F475408

General Info

Members Datasets Scaffolds Average Seq Length
689 342 1378 277

Family's Representative Sequence

Representative Sequence 3300047445|Ga0495677_0122871|Ga0495677_0122871_14_895
Length 286
Sequence MDFWDRLADSIIDNSREPNSTVQLSNFPTRKFASSDTWESFVEHFRREQQPLSQACQAWADLFGPLRTGTVDDLVIVGQVGQSLDGRVATATGHSKFINCPAGIEHLHRLRALVDIVVVGVGTALADNPQLTVRQVAGPQPARAVIDPGGRLGANAKLFADDGVRRLLITTDGSRAAPSPGVEVITLPASAIVASLAGAGMRRILIEGGADTVSRFIAARCLDRLHVNVAPVMLGAGGPGIELPPLERADQAHRMQVRVHKIEDDVLFDCDLSDQRVTIGVAKKST

Samples

Sample ID Description Type Environment
1 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
221 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
222 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
306 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
338 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
339 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0.15
Rhizoplane 0.87
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 8.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495677_0122871 3300047445 Bacteria 991
2 2214745206 2209111006 Bacteria 15476
3 ARcpr5oldR_c000054 3300000041 Bacteria 21079
4 ARSoilYngRDRAFT_c00031 3300000042 Bacteria 22082
5 ARcpr5yngRDRAFT_c000009 3300000043 Bacteria 37168
6 ARSoilOldRDRAFT_c000055 3300000044 Bacteria 23615
7 ARCol0yngRDRAFT_1000044 3300000652 Bacteria 21392
8 JGI24738J21930_10000339 3300002075 Bacteria 12791
9 rootH1_10211533 3300003323 Bacteria 2134
10 Ga0065716_1001996 3300005277 Bacteria 2495
11 Ga0065715_10000671 3300005293 Bacteria 11029
12 Ga0070676_10000016 3300005328 Bacteria 52098
13 Ga0070683_100000075 3300005329 Bacteria 67998
14 Ga0070683_100023207 3300005329 Bacteria 5548
15 Ga0070690_100001770 3300005330 Bacteria 11417
16 Ga0070690_100041169 3300005330 Bacteria 2924
17 Ga0070670_100161558 3300005331 Unclassified 1941
18 Ga0070670_100247191 3300005331 Bacteria 1553
19 Ga0070677_10000005 3300005333 Bacteria 79035
20 Ga0068869_100000578 3300005334 Bacteria 20535
21 Ga0068869_100001023 3300005334 Bacteria 16267
22 Ga0068869_100015281 3300005334 Bacteria 5145
23 Ga0070680_100000526 3300005336 Bacteria 26129
24 Ga0070680_100013188 3300005336 Bacteria 6434
25 Ga0070680_100055014 3300005336 Bacteria 3251
26 Ga0070682_100000144 3300005337 Bacteria 56618
27 Ga0070682_100013350 3300005337 Bacteria 4724
28 Ga0068868_100011353 3300005338 Bacteria 6486
29 Ga0068868_100032992 3300005338 Bacteria 3987
30 Ga0070660_100000153 3300005339 Bacteria 44533
31 Ga0070660_100089482 3300005339 Bacteria 2425
32 Ga0070660_100131960 3300005339 Unclassified 1999
33 Ga0070689_100003924 3300005340 Bacteria 9974
34 Ga0070691_10000030 3300005341 Bacteria 39784
35 Ga0070687_100000016 3300005343 Bacteria 55051
36 Ga0070687_100000523 3300005343 Bacteria 12899
37 Ga0070661_100000249 3300005344 Bacteria 44246
38 Ga0070668_100004112 3300005347 Bacteria 10770
39 Ga0070668_100005571 3300005347 Bacteria 9346
40 Ga0070668_100010862 3300005347 Bacteria 6776
41 Ga0070668_100011400 3300005347 Bacteria 6623
42 Ga0070668_100043035 3300005347 Bacteria 3463
43 Ga0070668_100060749 3300005347 Bacteria 2928
44 Ga0070669_100000145 3300005353 Bacteria 63377
45 Ga0070669_100131762 3300005353 Unclassified 1919
46 Ga0070675_100000081 3300005354 Bacteria 56087
47 Ga0070675_100131541 3300005354 Unclassified 2133
48 Ga0070675_100163423 3300005354 Bacteria 1916
49 Ga0070675_100393219 3300005354 Bacteria 1236
50 Ga0070671_100000267 3300005355 Bacteria 35238
51 Ga0070671_100044312 3300005355 Bacteria 3697
52 Ga0070671_100503057 3300005355 Bacteria 1042
53 Ga0070674_100000906 3300005356 Bacteria 15510
54 Ga0070674_100016271 3300005356 Bacteria 4660
55 Ga0070674_100045953 3300005356 Bacteria 2985
56 Ga0070673_100000125 3300005364 Bacteria 35606
57 Ga0070688_100000075 3300005365 Bacteria 49279
58 Ga0070659_100000144 3300005366 Bacteria 55051
59 Ga0070659_100081479 3300005366 Bacteria 2585
60 Ga0070667_100001956 3300005367 Bacteria 18291
61 Ga0070667_100271498 3300005367 Unclassified 1521
62 Ga0070667_100273039 3300005367 Bacteria 1516
63 Ga0070703_10001239 3300005406 Bacteria 7783
64 Ga0070709_10010606 3300005434 Bacteria 5107
65 Ga0070709_10083276 3300005434 Unclassified 2092
66 Ga0070709_10107847 3300005434 Unclassified 1867
67 Ga0070714_100037672 3300005435 Bacteria 4065
68 Ga0070714_100089873 3300005435 Unclassified 2689
69 Ga0070714_100418990 3300005435 Unclassified 1268
70 Ga0070713_100011623 3300005436 Bacteria 6421
71 Ga0070713_100039196 3300005436 Bacteria 3844
72 Ga0070713_100056090 3300005436 Bacteria 3277
73 Ga0070713_100153563 3300005436 Unclassified 2050
74 Ga0070710_10005280 3300005437 Bacteria 6125
75 Ga0070710_10008433 3300005437 Bacteria 5016
76 Ga0070710_10012516 3300005437 Unclassified 4214
77 Ga0070701_10000058 3300005438 Bacteria 29228
78 Ga0070701_10001508 3300005438 Bacteria 8628
79 Ga0070701_10078045 3300005438 Bacteria 1786
80 Ga0070711_100005040 3300005439 Bacteria 7858
81 Ga0070711_100028808 3300005439 Bacteria 3657
82 Ga0070711_100141660 3300005439 Unclassified 1803
83 Ga0070711_100322990 3300005439 Bacteria 1234
84 Ga0070711_100456176 3300005439 Bacteria 1047
85 Ga0070705_100000926 3300005440 Bacteria 16411
86 Ga0070705_100074583 3300005440 Bacteria 2063
87 Ga0070705_100102367 3300005440 Bacteria 1811
88 Ga0070700_100000100 3300005441 Bacteria 54110
89 Ga0070700_100010505 3300005441 Bacteria 5115
90 Ga0070700_100033235 3300005441 Bacteria 3105
91 Ga0070694_100000041 3300005444 Bacteria 59039
92 Ga0070708_100697703 3300005445 Bacteria 955
93 Ga0070663_100000071 3300005455 Bacteria 44246
94 Ga0070663_100031408 3300005455 Bacteria 3650
95 Ga0070663_100046789 3300005455 Bacteria 3063
96 Ga0070663_100063563 3300005455 Bacteria 2666
97 Ga0070663_100252731 3300005455 Unclassified 1395
98 Ga0070663_100253888 3300005455 Bacteria 1392
99 Ga0070663_100497532 3300005455 Bacteria 1012
100 Ga0070678_100000239 3300005456 Bacteria 25186
101 Ga0070662_100048415 3300005457 Bacteria 3062
102 Ga0070662_100076384 3300005457 Bacteria 2483
103 Ga0070681_10012408 3300005458 Bacteria 8452
104 Ga0070681_10106904 3300005458 Bacteria 2739
105 Ga0068867_100005147 3300005459 Bacteria 9242
106 Ga0068867_100129592 3300005459 Bacteria 1959
107 Ga0068867_100144219 3300005459 Bacteria 1864
108 Ga0070685_10000994 3300005466 Bacteria 15225
109 Ga0070685_10042305 3300005466 Bacteria 2600
110 Ga0070685_10181485 3300005466 Bacteria 1355
111 Ga0070698_100347650 3300005471 Bacteria 1414
112 Ga0070679_100000464 3300005530 Bacteria 34507
113 Ga0070679_100099308 3300005530 Bacteria 2898
114 Ga0070679_100188094 3300005530 Bacteria 2034
