F475289

General Info

Members Datasets Scaffolds Average Seq Length
687 394 1374 137

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_37301_c1|nmdc:mga0k408_37301_c1_154_624
Length 156
Sequence MSRAKPVDRIGTGIFRTTQMSQTYTGGCACGAIRYEISGEPIFQNHCQCRDCQRKSGTGHGSYLTFARDGVKHSGQATPWAIVADSGNVKTRAFCPTCGSPVYMTFSAMPDIFTVHAASLDDPGRYRPQAVTYTVRGPEWDCLDPALPKFDKMPAT

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
182 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
192 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
205 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
206 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
207 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
297 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
300 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
301 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
306 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
309 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
310 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
321 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
326 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
327 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
328 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
329 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
330 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
331 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
332 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
333 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
334 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
335 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
336 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
337 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
338 2643221573 Lysobacter sp. Root604 Isolate Unclassified
339 2643221720 Lysobacter sp. Root916 Isolate Unclassified
340 2643221728 Lysobacter sp. Root983 Isolate Unclassified
341 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
342 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
343 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
344 2818991446 Variovorax sp. 1180 Isolate Unclassified
345 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
346 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
347 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
348 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
349 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
350 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
351 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
352 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
353 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
354 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
355 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
356 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
357 2885198086 Variovorax sp. 679 Isolate Unclassified
358 2885211737 Variovorax sp. 553 Isolate Unclassified
359 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
360 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
361 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
362 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
363 2899924645 Variovorax sp. 369 Isolate Unclassified
364 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
365 2928037797 Variovorax sp. 1126 Isolate Unclassified
366 2928044640 Variovorax sp. 1128 Isolate Unclassified
367 2928051484 Variovorax sp. 1133 Isolate Unclassified
368 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
369 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
370 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
371 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
372 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
373 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
374 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
375 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
376 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
377 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
378 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
379 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
380 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
381 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
382 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
383 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
384 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
385 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
386 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
387 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
388 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
389 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
390 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
391 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
392 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
393 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
394 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.54
Metatranscriptomes 0
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.4
Nodule 5.24
Rhizoplane 4.37
Rhizosphere 49.64
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_37301_c1 3300050493 Bacteria 2790
2 MBSR1b_contig_5120920 2162886012 Bacteria 1100
3 JGI25152J39213_1000902 3300002773 Bacteria 14533
4 JGI25150J39212_1000529 3300002774 Bacteria 15578
