
795 Ga0097621_100405728
796 Ga0075428_100005210
797 Ga0075428_100084789
798 Ga0075428_100114983
799 Ga0075428_100243302
800 Ga0075428_100515653
801 Ga0075428_100576475
802 Ga0075430_100002163
803 Ga0075430_100037690
804 Ga0075430_100066110
805 Ga0075430_100089651
806 Ga0075431_100000033
807 Ga0075431_100068406
808 Ga0075431_100103033
809 Ga0075431_100334241
810 Ga0075433_10078674
811 Ga0075433_10605373
812 Ga0075434_100072479
813 Ga0075434_100155204
814 Ga0075429_100015660
815 Ga0075429_100228096
816 Ga0075429_100350372
817 Ga0075429_100449601
818 Ga0075436_100020081
819 Ga0075436_100124041
820 Ga0099823_1044187
821 Ga0075435_100051064
822 Ga0099794_10007633
823 Ga0105240_10024167
824 Ga0111539_10003260
825 Ga0111539_10080397
826 Ga0111539_10092686
827 Ga0105245_10071265
828 Ga0105245_10304654
829 Ga0105247_10034899
830 Ga0105247_10217467
831 Ga0105247_10391360
832 Ga0114129_10001565
833 Ga0114129_10009125
834 Ga0114129_10029026
835 Ga0114129_10033913
836 Ga0114129_10072318
837 Ga0114129_10126542
838 Ga0114129_10534477
839 Ga0114129_10831737
840 Ga0105241_10043729
841 Ga0105242_10638451
842 Ga0105248_10077875
843 Ga0105248_10156966
844 Ga0105237_10014611
845 Ga0105237_10221333
846 Ga0105237_10287260
847 Ga0105237_10356708
848 Ga0105238_10031358
849 Ga0099796_10001212
850 Ga0099796_10013226
851 Ga0105239_10019731
852 Ga0105239_10240650
853 Ga0105239_11106523
854 Ga0105246_10122272
855 Ga0105246_10155154
856 Ga0105246_10226149
857 Ga0157374_10005795
858 Ga0163162_10089838
859 Ga0157375_10181555
860 Ga0157375_11600470
861 Ga0163163_10011865
862 Ga0163163_10095553
863 Ga0163163_10260812
864 Ga0157377_10428404
865 Ga0157379_10160369
866 Ga0157379_10412798
867 Ga0157376_10101005
868 Ga0157376_10443605
869 Ga0163161_10150742
870 Ga0213875_10000023
871 Ga0209148_1000258
872 Ga0209233_1011849
873 Ga0209233_1025318
874 Ga0209455_1001530
875 Ga0209673_1041100
876 Ga0209564_1005824
877 Ga0209758_1000021
878 Ga0209758_1009445
879 Ga0209758_1070492
880 Ga0209256_1004268
881 Ga0207426_1001694
882 Ga0207426_1002095
883 Ga0207426_1006111
884 Ga0207426_1027590
885 Ga0209257_1002487
886 Ga0209257_1031316
887 Ga0207697_10116334
888 Ga0207692_10381081
889 Ga0207710_10063392
890 Ga0207688_10095986
891 Ga0207680_10076111
892 Ga0207685_10003051
893 Ga0207699_10028246
894 Ga0207699_10069449
895 Ga0207699_10107357
896 Ga0207699_10297871
897 Ga0207645_10023855
898 Ga0207654_10012739
899 Ga0207654_10163543
900 Ga0207707_10000311
901 Ga0207707_10340710
902 Ga0207695_10000015
903 Ga0207695_10084492
904 Ga0207671_10002600
905 Ga0207671_10063371
906 Ga0207693_10002979
907 Ga0207693_10010565
908 Ga0207693_10043742
909 Ga0207693_10070651
910 Ga0207693_10131213
911 Ga0207663_10007268
912 Ga0207663_10014885
913 Ga0207663_10071243