115 Ga0070684_100000099 3300005535 Bacteria 56087
116 Ga0070684_100010477 3300005535 Bacteria 7346
117 Ga0070684_100024110 3300005535 Bacteria 5101
118 Ga0070684_100069938 3300005535 Bacteria 3087
119 Ga0068853_100001732 3300005539 Bacteria 15993
120 Ga0068853_100054176 3300005539 Bacteria 3456
121 Ga0068853_100077942 3300005539 Unclassified 2895
122 Ga0068853_100088688 3300005539 Bacteria 2716
123 Ga0070672_100000035 3300005543 Bacteria 60570
124 Ga0070672_100137787 3300005543 Unclassified 2011
125 Ga0070686_100000086 3300005544 Bacteria 65438
126 Ga0070686_100034726 3300005544 Bacteria 3110
127 Ga0070695_100000036 3300005545 Bacteria 51060
128 Ga0070695_100043988 3300005545 Bacteria 2841
129 Ga0070695_100046618 3300005545 Unclassified 2765
130 Ga0070696_100028094 3300005546 Bacteria 3837
131 Ga0070693_100000310 3300005547 Bacteria 22583
132 Ga0070693_100008664 3300005547 Bacteria 5033
133 Ga0070693_100034107 3300005547 Bacteria 2815
134 Ga0070665_100011985 3300005548 Bacteria 8752
135 Ga0070665_100066725 3300005548 Bacteria 3610
136 Ga0070665_100091758 3300005548 Bacteria 3042
137 Ga0070665_100111336 3300005548 Unclassified 2740
138 Ga0070665_100120501 3300005548 Bacteria 2625
139 Ga0070665_100168550 3300005548 Bacteria 2191
140 Ga0070704_100042434 3300005549 Bacteria 3147
141 Ga0068855_100015219 3300005563 Bacteria 9262
142 Ga0068855_100057218 3300005563 Bacteria 4571
143 Ga0068855_100088285 3300005563 Bacteria 3582
144 Ga0068855_100088533 3300005563 Bacteria 3576
145 Ga0068855_100449783 3300005563 Bacteria 1406
146 Ga0070664_100004564 3300005564 Bacteria 11111
147 Ga0070664_100235441 3300005564 Bacteria 1642
148 Ga0070664_100372659 3300005564 Bacteria 1302
149 Ga0068857_100000122 3300005577 Bacteria 46603
150 Ga0068857_100014334 3300005577 Bacteria 6909
151 Ga0068854_100000410 3300005578 Bacteria 26884
152 Ga0068856_100001112 3300005614 Bacteria 28418
153 Ga0068856_100076602 3300005614 Bacteria 3314
154 Ga0070702_100001141 3300005615 Bacteria 10666
155 Ga0070702_100008187 3300005615 Bacteria 5051
156 Ga0068852_100013184 3300005616 Bacteria 6317
157 Ga0068852_100044248 3300005616 Bacteria 3780
158 Ga0068852_100446477 3300005616 Unclassified 1280
159 Ga0068859_100000365 3300005617 Bacteria 45011
160 Ga0068859_100006951 3300005617 Bacteria 11493
161 Ga0068859_100084981 3300005617 Bacteria 3209
162 Ga0068859_100130246 3300005617 Unclassified 2587
163 Ga0068859_100316508 3300005617 Bacteria 1654
164 Ga0068859_100780744 3300005617 Unclassified 1043
165 Ga0068864_100000271 3300005618 Bacteria 46062
166 Ga0068864_100119714 3300005618 Bacteria 2353
167 Ga0068866_10000213 3300005718 Bacteria 27527
168 Ga0068866_10017383 3300005718 Bacteria 3234
169 Ga0068866_10327642 3300005718 Bacteria 966
170 Ga0068861_100000340 3300005719 Bacteria 26546
171 Ga0068861_100002454 3300005719 Bacteria 12087
172 Ga0068861_100031257 3300005719 Bacteria 3910
173 Ga0068861_100038630 3300005719 Bacteria 3557
174 Ga0068870_10000079 3300005840 Bacteria 31219
175 Ga0068870_10012310 3300005840 Bacteria 3995
176 Ga0068870_10050587 3300005840 Bacteria 2196
177 Ga0068863_100000372 3300005841 Bacteria 45645
178 Ga0068863_100095915 3300005841 Bacteria 2815
179 Ga0068863_100130839 3300005841 Bacteria 2396
180 Ga0068863_100155066 3300005841 Bacteria 2192
181 Ga0068858_100000809 3300005842 Bacteria 32733
182 Ga0068858_100011014 3300005842 Bacteria 8546
183 Ga0068858_100084191 3300005842 Bacteria 2958
184 Ga0068858_100131202 3300005842 Bacteria 2350
185 Ga0068858_100162708 3300005842 Bacteria 2102
186 Ga0068860_100000709 3300005843 Bacteria 38176
187 Ga0068860_100232282 3300005843 Bacteria 1792
188 Ga0068860_100313521 3300005843 Bacteria 1538
189 Ga0068862_100000512 3300005844 Bacteria 41177
190 Ga0068862_100003054 3300005844 Bacteria 14584
191 Ga0068862_100004009 3300005844 Bacteria 12486
192 Ga0068862_100105761 3300005844 Bacteria 2466
193 Ga0081455_10000007 3300005937 Bacteria 269394
194 Ga0081455_10004091 3300005937 Bacteria 16511
195 Ga0081455_10004612 3300005937 Bacteria 15392
196 Ga0081455_10006391 3300005937 Bacteria 12652
197 Ga0081455_10006527 3300005937 Bacteria 12487
198 Ga0081455_10026677 3300005937 Bacteria 5306
199 Ga0081455_10104824 3300005937 Bacteria 2261
200 Ga0081455_10165469 3300005937 Bacteria 1690
201 Ga0081540_1000849 3300005983 Bacteria 27799
202 Ga0081540_1003812 3300005983 Bacteria 11793
203 Ga0081540_1040665 3300005983 Unclassified 2420
204 Ga0070717_10000938 3300006028 Bacteria 19441
205 Ga0070717_10022929 3300006028 Unclassified 4940
206 Ga0070717_10235739 3300006028 Bacteria 1612
207 Ga0070717_10331607 3300006028 Bacteria 1357
208 Ga0075365_10044741 3300006038 Bacteria 2902
209 Ga0075365_10072096 3300006038 Bacteria 2326
210 Ga0075368_10011952 3300006042 Bacteria 3167
211 Ga0075368_10016585 3300006042 Bacteria 2746
212 Ga0075368_10130870 3300006042 Bacteria 1043
213 Ga0075363_100007053 3300006048 Bacteria 5137
214 Ga0070715_10005821 3300006163 Bacteria 4149
215 Ga0070715_10113598 3300006163 Bacteria 1281
216 Ga0070715_10184008 3300006163 Bacteria 1050
217 Ga0070716_100003941 3300006173 Bacteria 7044
218 Ga0070716_100060827 3300006173 Unclassified 2183
219 Ga0070712_100002813 3300006175 Bacteria 10764
220 Ga0070712_100021865 3300006175 Bacteria 4208
221 Ga0070712_100082554 3300006175 Bacteria 2331
222 Ga0070712_100114763 3300006175 Bacteria 2017
223 Ga0070712_100168607 3300006175 Bacteria 1697
224 Ga0075362_10037602 3300006177 Bacteria 2123
225 Ga0075367_10010055 3300006178 Bacteria 4960
226 Ga0075367_10154647 3300006178 Bacteria 1424
227 Ga0075427_10008597 3300006194 Unclassified 1516
228 Ga0075366_10041571 3300006195 Bacteria 2722
229 Ga0075366_10093400 3300006195 Bacteria 1803
230 Ga0097621_100000047 3300006237 Bacteria 63910
231 Ga0097621_100352884 3300006237 Bacteria 1308
232 Ga0097621_100558607 3300006237 Bacteria 1042
233 Ga0075370_10003095 3300006353 Bacteria 7851
234 Ga0068871_100000721 3300006358 Bacteria 22411
235 Ga0068871_100045593 3300006358 Bacteria 3529
236 Ga0068871_100302613 3300006358 Bacteria 1404
237 Ga0075428_100005796 3300006844 Bacteria 13717
238 Ga0075428_100599340 3300006844 Bacteria 1177
239 Ga0075430_100000770 3300006846 Bacteria 24728
240 Ga0075431_100000399 3300006847 Bacteria 35027
241 Ga0075431_100044475 3300006847 Bacteria 4581
242 Ga0075431_100232597 3300006847 Bacteria 1877
243 Ga0075433_10000374 3300006852 Bacteria 28158
244 Ga0075433_10002587 3300006852 Bacteria 13788
245 Ga0075434_100001558 3300006871 Bacteria 19441
246 Ga0075434_100002975 3300006871 Bacteria 15080
247 Ga0075434_100035267 3300006871 Bacteria 4945
248 Ga0075434_100110352 3300006871 Bacteria 2761
249 Ga0075434_100327957 3300006871 Bacteria 1551
250 Ga0075434_100381566 3300006871 Bacteria 1430
251 Ga0075429_100002444 3300006880 Bacteria 15642
252 Ga0068865_100000415 3300006881 Bacteria 23798
253 Ga0068865_100303440 3300006881 Bacteria 1279
254 Ga0097620_100000365 3300006931 Bacteria 45011
255 Ga0097620_100006952 3300006931 Bacteria 11493
256 Ga0097620_100084976 3300006931 Bacteria 3209
257 Ga0097620_100130244 3300006931 Unclassified 2587
258 Ga0097620_100316504 3300006931 Bacteria 1654
259 Ga0097620_100780720 3300006931 Unclassified 1043
260 Ga0075435_100004974 3300007076 Bacteria 9226
261 Ga0075435_100025482 3300007076 Bacteria 4604
262 Ga0075435_100084751 3300007076 Bacteria 2608
263 Ga0105251_10134401 3300009011 Bacteria 1120
264 Ga0105240_10163423 3300009093 Bacteria 2642
265 Ga0105240_10348400 3300009093 Bacteria 1681
266 Ga0111539_10001287 3300009094 Bacteria 33486
267 Ga0105245_10170985 3300009098 Bacteria 2069
268 Ga0105247_10069217 3300009101 Bacteria 2202
269 Ga0114129_10550459 3300009147 Bacteria 1500
270 Ga0105243_10003796 3300009148 Bacteria 12086
271 Ga0105241_10020291 3300009174 Bacteria 4909
272 Ga0105241_10518014 3300009174 Bacteria 1066
273 Ga0105242_10139274 3300009176 Bacteria 2104
274 Ga0105248_10010344 3300009177 Bacteria 10269
275 Ga0105237_10006329 3300009545 Bacteria 13159
276 Ga0105237_10013540 3300009545 Bacteria 8547
277 Ga0105237_10053330 3300009545 Bacteria 4056
278 Ga0105238_10059268 3300009551 Bacteria 3835
279 Ga0105238_10136392 3300009551 Bacteria 2431
280 Ga0105249_10007192 3300009553 Bacteria 9721
281 Ga0105249_10013007 3300009553 Bacteria 7344
282 Ga0105249_10106968 3300009553 Bacteria 2639
283 Ga0099796_10010645 3300010159 Bacteria 2536
284 Ga0099796_10062744 3300010159 Bacteria 1321
285 Ga0105239_10016817 3300010375 Bacteria 8085
286 Ga0105239_10169970 3300010375 Bacteria 2437
287 Ga0105239_10546750 3300010375 Bacteria 1319
288 Ga0105246_10157166 3300011119 Bacteria 1728
289 Ga0157369_10156741 3300013105 Bacteria 2405
290 Ga0157369_10788400 3300013105 Bacteria 977
291 Ga0157374_10022777 3300013296 Bacteria 5594
292 Ga0157374_10023113 3300013296 Bacteria 5555
293 Ga0157374_10233531 3300013296 Bacteria 1807
294 Ga0157378_10008624 3300013297 Bacteria 8870
295 Ga0157378_10379753 3300013297 Bacteria 1387
296 Ga0157378_10612801 3300013297 Bacteria 1101
297 Ga0163162_10026487 3300013306 Bacteria 5729
298 Ga0157372_10234789 3300013307 Unclassified 2127
299 Ga0163163_10085670 3300014325 Bacteria 3159
300 Ga0163163_10624150 3300014325 Bacteria 1141
301 Ga0157380_10021456 3300014326 Bacteria 4844
302 Ga0157380_10070979 3300014326 Bacteria 2816
303 Ga0157380_10137835 3300014326 Bacteria 2091
304 Ga0157380_10260071 3300014326 Bacteria 1576
305 Ga0157379_10085363 3300014968 Bacteria 2829
306 Ga0157376_10068356 3300014969 Bacteria 3008
307 Ga0157376_10420450 3300014969 Bacteria 1297
308 Ga0163161_10000363 3300017792 Bacteria 37872
309 Ga0163161_10089947 3300017792 Bacteria 2271
310 Ga0163161_10354077 3300017792 Bacteria 1168
311 Ga0213874_10068114 3300021377 Unclassified 1129
312 Ga0207666_1000015 3300025271 Bacteria 41241
313 Ga0207666_1002258 3300025271 Bacteria 2311
314 Ga0207673_1000067 3300025290 Bacteria 8932
315 Ga0209758_1028463 3300025297 Bacteria 2362
316 Ga0207697_10000088 3300025315 Bacteria 41270
317 Ga0207697_10020214 3300025315 Bacteria 2726
318 Ga0207653_10000413 3300025885 Bacteria 18224
319 Ga0207682_10000004 3300025893 Bacteria 104760
320 Ga0207692_10005243 3300025898 Bacteria 5180
321 Ga0207692_10025276 3300025898 Bacteria 2771
322 Ga0207692_10181293 3300025898 Bacteria 1227
323 Ga0207642_10000291 3300025899 Bacteria 14980
324 Ga0207642_10011859 3300025899 Bacteria 3125
325 Ga0207710_10001511 3300025900 Bacteria 11534
326 Ga0207688_10000042 3300025901 Bacteria 44479
327 Ga0207688_10065419 3300025901 Bacteria 2054
328 Ga0207688_10306880 3300025901 Bacteria 971
329 Ga0207680_10000311 3300025903 Bacteria 23202
330 Ga0207680_10096369 3300025903 Unclassified 1892
331 Ga0207647_10000417 3300025904 Bacteria 35010
332 Ga0207647_10009783 3300025904 Bacteria 6800
333 Ga0207685_10043089 3300025905 Bacteria 1698
334 Ga0207699_10065167 3300025906 Unclassified 2207
335 Ga0207645_10000061 3300025907 Bacteria 77457
336 Ga0207643_10000012 3300025908 Bacteria 133318
337 Ga0207643_10023231 3300025908 Bacteria 3419
338 Ga0207705_10174962 3300025909 Bacteria 1617
339 Ga0207684_10004800 3300025910 Bacteria 12657
340 Ga0207654_10001794 3300025911 Bacteria 11151
341 Ga0207654_10008001 3300025911 Bacteria 5330
342 Ga0207707_10006541 3300025912 Bacteria 10170
343 Ga0207707_10006621 3300025912 Bacteria 10109
344 Ga0207707_10045574 3300025912 Bacteria 3821
345 Ga0207695_10151269 3300025913 Bacteria 2260
346 Ga0207671_10027210 3300025914 Bacteria 4276
347 Ga0207671_10085676 3300025914 Bacteria 2368
348 Ga0207693_10006337 3300025915 Bacteria 9808
349 Ga0207693_10013325 3300025915 Bacteria 6629
350 Ga0207693_10013933 3300025915 Bacteria 6475
351 Ga0207693_10023130 3300025915 Bacteria 4935
352 Ga0207693_10379367 3300025915 Bacteria 1106
353 Ga0207663_10017249 3300025916 Bacteria 4019
354 Ga0207663_10019869 3300025916 Unclassified 3793
355 Ga0207660_10000008 3300025917 Bacteria 98521
356 Ga0207660_10020887 3300025917 Bacteria 4399
357 Ga0207662_10000097 3300025918 Bacteria 41243
358 Ga0207662_10001598 3300025918 Bacteria 11094
359 Ga0207657_10000503 3300025919 Bacteria 41249
360 Ga0207657_10002293 3300025919 Bacteria 20727
361 Ga0207657_10026996 3300025919 Bacteria 5264
362 Ga0207649_10000099 3300025920 Bacteria 71350
363 Ga0207652_10001041 3300025921 Bacteria 25403
364 Ga0207652_10044158 3300025921 Bacteria 3796
365 Ga0207646_10076790 3300025922 Bacteria 2985
366 Ga0207681_10000141 3300025923 Bacteria 59951
367 Ga0207694_10012899 3300025924 Bacteria 6292
368 Ga0207694_10342688 3300025924 Bacteria 1236
369 Ga0207650_10007055 3300025925 Bacteria 7659
370 Ga0207659_10000023 3300025926 Bacteria 142947
371 Ga0207659_10339868 3300025926 Bacteria 1243
372 Ga0207687_10000319 3300025927 Bacteria 32748
373 Ga0207687_10002932 3300025927 Bacteria 11587
374 Ga0207687_10012739 3300025927 Bacteria 5494
375 Ga0207687_10191408 3300025927 Bacteria 1592
376 Ga0207700_10000751 3300025928 Bacteria 18675
377 Ga0207700_10076919 3300025928 Unclassified 2591
378 Ga0207700_10084440 3300025928 Bacteria 2489
379 Ga0207700_10114250 3300025928 Bacteria 2178
380 Ga0207664_10462048 3300025929 Bacteria 1134
381 Ga0207644_10015130 3300025931 Bacteria 5175