914 Ga0207663_10247011
915 Ga0207660_10108440
916 Ga0207660_10142166
917 Ga0207657_10011987
918 Ga0207649_10166766
919 Ga0207652_10017328
920 Ga0207652_10055414
921 Ga0207652_10245798
922 Ga0207652_10630896
923 Ga0207646_10166456
924 Ga0207681_10184129
925 Ga0207681_10244988
926 Ga0207694_10017860
927 Ga0207694_10139056
928 Ga0207694_10368762
929 Ga0207650_10008082
930 Ga0207650_10243927
931 Ga0207659_10087585
932 Ga0207687_10062915
933 Ga0207687_10595549
934 Ga0207700_10027994
935 Ga0207700_10029519
936 Ga0207700_10057709
937 Ga0207700_10160928
938 Ga0207664_10040433
939 Ga0207664_10455020
940 Ga0207644_10001240
941 Ga0207644_10085795
942 Ga0207644_10170359
943 Ga0207706_10243008
944 Ga0207709_10163324
945 Ga0207709_10164860
946 Ga0207665_10017584
947 Ga0207691_10148443
948 Ga0207711_10009916
949 Ga0207689_10375065
950 Ga0207661_10072662
951 Ga0207661_10277288
952 Ga0207661_10414919
953 Ga0207661_10469333
954 Ga0207661_10735193
955 Ga0207679_10044696
956 Ga0207651_10011493
957 Ga0207668_10507928
958 Ga0207640_10029680
959 Ga0207640_10445775
960 Ga0207658_10130152
961 Ga0207678_10018096
962 Ga0207678_10212336
963 Ga0207708_10114277
964 Ga0207641_10082469
965 Ga0207641_10435395
966 Ga0207676_10147446
967 Ga0207683_10035409
968 Ga0209389_1000041
969 Ga0209489_105228
970 Ga0209700_100010
971 Ga0209179_1009079
972 Ga0209588_1043768
973 Ga0207428_10003754
974 Ga0207428_10670779
975 Ga0268266_10086002
976 Ga0268264_10183975
977 Ga0265330_10159980
978 Ga0265332_10047054
979 Ga0265332_10054308
980 Ga0265320_10011784
981 Ga0265325_10001321
982 Ga0265339_10080814
983 Ga0265331_10034617
984 Ga0265316_10023436
985 Ga0265313_10031858
986 Ga0265314_10011738
987 Ga0265342_10017105
988 Ga0316583_10002219
989 Ga0307510_10023325
990 Ga0373928_0015573
991 Ga0373929_0027327
992 Ga0373923_0008206
993 Ga0373923_0111554
994 Ga0373932_0025327
995 Ga0373932_0062317
996 Ga0373941_0078548
997 Ga0373953_0036386
998 Ga0373957_0052073
999 Ga0373960_0008815
1000 Ga0373960_0096100
1001 Ga0373943_0029361
1002 Ga0373943_0166346
1003 Ga0373946_0004816
1004 Ga0373961_0007413
1005 Ga0373961_0011190
1006 Ga0373924_0024204
1007 Ga0373931_0028701
1008 Ga0373931_0068849
1009 Ga0373931_0202494
1010 Ga0373927_0003031
1011 Ga0373927_0077817
1012 Ga0373933_0001146
1013 Ga0373947_0018683
1014 Ga0373947_0026170
1015 Ga0373947_0313956
1016 Ga0373947_0453407
1017 Ga0373937_0006789
1018 Ga0373937_0049672
1019 Ga0373937_0240847
1020 Ga0373925_0015942
1021 Ga0373925_0151565
1022 Ga0373925_0243693
1023 Ga0373925_0304406
1024 Ga0395899_0076582
1025 Ga0395900_0031724
1026 Ga0395900_0265941
1027 Ga0395898_0113276
1028 Ga0395898_0159109
1029 Ga0395898_0342027
1030 Ga0395905_0004439
1031 Ga0395905_0014655
1032 Ga0395905_0060259
1033 Ga0436364_0294605