382 Ga0207644_10078901 3300025931 Bacteria 2428
383 Ga0207690_10000105 3300025932 Bacteria 68515
384 Ga0207706_10000438 3300025933 Bacteria 44481
385 Ga0207706_10005437 3300025933 Bacteria 11870
386 Ga0207706_10206838 3300025933 Unclassified 1721
387 Ga0207686_10000140 3300025934 Bacteria 56605
388 Ga0207686_10090867 3300025934 Unclassified 2015
389 Ga0207686_10336556 3300025934 Unclassified 1132
390 Ga0207709_10000264 3300025935 Bacteria 62258
391 Ga0207709_10005146 3300025935 Bacteria 7460
392 Ga0207709_10092207 3300025935 Unclassified 1983
393 Ga0207670_10000108 3300025936 Bacteria 56906
394 Ga0207670_10117134 3300025936 Bacteria 1930
395 Ga0207669_10000110 3300025937 Bacteria 40953
396 Ga0207669_10003138 3300025937 Bacteria 7125
397 Ga0207669_10044617 3300025937 Bacteria 2606
398 Ga0207704_10000171 3300025938 Bacteria 34340
399 Ga0207665_10001820 3300025939 Bacteria 14355
400 Ga0207711_10002682 3300025941 Bacteria 15745
401 Ga0207711_10081110 3300025941 Bacteria 2834
402 Ga0207711_10459918 3300025941 Bacteria 1185
403 Ga0207689_10000008 3300025942 Bacteria 127942
404 Ga0207689_10003600 3300025942 Bacteria 14146
405 Ga0207689_10032016 3300025942 Bacteria 4374
406 Ga0207689_10276869 3300025942 Unclassified 1389
407 Ga0207689_10284532 3300025942 Bacteria 1369
408 Ga0207661_10000053 3300025944 Bacteria 90600
409 Ga0207661_10180498 3300025944 Bacteria 1843
410 Ga0207679_10000053 3300025945 Bacteria 109038
411 Ga0207679_10298236 3300025945 Bacteria 1388
412 Ga0207679_10432006 3300025945 Bacteria 1164
413 Ga0207667_10008564 3300025949 Bacteria 12140
414 Ga0207651_10000052 3300025960 Bacteria 53826
415 Ga0207651_10073342 3300025960 Bacteria 2434
416 Ga0207712_10000156 3300025961 Bacteria 70300
417 Ga0207712_10029018 3300025961 Bacteria 3708
418 Ga0207712_10065250 3300025961 Bacteria 2598
419 Ga0207668_10000160 3300025972 Bacteria 47008
420 Ga0207668_10001768 3300025972 Bacteria 12618
421 Ga0207668_10004317 3300025972 Bacteria 8349
422 Ga0207668_10014488 3300025972 Bacteria 4881
423 Ga0207668_10015858 3300025972 Bacteria 4692
424 Ga0207668_10032006 3300025972 Bacteria 3471
425 Ga0207668_10196760 3300025972 Bacteria 1602
426 Ga0207668_10214628 3300025972 Unclassified 1541
427 Ga0207640_10000325 3300025981 Bacteria 31933
428 Ga0207658_10036051 3300025986 Bacteria 3545
429 Ga0207677_10009376 3300026023 Bacteria 5509
430 Ga0207677_10080611 3300026023 Bacteria 2333
431 Ga0207677_10082504 3300026023 Bacteria 2310
432 Ga0207703_10001510 3300026035 Bacteria 21203
433 Ga0207703_10022564 3300026035 Bacteria 4938
434 Ga0207703_10173335 3300026035 Bacteria 1899
435 Ga0207639_10001511 3300026041 Bacteria 15635
436 Ga0207639_10108021 3300026041 Bacteria 2261
437 Ga0207678_10000185 3300026067 Bacteria 53359
438 Ga0207678_10014425 3300026067 Bacteria 6948
439 Ga0207678_10015331 3300026067 Bacteria 6741
440 Ga0207678_10019755 3300026067 Bacteria 5927
441 Ga0207678_10021191 3300026067 Bacteria 5697
442 Ga0207678_10031346 3300026067 Bacteria 4638
443 Ga0207678_10034592 3300026067 Bacteria 4401
444 Ga0207708_10000263 3300026075 Bacteria 41243
445 Ga0207708_10001344 3300026075 Bacteria 18498
446 Ga0207708_10036156 3300026075 Bacteria 3760
447 Ga0207708_10417458 3300026075 Bacteria 1112
448 Ga0207708_10484129 3300026075 Unclassified 1035
449 Ga0207702_10000297 3300026078 Bacteria 57296
450 Ga0207702_10034823 3300026078 Bacteria 4212
451 Ga0207641_10000775 3300026088 Bacteria 34184
452 Ga0207641_10066130 3300026088 Bacteria 3094
453 Ga0207641_10244309 3300026088 Bacteria 1674
454 Ga0207648_10000469 3300026089 Bacteria 45034
455 Ga0207648_10038076 3300026089 Bacteria 4233
456 Ga0207648_10059475 3300026089 Bacteria 3332
457 Ga0207648_10092869 3300026089 Bacteria 2639
458 Ga0207648_10167388 3300026089 Bacteria 1942
459 Ga0207676_10001235 3300026095 Bacteria 19009
460 Ga0207676_10007604 3300026095 Bacteria 7694
461 Ga0207674_10001208 3300026116 Bacteria 33667
462 Ga0207674_10028740 3300026116 Bacteria 5864
463 Ga0207675_100000342 3300026118 Bacteria 44471
464 Ga0207675_100018349 3300026118 Bacteria 6524
465 Ga0207675_100019267 3300026118 Bacteria 6365
466 Ga0207675_100172606 3300026118 Unclassified 2067
467 Ga0207683_10000006 3300026121 Bacteria 181260
468 Ga0207683_10007794 3300026121 Bacteria 9162
469 Ga0207683_10095459 3300026121 Unclassified 2651
470 Ga0207683_10269977 3300026121 Bacteria 1554
471 Ga0207683_10446382 3300026121 Bacteria 1192
472 Ga0207698_10000236 3300026142 Bacteria 34581
473 Ga0209973_1002926 3300027252 Unclassified 1640
474 Ga0209971_1013750 3300027682 Unclassified 1917
475 Ga0209971_1028891 3300027682 Bacteria 1327
476 Ga0209998_10001431 3300027717 Bacteria 5774
477 Ga0209998_10004020 3300027717 Bacteria 3148
478 Ga0209813_10005828 3300027866 Bacteria 3015
479 Ga0209974_10002024 3300027876 Bacteria 7403
480 Ga0209974_10039609 3300027876 Bacteria 1567
481 Ga0207428_10000112 3300027907 Bacteria 110733
482 Ga0207428_10000417 3300027907 Bacteria 52860
483 Ga0207428_10000480 3300027907 Bacteria 48240
484 Ga0207428_10149355 3300027907 Bacteria 1779
485 Ga0268266_10015275 3300028379 Bacteria 6591
486 Ga0268266_10015395 3300028379 Bacteria 6562
487 Ga0268266_10017509 3300028379 Bacteria 6113
488 Ga0268266_10036687 3300028379 Bacteria 4174
489 Ga0268266_10266097 3300028379 Bacteria 1590
490 Ga0268265_10000257 3300028380 Bacteria 60485
491 Ga0268265_10043763 3300028380 Bacteria 3330
492 Ga0268265_10094530 3300028380 Unclassified 2398
493 Ga0268265_10149745 3300028380 Bacteria 1966
494 Ga0268265_10223722 3300028380 Unclassified 1648
495 Ga0268264_10000579 3300028381 Bacteria 44364
496 Ga0268264_10145178 3300028381 Bacteria 2121
497 Ga0268264_10263683 3300028381 Bacteria 1606
498 Ga0265338_10019899 3300028800 Bacteria 7091
499 Ga0265325_10002196 3300031241 Bacteria 13261
500 Ga0265329_10045582 3300031242 Bacteria 1401
501 Ga0265340_10004522 3300031247 Bacteria 7757
502 Ga0265340_10013567 3300031247 Bacteria 4278
503 Ga0307509_10282892 3300031507 Unclassified 1418
504 Ga0265313_10031295 3300031595 Bacteria 2729
505 Ga0307508_10296553 3300031616 Bacteria 1209
506 Ga0307413_10090700 3300031824 Bacteria 1989
507 Ga0307414_10297361 3300032004 Bacteria 1364
508 Ga0307411_10022180 3300032005 Bacteria 3733
509 Ga0307510_10202210 3300033180 Unclassified 1520
510 Ga0373930_0000160 3300034816 Bacteria 7781
511 Ga0373948_0001631 3300034817 Unclassified 3164
512 Ga0373950_0000344 3300034818 Bacteria 5784
513 Ga0373959_0000573 3300034820 Bacteria 6467
514 Ga0373938_0000090 3300034957 Bacteria 12290
515 Ga0373926_0005345 3300035083 Bacteria 4229
516 Ga0373928_0000746 3300035084 Bacteria 6375
517 Ga0373940_0000074 3300035088 Bacteria 11657
518 Ga0373949_0001646 3300035090 Bacteria 6231
519 Ga0373951_0001485 3300035091 Bacteria 6116
520 Ga0373952_0001442 3300035092 Bacteria 4323
521 Ga0373923_0000748 3300035111 Bacteria 8411
522 Ga0373932_0000751 3300035112 Bacteria 9658
523 Ga0373936_0010785 3300035113 Bacteria 3450
524 Ga0373936_0028423 3300035113 Bacteria 2198
525 Ga0373939_0000873 3300035114 Bacteria 7470
526 Ga0373941_0000030 3300035115 Bacteria 21511
527 Ga0373945_0019356 3300035116 Bacteria 2324
528 Ga0373945_0028265 3300035116 Bacteria 1964
529 Ga0373953_0015516 3300035117 Bacteria 2763
530 Ga0373953_0098315 3300035117 Bacteria 1230
531 Ga0373954_0075905 3300035118 Bacteria 1601
532 Ga0373956_0028834 3300035119 Bacteria 2417
533 Ga0373943_0005228 3300035170 Bacteria 5842
534 Ga0373943_0114943 3300035170 Bacteria 1424
535 Ga0373946_0004802 3300035171 Bacteria 4864
536 Ga0373946_0006843 3300035171 Bacteria 4148
537 Ga0373946_0055308 3300035171 Bacteria 1673
538 Ga0373955_0000090 3300035172 Bacteria 36712
539 Ga0373955_0015306 3300035172 Bacteria 3752
540 Ga0373955_0081548 3300035172 Bacteria 1829
541 Ga0373942_0000232 3300035207 Bacteria 14790
542 Ga0373961_0001000 3300035241 Bacteria 9283
543 Ga0373962_0020542 3300035242 Unclassified 1735
544 Ga0373935_0000418 3300035692 Bacteria 22120
545 Ga0373935_0004551 3300035692 Bacteria 8152
546 Ga0373935_0007460 3300035692 Bacteria 6546
547 Ga0373935_0112074 3300035692 Bacteria 1812
548 Ga0373935_0181030 3300035692 Bacteria 1447
549 Ga0373927_0004434 3300035695 Bacteria 9836
550 Ga0373927_0007901 3300035695 Bacteria 7188
551 Ga0373927_0066537 3300035695 Bacteria 2331
552 Ga0373927_0089921 3300035695 Bacteria 1994
553 Ga0373933_0135960 3300035724 Bacteria 1549
554 Ga0373947_0002133 3300035725 Bacteria 12043
555 Ga0373947_0016707 3300035725 Bacteria 4217
556 Ga0373947_0023965 3300035725 Bacteria 3553
557 Ga0373937_0000733 3300036401 Bacteria 28363
558 Ga0373937_0005736 3300036401 Bacteria 10663
559 Ga0373937_0025710 3300036401 Bacteria 5317
560 Ga0373925_0000064 3300037068 Bacteria 114743
561 Ga0373925_0021935 3300037068 Bacteria 4656
562 Ga0373925_0034015 3300037068 Bacteria 3756
563 Ga0242420_005665 3300038996 Unclassified 1945
564 Ga0436363_0192704 3300039450 Unclassified 1477
565 Ga0451843_0438584 3300041509 Bacteria 1272
566 Ga0451577_0223730 3300042876 Unclassified 1701
567 Ga0453684_0078254 3300044712 Bacteria 4139
568 Ga0451576_0267106 3300045051 Unclassified 1788
569 Ga0495592_0000388 3300046454 Bacteria 34309
570 Ga0495592_0037813 3300046454 Bacteria 3632
571 Ga0495603_0001247 3300046455 Bacteria 14873
572 Ga0495603_0023101 3300046455 Bacteria 3765
573 Ga0495629_0001052 3300046459 Bacteria 22061
574 Ga0495629_0015597 3300046459 Bacteria 5455
575 Ga0495638_0060830 3300046460 Bacteria 2334
576 Ga0495638_0286006 3300046460 Bacteria 894
577 Ga0495641_0013443 3300046461 Bacteria 4499
578 Ga0495653_0060993 3300046463 Bacteria 2855
579 Ga0495580_0007868 3300046472 Bacteria 8528
580 Ga0495582_0000221 3300046473 Bacteria 31591
581 Ga0495639_0001053 3300046475 Bacteria 12441
582 Ga0495662_0001011 3300046476 Bacteria 13803
583 Ga0495662_0005160 3300046476 Bacteria 6548
584 Ga0495664_0000003 3300046477 Bacteria 551602
585 Ga0495664_0054632 3300046477 Bacteria 2374
586 Ga0495584_0123087 3300046491 Bacteria 1314
587 Ga0495594_0003526 3300046499 Bacteria 8057
588 Ga0495583_0021175 3300046506 Bacteria 3350
589 Ga0495606_0153353 3300046507 Bacteria 1350
590 Ga0495608_0000011 3300046511 Bacteria 248514
591 Ga0495608_0073244 3300046511 Bacteria 2234
592 Ga0495618_0000099 3300046514 Bacteria 63065
593 Ga0495618_0195224 3300046514 Bacteria 1282
594 Ga0495628_0000001 3300046516 Bacteria 917742
595 Ga0495628_0172216 3300046516 Bacteria 1641
596 Ga0495630_0002234 3300046517 Bacteria 13474
597 Ga0495630_0002380 3300046517 Bacteria 13060
598 Ga0495630_0170903 3300046517 Unclassified 1656
599 Ga0495642_0006017 3300046528 Bacteria 4660
600 Ga0495652_0000002 3300046529 Bacteria 946606
601 Ga0495665_0000755 3300046531 Bacteria 16775
602 Ga0495640_0000002 3300046533 Bacteria 646434
603 Ga0495640_0046151 3300046533 Bacteria 3020
604 Ga0495587_0000001 3300046536 Bacteria 724132
605 Ga0495609_0021386 3300046538 Bacteria 2984
606 Ga0495597_0072639 3300046542 Bacteria 1480
607 Ga0495622_0116581 3300046557 Unclassified 1221
608 Ga0495633_0146576 3300046558 Bacteria 1091
609 Ga0495633_0172563 3300046558 Bacteria 996
610 Ga0495667_0000004 3300046559 Bacteria 295297
611 Ga0495667_0300202 3300046559 Bacteria 1017
612 Ga0495656_0065580 3300046615 Bacteria 1597
613 Ga0495656_0203805 3300046615 Bacteria 983
614 Ga0495668_0024366 3300046616 Bacteria 3442
615 Ga0495634_0000478 3300046642 Bacteria 39481
616 Ga0495634_0003584 3300046642 Bacteria 12413
617 Ga0495611_0085407 3300046648 Bacteria 1455
618 Ga0495611_0086523 3300046648 Bacteria 1446
619 Ga0495625_0110202 3300046660 Bacteria 1882
620 Ga0495635_0000001 3300046663 Bacteria 704901
621 Ga0495635_0011640 3300046663 Bacteria 6165
622 Ga0495599_0000036 3300046678 Bacteria 102707
623 Ga0495599_0050575 3300046678 Bacteria 2604
624 Ga0495623_0000043 3300046679 Bacteria 77839
625 Ga0495646_0000019 3300046680 Bacteria 119527
626 Ga0495647_0001581 3300046681 Bacteria 7034
627 Ga0495658_0000937 3300046683 Bacteria 15538
628 Ga0495613_0000393 3300046689 Bacteria 37458
629 Ga0495613_0046476 3300046689 Bacteria 3210
630 Ga0495624_0000182 3300046690 Bacteria 46968
631 Ga0495649_0089862 3300046694 Bacteria 1638
632 Ga0495600_0000017 3300046809 Bacteria 107635
633 Ga0495581_0000093 3300047315 Bacteria 36772
634 Ga0495604_0000008 3300047317 Bacteria 341160
635 Ga0495604_0188461 3300047317 Bacteria 1439
636 Ga0495674_0000016 3300047319 Bacteria 216763
637 Ga0495674_0005687 3300047319 Bacteria 11939
638 Ga0495674_0192033 3300047319 Bacteria 1697
639 Ga0495672_0023130 3300047320 Bacteria 4029
640 Ga0495676_0024359 3300047321 Bacteria 5241
641 Ga0495680_0000974 3300047322 Bacteria 31812
642 Ga0495683_0141640 3300047323 Bacteria 1126
643 Ga0495683_0187588 3300047323 Bacteria 940
644 Ga0495675_0000163 3300047444 Bacteria 47525
645 Ga0495684_0000002 3300047471 Bacteria 341216
646 Ga0495684_0043730 3300047471 Bacteria 3430
647 Ga0495684_0146845 3300047471 Bacteria 1766
648 Ga0495593_0000827 3300047673 Bacteria 17976
649 Ga0495593_0021170 3300047673 Bacteria 3635
650 Ga0495602_0000066 3300048088 Bacteria 102731
651 Ga0495614_0020003 3300048089 Bacteria 2895
652 Ga0496101_0043512 3300048904 Bacteria 3210
653 Ga0496102_0065855 3300048905 Bacteria 3321