1034 Ga0436364_1354913
1035 Ga0436365_1103520
1036 Ga0436360_0655491
1037 Ga0436361_0327575
1038 Ga0451789_0631626
1039 Ga0451795_0402816
1040 Ga0451849_0742029
1041 Ga0451853_4052471
1042 Ga0439435_0036925
1043 Ga0466965_0003867
1044 Ga0466957_0071774
1045 Ga0466960_0115939
1046 Ga0466960_0166421
1047 Ga0466967_0018550
1048 Ga0466967_0832879
1049 Ga0495592_0004263
1050 Ga0495603_0002833
1051 Ga0495629_0000409
1052 Ga0495629_0140501
1053 Ga0495629_0163022
1054 Ga0495641_0014960
1055 Ga0495651_0000765
1056 Ga0495653_0017238
1057 Ga0495580_0025173
1058 Ga0495605_0039277
1059 Ga0495639_0012682
1060 Ga0495662_0251986
1061 Ga0495664_0042760
1062 Ga0495664_0061157
1063 Ga0495584_0065866
1064 Ga0495584_0080709
1065 Ga0495585_0076688
1066 Ga0495585_0274904
1067 Ga0495594_0134644
1068 Ga0495594_0146221
1069 Ga0495583_0076981
1070 Ga0495606_0049064
1071 Ga0495608_0001595
1072 Ga0495608_0236736
1073 Ga0495610_0072280
1074 Ga0495616_0164149
1075 Ga0495618_0000463
1076 Ga0495630_0108772
1077 Ga0495630_0158934
1078 Ga0495637_0047787
1079 Ga0495637_0097436
1080 Ga0495643_0101453
1081 Ga0495644_0177558
1082 Ga0495648_0104913
1083 Ga0495648_0158827
1084 Ga0495663_0013862
1085 Ga0495666_0179025
1086 Ga0495652_0002799
1087 Ga0495652_0197449
1088 Ga0495652_0271634
1089 Ga0495665_0065150
1090 Ga0495640_0001726
1091 Ga0495640_0237841
1092 Ga0495640_0431665
1093 Ga0495587_0001870
1094 Ga0495587_0192330
1095 Ga0495598_0009046
1096 Ga0495645_0130849
1097 Ga0495633_0090780
1098 Ga0495667_0000449
1099 Ga0495656_0014167
1100 Ga0495656_0040527
1101 Ga0495656_0087485
1102 Ga0495668_0141416
1103 Ga0495634_0007434
1104 Ga0495634_0154528
1105 Ga0495635_0001992
1106 Ga0495635_0108088
1107 Ga0495635_0147339
1108 Ga0495659_0016048
1109 Ga0495661_0037465
1110 Ga0495657_0023229
1111 Ga0495657_0065562
1112 Ga0495623_0003787
1113 Ga0495646_0005008
1114 Ga0495647_0072544
1115 Ga0495658_0004246
1116 Ga0495613_0103037
1117 Ga0495613_0172035
1118 Ga0495613_0196170
1119 Ga0495613_0465399
1120 Ga0495624_0186894
1121 Ga0495670_0113427
1122 Ga0495671_0051534
1123 Ga0495671_0067020
1124 Ga0495589_0227529
1125 Ga0495600_0017964
1126 Ga0495660_0108639
1127 Ga0495581_0063090
1128 Ga0495581_0093740
1129 Ga0495581_0312283
1130 Ga0495604_0001780
1131 Ga0495604_0020747
1132 Ga0495674_0001004
1133 Ga0495674_0394514
1134 Ga0495676_0077647
1135 Ga0495676_0240211
1136 Ga0495676_0373979
1137 Ga0495675_0023303
1138 Ga0495677_0034633
1139 Ga0495673_0040799
1140 Ga0495681_0065291
1141 Ga0495684_0005592
1142 Ga0495684_0070662
1143 Ga0495602_0014319
1144 Ga0495614_0096179
1145 Ga0496100_0022641
1146 Ga0496100_0026198
1147 Ga0496100_0047880
1148 Ga0496100_0754057
1149 Ga0496101_0014208
1150 Ga0496101_0052219
1151 Ga0496101_0114964
1152 Ga0496101_0153105
1153 Ga0496101_0272326