654 Ga0496102_0768035 3300048905 Bacteria 886
655 Ga0496103_0189376 3300048906 Bacteria 1323
656 Ga0496110_0040658 3300048913 Unclassified 4053
657 Ga0496113_0269458 3300048916 Unclassified 1361
658 Ga0496117_0054980 3300048920 Bacteria 2785
659 Ga0496118_0050377 3300048921 Bacteria 3197
660 Ga0496121_0007756 3300048924 Bacteria 12859
661 Ga0496124_0021930 3300048927 Bacteria 5874
662 Ga0496126_0011003 3300048929 Bacteria 9412
663 Ga0496126_0032904 3300048929 Unclassified 4880
664 Ga0496126_0128172 3300048929 Unclassified 2195
665 Ga0501038_0291989 3300049574 Bacteria 1281
666 Ga0501067_0196086 3300049583 Bacteria 1125
667 nmdc:mga03n38_34498_c1 3300050490 Bacteria 2162
668 nmdc:mga00v17_55739_c1 3300050491 Bacteria 2414
669 nmdc:mga0yw44_12855_c1 3300050492 Bacteria 4381
670 nmdc:mga0yw44_164052_c1 3300050492 Bacteria 1456
671 nmdc:mga09592_256645_c1 3300050508 Bacteria 1515
672 nmdc:mga06r32_25592_c1 3300050510 Bacteria 5491
673 nmdc:mga06r32_81997_c1 3300050510 Bacteria 3141
674 nmdc:mga0n895_17846_c2 3300050512 Unclassified 4038
675 nmdc:mga0n895_372970_c1 3300050512 Bacteria 1444
676 nmdc:mga0n895_906028_c1 3300050512 Unclassified 867
677 nmdc:mga08x19_129953_c1 3300050514 Bacteria 1693
678 Ga0495601_0000001 3300053077 Bacteria 549454
679 Ga0495612_0000003 3300053078 Bacteria 303629
680 Ga0495595_0000049 3300053084 Bacteria 60566
681 Ga0495619_0000004 3300053085 Bacteria 500068
682 Ga0495619_0270630 3300053085 Bacteria 1177
683 Ga0500554_019723 3300053102 Bacteria 1842
684 Ga0500569_062644 3300053109 Bacteria 1152
685 Ga0500589_143014 3300053147 Bacteria 983
686 Ga0500603_000736 3300053150 Bacteria 7974
687 Ga0500637_0005083 3300053178 Bacteria 6335
688 Ga0500637_0028551 3300053178 Bacteria 3086
689 2723847868 2721755755 Bacteria 8322773
690 Ga0495677_0122871
691 2214745206
692 ARcpr5oldR_c000054
693 ARSoilYngRDRAFT_c00031
694 ARcpr5yngRDRAFT_c000009
695 ARSoilOldRDRAFT_c000055
696 ARCol0yngRDRAFT_1000044
697 JGI24738J21930_10000339
698 rootH1_10211533
699 Ga0065716_1001996
700 Ga0065715_10000671
701 Ga0070676_10000016
702 Ga0070683_100000075
703 Ga0070683_100023207
704 Ga0070690_100001770
705 Ga0070690_100041169
706 Ga0070670_100161558
707 Ga0070670_100247191
708 Ga0070677_10000005
709 Ga0068869_100000578
710 Ga0068869_100001023
711 Ga0068869_100015281
712 Ga0070680_100000526
713 Ga0070680_100013188
714 Ga0070680_100055014
715 Ga0070682_100000144
716 Ga0070682_100013350
717 Ga0068868_100011353
718 Ga0068868_100032992
719 Ga0070660_100000153
720 Ga0070660_100089482
721 Ga0070660_100131960
722 Ga0070689_100003924
723 Ga0070691_10000030
724 Ga0070687_100000016
725 Ga0070687_100000523
726 Ga0070661_100000249
727 Ga0070668_100004112
728 Ga0070668_100005571
729 Ga0070668_100010862
730 Ga0070668_100011400
731 Ga0070668_100043035
732 Ga0070668_100060749
733 Ga0070669_100000145
734 Ga0070669_100131762
735 Ga0070675_100000081
736 Ga0070675_100131541
737 Ga0070675_100163423
738 Ga0070675_100393219
739 Ga0070671_100000267
740 Ga0070671_100044312
741 Ga0070671_100503057
742 Ga0070674_100000906
743 Ga0070674_100016271
744 Ga0070674_100045953
745 Ga0070673_100000125
746 Ga0070688_100000075
747 Ga0070659_100000144
748 Ga0070659_100081479
749 Ga0070667_100001956
750 Ga0070667_100271498
751 Ga0070667_100273039
752 Ga0070703_10001239
753 Ga0070709_10010606
754 Ga0070709_10083276
755 Ga0070709_10107847
756 Ga0070714_100037672
757 Ga0070714_100089873
758 Ga0070714_100418990
759 Ga0070713_100011623
760 Ga0070713_100039196
761 Ga0070713_100056090
762 Ga0070713_100153563
763 Ga0070710_10005280
764 Ga0070710_10008433
765 Ga0070710_10012516
766 Ga0070701_10000058
767 Ga0070701_10001508
768 Ga0070701_10078045
769 Ga0070711_100005040
770 Ga0070711_100028808
771 Ga0070711_100141660
772 Ga0070711_100322990
773 Ga0070711_100456176
774 Ga0070705_100000926
775 Ga0070705_100074583
776 Ga0070705_100102367
777 Ga0070700_100000100
778 Ga0070700_100010505
779 Ga0070700_100033235
780 Ga0070694_100000041
781 Ga0070708_100697703
782 Ga0070663_100000071
783 Ga0070663_100031408
784 Ga0070663_100046789
785 Ga0070663_100063563
786 Ga0070663_100252731
787 Ga0070663_100253888
788 Ga0070663_100497532
789 Ga0070678_100000239
790 Ga0070662_100048415
791 Ga0070662_100076384
792 Ga0070681_10012408
793 Ga0070681_10106904
794 Ga0068867_100005147
795 Ga0068867_100129592
796 Ga0068867_100144219
797 Ga0070685_10000994
798 Ga0070685_10042305
799 Ga0070685_10181485
800 Ga0070698_100347650
801 Ga0070679_100000464
802 Ga0070679_100099308
803 Ga0070679_100188094
804 Ga0070684_100000099
805 Ga0070684_100010477
806 Ga0070684_100024110
807 Ga0070684_100069938
808 Ga0068853_100001732
809 Ga0068853_100054176
810 Ga0068853_100077942
811 Ga0068853_100088688
812 Ga0070672_100000035
813 Ga0070672_100137787
814 Ga0070686_100000086
815 Ga0070686_100034726
816 Ga0070695_100000036
817 Ga0070695_100043988
818 Ga0070695_100046618
819 Ga0070696_100028094
820 Ga0070693_100000310
821 Ga0070693_100008664
822 Ga0070693_100034107
823 Ga0070665_100011985
824 Ga0070665_100066725
825 Ga0070665_100091758
826 Ga0070665_100111336
827 Ga0070665_100120501
828 Ga0070665_100168550
829 Ga0070704_100042434
830 Ga0068855_100015219
831 Ga0068855_100057218
832 Ga0068855_100088285
833 Ga0068855_100088533
834 Ga0068855_100449783
835 Ga0070664_100004564
836 Ga0070664_100235441
837 Ga0070664_100372659
838 Ga0068857_100000122
839 Ga0068857_100014334
840 Ga0068854_100000410
841 Ga0068856_100001112
842 Ga0068856_100076602
843 Ga0070702_100001141
844 Ga0070702_100008187
845 Ga0068852_100013184
846 Ga0068852_100044248
847 Ga0068852_100446477
848 Ga0068859_100000365
849 Ga0068859_100006951
850 Ga0068859_100084981
851 Ga0068859_100130246
852 Ga0068859_100316508
853 Ga0068859_100780744
854 Ga0068864_100000271
855 Ga0068864_100119714
856 Ga0068866_10000213
857 Ga0068866_10017383
858 Ga0068866_10327642
859 Ga0068861_100000340
860 Ga0068861_100002454
861 Ga0068861_100031257
862 Ga0068861_100038630
863 Ga0068870_10000079
864 Ga0068870_10012310
865 Ga0068870_10050587
866 Ga0068863_100000372
867 Ga0068863_100095915
868 Ga0068863_100130839
869 Ga0068863_100155066
870 Ga0068858_100000809
871 Ga0068858_100011014
872 Ga0068858_100084191
873 Ga0068858_100131202
874 Ga0068858_100162708
875 Ga0068860_100000709
876 Ga0068860_100232282
877 Ga0068860_100313521
878 Ga0068862_100000512
879 Ga0068862_100003054
880 Ga0068862_100004009
881 Ga0068862_100105761
882 Ga0081455_10000007
883 Ga0081455_10004091
884 Ga0081455_10004612
885 Ga0081455_10006391
886 Ga0081455_10006527
887 Ga0081455_10026677
888 Ga0081455_10104824
889 Ga0081455_10165469
890 Ga0081540_1000849
891 Ga0081540_1003812
892 Ga0081540_1040665
893 Ga0070717_10000938
894 Ga0070717_10022929
895 Ga0070717_10235739
896 Ga0070717_10331607
897 Ga0075365_10044741
898 Ga0075365_10072096
899 Ga0075368_10011952
900 Ga0075368_10016585
901 Ga0075368_10130870
902 Ga0075363_100007053
903 Ga0070715_10005821
904 Ga0070715_10113598
905 Ga0070715_10184008
906 Ga0070716_100003941
907 Ga0070716_100060827
908 Ga0070712_100002813
909 Ga0070712_100021865
910 Ga0070712_100082554
911 Ga0070712_100114763
912 Ga0070712_100168607
913 Ga0075362_10037602
914 Ga0075367_10010055
915 Ga0075367_10154647
916 Ga0075427_10008597
917 Ga0075366_10041571
918 Ga0075366_10093400
919 Ga0097621_100000047
920 Ga0097621_100352884
921 Ga0097621_100558607
922 Ga0075370_10003095
923 Ga0068871_100000721
924 Ga0068871_100045593
925 Ga0068871_100302613
926 Ga0075428_100005796
927 Ga0075428_100599340
928 Ga0075430_100000770
929 Ga0075431_100000399
930 Ga0075431_100044475
931 Ga0075431_100232597
932 Ga0075433_10000374
933 Ga0075433_10002587
934 Ga0075434_100001558
935 Ga0075434_100002975
936 Ga0075434_100035267
937 Ga0075434_100110352
938 Ga0075434_100327957
939 Ga0075434_100381566
940 Ga0075429_100002444
941 Ga0068865_100000415
942 Ga0068865_100303440
943 Ga0097620_100000365
944 Ga0097620_100006952
945 Ga0097620_100084976
946 Ga0097620_100130244
947 Ga0097620_100316504
948 Ga0097620_100780720
949 Ga0075435_100004974
950 Ga0075435_100025482
951 Ga0075435_100084751
952 Ga0105251_10134401
953 Ga0105240_10163423
954 Ga0105240_10348400
955 Ga0111539_10001287
956 Ga0105245_10170985
957 Ga0105247_10069217
958 Ga0114129_10550459
959 Ga0105243_10003796
960 Ga0105241_10020291
961 Ga0105241_10518014
962 Ga0105242_10139274
963 Ga0105248_10010344
964 Ga0105237_10006329
965 Ga0105237_10013540
966 Ga0105237_10053330
967 Ga0105238_10059268
968 Ga0105238_10136392
969 Ga0105249_10007192
970 Ga0105249_10013007
971 Ga0105249_10106968
972 Ga0099796_10010645
973 Ga0099796_10062744
974 Ga0105239_10016817
975 Ga0105239_10169970
976 Ga0105239_10546750
977 Ga0105246_10157166
978 Ga0157369_10156741
979 Ga0157369_10788400
980 Ga0157374_10022777
981 Ga0157374_10023113
982 Ga0157374_10233531
983 Ga0157378_10008624
984 Ga0157378_10379753
985 Ga0157378_10612801
986 Ga0163162_10026487
987 Ga0157372_10234789
988 Ga0163163_10085670
989 Ga0163163_10624150
990 Ga0157380_10021456
991 Ga0157380_10070979
992 Ga0157380_10137835
993 Ga0157380_10260071
994 Ga0157379_10085363
995 Ga0157376_10068356
996 Ga0157376_10420450
997 Ga0163161_10000363
998 Ga0163161_10089947
999 Ga0163161_10354077
1000 Ga0213874_10068114
1001 Ga0207666_1000015
1002 Ga0207666_1002258
1003 Ga0207673_1000067
1004 Ga0209758_1028463
1005 Ga0207697_10000088
1006 Ga0207697_10020214
1007 Ga0207653_10000413
1008 Ga0207682_10000004
1009 Ga0207692_10005243
1010 Ga0207692_10025276
1011 Ga0207692_10181293
1012 Ga0207642_10000291
1013 Ga0207642_10011859
1014 Ga0207710_10001511
1015 Ga0207688_10000042
1016 Ga0207688_10065419
1017 Ga0207688_10306880
1018 Ga0207680_10000311
1019 Ga0207680_10096369
1020 Ga0207647_10000417
1021 Ga0207647_10009783
1022 Ga0207685_10043089
1023 Ga0207699_10065167
1024 Ga0207645_10000061
1025 Ga0207643_10000012
1026 Ga0207643_10023231
1027 Ga0207705_10174962
1028 Ga0207684_10004800
1029 Ga0207654_10001794
1030 Ga0207654_10008001
1031 Ga0207707_10006541
1032 Ga0207707_10006621
1033 Ga0207707_10045574
1034 Ga0207695_10151269
1035 Ga0207671_10027210
1036 Ga0207671_10085676
1037 Ga0207693_10006337
1038 Ga0207693_10013325
1039 Ga0207693_10013933
1040 Ga0207693_10023130
1041 Ga0207693_10379367
1042 Ga0207663_10017249
1043 Ga0207663_10019869
1044 Ga0207660_10000008
1045 Ga0207660_10020887
1046 Ga0207662_10000097
1047 Ga0207662_10001598
1048 Ga0207657_10000503
1049 Ga0207657_10002293
1050 Ga0207657_10026996
1051 Ga0207649_10000099
1052 Ga0207652_10001041
1053 Ga0207652_10044158
1054 Ga0207646_10076790
1055 Ga0207681_10000141
1056 Ga0207694_10012899
1057 Ga0207694_10342688
1058 Ga0207650_10007055
1059 Ga0207659_10000023
1060 Ga0207659_10339868
1061 Ga0207687_10000319
1062 Ga0207687_10002932
1063 Ga0207687_10012739
1064 Ga0207687_10191408
1065 Ga0207700_10000751
1066 Ga0207700_10076919
1067 Ga0207700_10084440
1068 Ga0207700_10114250
1069 Ga0207664_10462048
1070 Ga0207644_10015130
1071 Ga0207644_10078901
1072 Ga0207690_10000105
1073 Ga0207706_10000438
1074 Ga0207706_10005437
1075 Ga0207706_10206838
1076 Ga0207686_10000140
1077 Ga0207686_10090867
1078 Ga0207686_10336556
1079 Ga0207709_10000264
1080 Ga0207709_10005146
1081 Ga0207709_10092207
1082 Ga0207670_10000108
1083 Ga0207670_10117134
1084 Ga0207669_10000110
1085 Ga0207669_10003138
1086 Ga0207669_10044617
1087 Ga0207704_10000171
1088 Ga0207665_10001820
1089 Ga0207711_10002682
1090 Ga0207711_10081110
1091 Ga0207711_10459918
1092 Ga0207689_10000008
1093 Ga0207689_10003600
1094 Ga0207689_10032016
1095 Ga0207689_10276869
1096 Ga0207689_10284532
1097 Ga0207661_10000053
1098 Ga0207661_10180498
1099 Ga0207679_10000053
1100 Ga0207679_10298236
1101 Ga0207679_10432006
1102 Ga0207667_10008564
1103 Ga0207651_10000052
1104 Ga0207651_10073342
1105 Ga0207712_10000156
1106 Ga0207712_10029018
1107 Ga0207712_10065250
1108 Ga0207668_10000160
1109 Ga0207668_10001768
1110 Ga0207668_10004317
1111 Ga0207668_10014488
1112 Ga0207668_10015858
1113 Ga0207668_10032006
1114 Ga0207668_10196760
1115 Ga0207668_10214628
1116 Ga0207640_10000325
1117 Ga0207658_10036051
1118 Ga0207677_10009376
1119 Ga0207677_10080611
1120 Ga0207677_10082504
1121 Ga0207703_10001510
1122 Ga0207703_10022564
1123 Ga0207703_10173335
1124 Ga0207639_10001511
1125 Ga0207639_10108021
1126 Ga0207678_10000185
1127 Ga0207678_10014425
1128 Ga0207678_10015331
1129 Ga0207678_10019755
1130 Ga0207678_10021191
1131 Ga0207678_10031346
1132 Ga0207678_10034592
1133 Ga0207708_10000263
1134 Ga0207708_10001344
1135 Ga0207708_10036156
1136 Ga0207708_10417458
1137 Ga0207708_10484129
1138 Ga0207702_10000297
1139 Ga0207702_10034823
1140 Ga0207641_10000775
1141 Ga0207641_10066130
1142 Ga0207641_10244309
1143 Ga0207648_10000469
1144 Ga0207648_10038076
1145 Ga0207648_10059475
1146 Ga0207648_10092869
1147 Ga0207648_10167388
1148 Ga0207676_10001235
1149 Ga0207676_10007604
1150 Ga0207674_10001208
1151 Ga0207674_10028740
1152 Ga0207675_100000342
1153 Ga0207675_100018349
1154 Ga0207675_100019267
1155 Ga0207675_100172606
1156 Ga0207683_10000006
1157 Ga0207683_10007794
1158 Ga0207683_10095459
1159 Ga0207683_10269977
1160 Ga0207683_10446382
1161 Ga0207698_10000236
1162 Ga0209973_1002926
1163 Ga0209971_1013750
1164 Ga0209971_1028891
1165 Ga0209998_10001431
1166 Ga0209998_10004020
1167 Ga0209813_10005828