1154 Ga0496102_0002555
1155 Ga0496102_0072324
1156 Ga0496102_0144252
1157 Ga0496102_0520075
1158 Ga0496103_0021945
1159 Ga0496103_0051627
1160 Ga0496103_0183151
1161 Ga0496103_0395262
1162 Ga0496104_0000730
1163 Ga0496104_0001076
1164 Ga0496104_0009331
1165 Ga0496104_0021681
1166 Ga0496104_0036020
1167 Ga0496104_0040425
1168 Ga0496104_0069299
1169 Ga0496104_0075277
1170 Ga0496105_0000364
1171 Ga0496105_0004848
1172 Ga0496105_0010760
1173 Ga0496105_0034986
1174 Ga0496105_0053112
1175 Ga0496105_0066848
1176 Ga0496106_0089281
1177 Ga0496106_0139145
1178 Ga0496106_0148582
1179 Ga0496106_0293767
1180 Ga0496106_0340155
1181 Ga0496107_0007274
1182 Ga0496107_0072336
1183 Ga0496107_0112982
1184 Ga0496107_0357767
1185 Ga0496108_0006618
1186 Ga0496108_0014300
1187 Ga0496108_0114663
1188 Ga0496108_0189088
1189 Ga0496108_0358069
1190 Ga0496109_0005006
1191 Ga0496109_0092353
1192 Ga0496109_0139277
1193 Ga0496109_0145720
1194 Ga0496109_0149472
1195 Ga0496110_0005635
1196 Ga0496110_0019042
1197 Ga0496110_0027225
1198 Ga0496110_0039508
1199 Ga0496110_0052318
1200 Ga0496111_0006431
1201 Ga0496111_0014626
1202 Ga0496111_0015562
1203 Ga0496111_0203614
1204 Ga0496111_0205955
1205 Ga0496112_0006633
1206 Ga0496112_0017533
1207 Ga0496112_0020955
1208 Ga0496112_0202311
1209 Ga0496112_0319005
1210 Ga0496112_0454430
1211 Ga0496112_0518685
1212 Ga0496113_0000048
1213 Ga0496113_0027751
1214 Ga0496113_0118262
1215 Ga0496113_0362959
1216 Ga0496113_0427460
1217 Ga0496114_0007248
1218 Ga0496114_0034706
1219 Ga0496114_0142850
1220 Ga0496114_0343802
1221 Ga0496114_0644646
1222 Ga0496115_0000736
1223 Ga0496115_0045914
1224 Ga0496115_0048181
1225 Ga0496115_0079506
1226 Ga0496115_0240653
1227 Ga0496116_0016469
1228 Ga0496116_0069456
1229 Ga0496119_0042892
1230 Ga0496120_0044351
1231 Ga0496121_0000612
1232 Ga0496121_0022465
1233 Ga0496121_0410790
1234 Ga0496125_0089378
1235 Ga0496125_0101780
1236 Ga0496126_0026422
1237 Ga0496126_0054381
1238 Ga0496126_0160947
1239 Ga0496126_0439053
1240 Ga0501033_0187837
1241 Ga0501034_0103459
1242 Ga0501034_0147456
1243 Ga0501038_0012938
1244 Ga0501038_0525325
1245 Ga0501039_0079188
1246 Ga0501040_0108156
1247 Ga0501040_0173432
1248 Ga0501046_0054605
1249 Ga0501047_0236876
1250 Ga0501048_0246858
1251 Ga0501068_0169170
1252 Ga0501069_0171492
1253 Ga0501070_0117300
1254 Ga0501070_0336458
1255 Ga0501071_0101577
1256 Ga0501071_0111094
1257 Ga0501071_0449976
1258 Ga0501072_0002871
1259 Ga0501072_0006078
1260 Ga0501072_0181606
1261 Ga0501073_0043794
1262 Ga0501075_0060915
1263 Ga0501075_0065677
1264 Ga0501075_0115519
1265 Ga0501075_0302812
1266 Ga0501076_0009864
1267 Ga0501076_0098779
1268 Ga0501077_0128720
1269 Ga0501077_0222125
1270 Ga0501079_0245463
1271 Ga0501079_0480144
1272 Ga0501080_0376063