1168 Ga0209974_10002024
1169 Ga0209974_10039609
1170 Ga0207428_10000112
1171 Ga0207428_10000417
1172 Ga0207428_10000480
1173 Ga0207428_10149355
1174 Ga0268266_10015275
1175 Ga0268266_10015395
1176 Ga0268266_10017509
1177 Ga0268266_10036687
1178 Ga0268266_10266097
1179 Ga0268265_10000257
1180 Ga0268265_10043763
1181 Ga0268265_10094530
1182 Ga0268265_10149745
1183 Ga0268265_10223722
1184 Ga0268264_10000579
1185 Ga0268264_10145178
1186 Ga0268264_10263683
1187 Ga0265338_10019899
1188 Ga0265325_10002196
1189 Ga0265329_10045582
1190 Ga0265340_10004522
1191 Ga0265340_10013567
1192 Ga0307509_10282892
1193 Ga0265313_10031295
1194 Ga0307508_10296553
1195 Ga0307413_10090700
1196 Ga0307414_10297361
1197 Ga0307411_10022180
1198 Ga0307510_10202210
1199 Ga0373930_0000160
1200 Ga0373948_0001631
1201 Ga0373950_0000344
1202 Ga0373959_0000573
1203 Ga0373938_0000090
1204 Ga0373926_0005345
1205 Ga0373928_0000746
1206 Ga0373940_0000074
1207 Ga0373949_0001646
1208 Ga0373951_0001485
1209 Ga0373952_0001442
1210 Ga0373923_0000748
1211 Ga0373932_0000751
1212 Ga0373936_0010785
1213 Ga0373936_0028423
1214 Ga0373939_0000873
1215 Ga0373941_0000030
1216 Ga0373945_0019356
1217 Ga0373945_0028265
1218 Ga0373953_0015516
1219 Ga0373953_0098315
1220 Ga0373954_0075905
1221 Ga0373956_0028834
1222 Ga0373943_0005228
1223 Ga0373943_0114943
1224 Ga0373946_0004802
1225 Ga0373946_0006843
1226 Ga0373946_0055308
1227 Ga0373955_0000090
1228 Ga0373955_0015306
1229 Ga0373955_0081548
1230 Ga0373942_0000232
1231 Ga0373961_0001000
1232 Ga0373962_0020542
1233 Ga0373935_0000418
1234 Ga0373935_0004551
1235 Ga0373935_0007460
1236 Ga0373935_0112074
1237 Ga0373935_0181030
1238 Ga0373927_0004434
1239 Ga0373927_0007901
1240 Ga0373927_0066537
1241 Ga0373927_0089921
1242 Ga0373933_0135960
1243 Ga0373947_0002133
1244 Ga0373947_0016707
1245 Ga0373947_0023965
1246 Ga0373937_0000733
1247 Ga0373937_0005736
1248 Ga0373937_0025710
1249 Ga0373925_0000064
1250 Ga0373925_0021935
1251 Ga0373925_0034015
1252 Ga0242420_005665
1253 Ga0436363_0192704
1254 Ga0451843_0438584
1255 Ga0451577_0223730
1256 Ga0453684_0078254
1257 Ga0451576_0267106
1258 Ga0495592_0000388
1259 Ga0495592_0037813
1260 Ga0495603_0001247
1261 Ga0495603_0023101
1262 Ga0495629_0001052
1263 Ga0495629_0015597
1264 Ga0495638_0060830
1265 Ga0495638_0286006
1266 Ga0495641_0013443
1267 Ga0495653_0060993
1268 Ga0495580_0007868
1269 Ga0495582_0000221
1270 Ga0495639_0001053
1271 Ga0495662_0001011
1272 Ga0495662_0005160
1273 Ga0495664_0000003
1274 Ga0495664_0054632
1275 Ga0495584_0123087
1276 Ga0495594_0003526
1277 Ga0495583_0021175
1278 Ga0495606_0153353
1279 Ga0495608_0000011
1280 Ga0495608_0073244
1281 Ga0495618_0000099
1282 Ga0495618_0195224
1283 Ga0495628_0000001
1284 Ga0495628_0172216
1285 Ga0495630_0002234
1286 Ga0495630_0002380
1287 Ga0495630_0170903
1288 Ga0495642_0006017
1289 Ga0495652_0000002
1290 Ga0495665_0000755
1291 Ga0495640_0000002
1292 Ga0495640_0046151
1293 Ga0495587_0000001
1294 Ga0495609_0021386
1295 Ga0495597_0072639
1296 Ga0495622_0116581
1297 Ga0495633_0146576
1298 Ga0495633_0172563
1299 Ga0495667_0000004
1300 Ga0495667_0300202
1301 Ga0495656_0065580
1302 Ga0495656_0203805
1303 Ga0495668_0024366
1304 Ga0495634_0000478
1305 Ga0495634_0003584
1306 Ga0495611_0085407
1307 Ga0495611_0086523
1308 Ga0495625_0110202
1309 Ga0495635_0000001
1310 Ga0495635_0011640
1311 Ga0495599_0000036
1312 Ga0495599_0050575
1313 Ga0495623_0000043
1314 Ga0495646_0000019
1315 Ga0495647_0001581
1316 Ga0495658_0000937
1317 Ga0495613_0000393
1318 Ga0495613_0046476
1319 Ga0495624_0000182
1320 Ga0495649_0089862
1321 Ga0495600_0000017
1322 Ga0495581_0000093
1323 Ga0495604_0000008
1324 Ga0495604_0188461
1325 Ga0495674_0000016
1326 Ga0495674_0005687
1327 Ga0495674_0192033
1328 Ga0495672_0023130
1329 Ga0495676_0024359
1330 Ga0495680_0000974
1331 Ga0495683_0141640
1332 Ga0495683_0187588
1333 Ga0495675_0000163
1334 Ga0495684_0000002
1335 Ga0495684_0043730
1336 Ga0495684_0146845
1337 Ga0495593_0000827
1338 Ga0495593_0021170
1339 Ga0495602_0000066
1340 Ga0495614_0020003
1341 Ga0496101_0043512
1342 Ga0496102_0065855
1343 Ga0496102_0768035
1344 Ga0496103_0189376
1345 Ga0496110_0040658
1346 Ga0496113_0269458
1347 Ga0496117_0054980
1348 Ga0496118_0050377
1349 Ga0496121_0007756
1350 Ga0496124_0021930
1351 Ga0496126_0011003
1352 Ga0496126_0032904
1353 Ga0496126_0128172
1354 Ga0501038_0291989
1355 Ga0501067_0196086
1356 nmdc:mga03n38_34498_c1
1357 nmdc:mga00v17_55739_c1
1358 nmdc:mga0yw44_12855_c1
1359 nmdc:mga0yw44_164052_c1
1360 nmdc:mga09592_256645_c1
1361 nmdc:mga06r32_25592_c1
1362 nmdc:mga06r32_81997_c1
1363 nmdc:mga0n895_17846_c2
1364 nmdc:mga0n895_372970_c1
1365 nmdc:mga0n895_906028_c1
1366 nmdc:mga08x19_129953_c1
1367 Ga0495601_0000001
1368 Ga0495612_0000003
1369 Ga0495595_0000049
1370 Ga0495619_0000004
1371 Ga0495619_0270630
1372 Ga0500554_019723
1373 Ga0500569_062644
1374 Ga0500589_143014
1375 Ga0500603_000736
1376 Ga0500637_0005083
1377 Ga0500637_0028551
1378 2723847868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

75

268

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dqb-assembly1.cif.gz_A crystal structure of 3-dehydroquinate dehydratase i from klebsiella oxytoca (i23 form) 0.8572 56 260
8dqc-assembly1.cif.gz_A crystal structure of 3-dehydroquinate dehydratase i from klebsiella oxytoca (i222 form) 0.8549 55 260
2g6v-assembly1.cif.gz_B the crystal structure of ribd from escherichia coli 0.8535 56 260
2obc-assembly1.cif.gz_B the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain 0.8532 56 260
5xv0-assembly3.cif.gz_E crystal structure of rib7 mutant d33n from methanosarcina mazei 0.8441 55 259
ID Description Score Start End Superfamily
2b3zA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.859 55 259 3.40.430.10
af_Q2FXF9_123_334_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8566 55 259 3.40.430.10
2hxvA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8512 56 259 3.40.430.10
af_Q9STY4_178_394_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8488 55 258 3.40.430.10
2hxvA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8393 56 259 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6M9PU83-F1-model_v4 Riboflavin deaminase 0.9306 55 268 GO:0008703
GO:0009231
AF-A0A6M9PU83-F1-model_v4 Riboflavin deaminase 0.9264 55 268 GO:0008703
GO:0009231
AF-A0A6N7GPT5-F1-model_v4 Riboflavin deaminase 0.9205 30 274 GO:0008703
GO:0009231
AF-A0A127EW13-F1-model_v4 Bifunctional deaminase-reductase domain-containing protein 0.9188 22 274 GO:0008703
GO:0009231
AF-A0A257HFN2-F1-model_v4 Deaminase 0.9188 55 260 GO:0008703
GO:0009231

Map