1273 Ga0501081_0045257
1274 Ga0501083_0029231
1275 Ga0501083_0030684
1276 Ga0501083_0047287
1277 Ga0501035_0109447
1278 Ga0501035_0216583
1279 Ga0501044_0000519
1280 Ga0501044_0206638
1281 Ga0501044_0540096
1282 Ga0501044_0911496
1283 Ga0501045_0240034
1284 Ga0501045_0403587
1285 nmdc:mga03n38_177255_c1
1286 nmdc:mga03n38_65177_c1
1287 nmdc:mga00v17_10946_c1
1288 nmdc:mga00v17_313046_c1
1289 nmdc:mga0yw44_116345_c1
1290 nmdc:mga0yw44_11678_c1
1291 nmdc:mga0yw44_273997_c1
1292 nmdc:mga0yw44_77283_c1
1293 nmdc:mga0k408_115398_c1
1294 nmdc:mga0k408_6848_c1
1295 nmdc:mga06z11_180588_c1
1296 nmdc:mga06z11_261821_c1
1297 nmdc:mga04h51_38628_c1
1298 nmdc:mga07m45_213123_c1
1299 nmdc:mga05p37_14_c1
1300 nmdc:mga05p37_179019_c1
1301 nmdc:mga05p37_218863_c1
1302 nmdc:mga05p37_31880_c1
1303 nmdc:mga05p37_56270_c1
1304 nmdc:mga05p37_673952_c1
1305 nmdc:mga05p37_75969_c1
1306 nmdc:mga09592_104563_c1
1307 nmdc:mga09592_14380_c1
1308 nmdc:mga09592_193250_c1
1309 nmdc:mga09592_263619_c1
1310 nmdc:mga09592_274884_c1
1311 nmdc:mga09592_566822_c1
1312 nmdc:mga0qj67_31734_c1
1313 nmdc:mga0qj67_498550_c1
1314 nmdc:mga0qj67_6499_c1
1315 nmdc:mga06r32_1042_c1
1316 nmdc:mga06r32_236574_c1
1317 nmdc:mga06r32_386383_c1
1318 nmdc:mga06r32_790070_c1
1319 nmdc:mga08y16_317190_c1
1320 nmdc:mga08y16_412_c1
1321 nmdc:mga0n895_14811_c1
1322 nmdc:mga0n895_205901_c1
1323 nmdc:mga0n895_4804_c1
1324 nmdc:mga08x19_58080_c1
1325 nmdc:mga0a205_148701_c1
1326 nmdc:mga0a205_20418_c1
1327 nmdc:mga0a205_210297_c1
1328 nmdc:mga0a205_329313_c1
1329 Ga0495601_0002374
1330 Ga0495601_0080425
1331 Ga0495601_0121175
1332 Ga0495601_0256659
1333 Ga0495612_0004049
1334 Ga0495655_0007901
1335 Ga0495595_0001969
1336 Ga0495619_0010572
1337 Ga0495619_0013104
1338 Ga0495619_0425219
1339 Ga0495619_0433686
1340 Ga0500643_000116
1341 Ga0500566_0004414
1342 Ga0500650_0180981
1343 Ga0500555_001167
1344 Ga0500572_022800
1345 Ga0500592_003684
1346 Ga0500593_000557
1347 Ga0500595_013385
1348 Ga0500595_022110
1349 Ga0500608_059289
1350 Ga0500618_056947
1351 Ga0500642_0000098
1352 Ga0500655_065420
1353 Ga0500568_0000001
1354 Ga0500568_0003430
1355 Ga0500588_0186373
1356 Ga0500589_056159
1357 Ga0500604_0058392
1358 Ga0500627_0001120
1359 Ga0500636_0000468
1360 Ga0500625_016887
1361 Ga0500645_017117
1362 Ga0500601_000104
1363 Ga0501084_0333592
1364 Ga0501084_0337363
1365 Ga0501084_0422771
1366 Ga0501082_0016050
1367 Ga0501082_0207976
1368 Ga0501082_0266119
1369 Ga0501082_0297787
1370 Ga0530510_0076131
1371 Ga0530510_0088140
1372 Ga0530510_0139319
1373 2511396241
1374 2513892836
1375 2824708773
1376 2824761264
1377 2824773184
1378 2857513743
1379 2904717329
1380 3005598645
1381 8016513991
1382 8056683278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

32

187

0.98

Map