5 JGI25159J45721_1000714 3300002987 Bacteria 14510
6 JGI25159J45721_1015530 3300002987 Bacteria 1663
7 JGI25151J46595_10001672 3300003187 Bacteria 14533
8 JGI25153J46596_10001378 3300003215 Bacteria 14533
9 rootH1_10084038 3300003316 Bacteria 2213
10 JGI25160J50197_1000504 3300003354 Bacteria 23228
11 JGI25160J50197_1001019 3300003354 Bacteria 14510
12 JGI25160J50197_1016594 3300003354 Bacteria 2367
13 JGI25161J50226_1001946 3300003374 Bacteria 5689
14 JGI25161J50226_1007453 3300003374 Bacteria 1830
15 Ga0055539_1023106 3300003752 Bacteria 732
16 Ga0055535_1000544 3300003761 Bacteria 32432
17 Ga0055542_1000004 3300003762 Bacteria 553532
18 Ga0055526_1001885 3300003771 Bacteria 14533
19 Ga0055526_1020268 3300003771 Bacteria 2375
20 Ga0055537_1000532 3300003773 Bacteria 22142
21 Ga0055537_1021503 3300003773 Bacteria 957
22 Ga0055524_1001312 3300003775 Bacteria 14533
23 Ga0055524_1003577 3300003775 Bacteria 7490
24 Ga0055524_1008003 3300003775 Bacteria 4434
25 Ga0055536_1001009 3300003781 Bacteria 17895
26 Ga0055534_1000806 3300003784 Bacteria 14533
27 Ga0055534_1006267 3300003784 Bacteria 3023
28 Ga0055528_1000780 3300003790 Bacteria 22142
29 Ga0055528_1016555 3300003790 Bacteria 2599
30 Ga0055530_10000730 3300003791 Bacteria 27505
31 Ga0055530_10001183 3300003791 Bacteria 20158
32 Ga0055540_1001469 3300003792 Bacteria 14046
33 Ga0055540_1005496 3300003792 Bacteria 5306
34 Ga0055531_10002619 3300003794 Bacteria 11919
35 Ga0055531_10008256 3300003794 Bacteria 5535
36 Ga0055543_1000702 3300004625 Bacteria 17034
37 Ga0055543_1001310 3300004625 Bacteria 10206
38 Ga0065165_1000278 3300005262 Bacteria 87353
39 Ga0065165_1002519 3300005262 Bacteria 15255
40 Ga0065165_1016865 3300005262 Bacteria 2714
41 Ga0065165_1024980 3300005262 Bacteria 1996
42 Ga0065714_10404806 3300005288 Bacteria 587
43 Ga0065715_10136549 3300005293 Bacteria 1920
44 Ga0070658_10005436 3300005327 Bacteria 10336
45 Ga0070676_10067141 3300005328 Bacteria 2144
46 Ga0070670_100061462 3300005331 Bacteria 3224
47 Ga0070670_100065897 3300005331 Bacteria 3108
48 Ga0070670_100136746 3300005331 Bacteria 2118
49 Ga0070677_10011531 3300005333 Bacteria 3051
50 Ga0068869_100367635 3300005334 Bacteria 1176
51 Ga0068869_101690182 3300005334 Bacteria 565
52 Ga0070666_10000008 3300005335 Bacteria 293415
53 Ga0070661_100013390 3300005344 Bacteria 5757
54 Ga0070668_100026997 3300005347 Bacteria 4359
55 Ga0070668_100787774 3300005347 Bacteria 844
56 Ga0070668_101231803 3300005347 Bacteria 679
57 Ga0070669_100022638 3300005353 Bacteria 4494
58 Ga0070669_100118587 3300005353 Bacteria 2016
59 Ga0070675_100000730 3300005354 Bacteria 22896
60 Ga0070671_100002821 3300005355 Bacteria 13508
61 Ga0070671_100034351 3300005355 Bacteria 4197
62 Ga0070671_100234860 3300005355 Bacteria 1556
63 Ga0070671_100781906 3300005355 Bacteria 830
64 Ga0070674_101268572 3300005356 Bacteria 656
65 Ga0070673_100016466 3300005364 Bacteria 5229
66 Ga0070673_100087038 3300005364 Bacteria 2546
67 Ga0070673_100429956 3300005364 Bacteria 1185
68 Ga0070667_100023464 3300005367 Bacteria 5118
69 Ga0070667_100035512 3300005367 Bacteria 4177
70 Ga0070667_100230615 3300005367 Bacteria 1651
71 Ga0070667_100412982 3300005367 Bacteria 1230
72 Ga0070667_100457391 3300005367 Bacteria 1167
73 Ga0070667_100701117 3300005367 Bacteria 937
74 Ga0070667_101396241 3300005367 Bacteria 657
75 Ga0070667_101416414 3300005367 Bacteria 652
76 Ga0070708_100173250 3300005445 Bacteria 2015
77 Ga0070708_100289057 3300005445 Bacteria 1543
78 Ga0070663_100003812 3300005455 Bacteria 8775
79 Ga0070678_100011111 3300005456 Bacteria 5538
80 Ga0070662_100224876 3300005457 Bacteria 1499
81 Ga0070662_100403870 3300005457 Bacteria 1128
82 Ga0068867_100001685 3300005459 Bacteria 15414
83 Ga0068867_100020669 3300005459 Bacteria 4691
84 Ga0068867_100243945 3300005459 Bacteria 1458
85 Ga0070706_100000297 3300005467 Bacteria 60441
86 Ga0070707_100016306 3300005468 Bacteria 6974
87 Ga0070698_100156206 3300005471 Bacteria 2227
88 Ga0070697_101469464 3300005536 Bacteria 609
89 Ga0068853_100001340 3300005539 Bacteria 17741
90 Ga0068853_100059971 3300005539 Bacteria 3287
91 Ga0068853_100398065 3300005539 Bacteria 1288
92 Ga0070672_100000424 3300005543 Bacteria 24646
93 Ga0070665_100009026 3300005548 Bacteria 10100
94 Ga0070665_100031156 3300005548 Bacteria 5368
95 Ga0070665_100363659 3300005548 Bacteria 1453
96 Ga0070665_100687013 3300005548 Bacteria 1036
97 Ga0070665_100841690 3300005548 Bacteria 930
98 Ga0070665_100932919 3300005548 Bacteria 880
99 Ga0068855_100123638 3300005563 Bacteria 2960
100 Ga0068855_100150995 3300005563 Bacteria 2642
101 Ga0070664_100096689 3300005564 Bacteria 2563
102 Ga0070664_100457789 3300005564 Bacteria 1172
103 Ga0070664_101272953 3300005564 Bacteria 694
104 Ga0068857_100018893 3300005577 Bacteria 6048
105 Ga0068857_100285909 3300005577 Bacteria 1518
106 Ga0068857_100763917 3300005577 Bacteria 921
107 Ga0068854_100073055 3300005578 Bacteria 2513
108 Ga0068854_100649103 3300005578 Bacteria 906
109 Ga0068856_100482528 3300005614 Bacteria 1260
110 Ga0068856_101101422 3300005614 Bacteria 811
111 Ga0068852_100045272 3300005616 Bacteria 3742
112 Ga0068852_100172206 3300005616 Bacteria 2030
113 Ga0068859_100538291 3300005617 Bacteria 1262
114 Ga0068864_100022500 3300005618 Bacteria 5285
115 Ga0068864_100240584 3300005618 Bacteria 1677
116 Ga0068866_10043543 3300005718 Bacteria 2241
117 Ga0068861_100009698 3300005719 Bacteria 6657
118 Ga0068851_10014519 3300005834 Bacteria 3741
119 Ga0068851_10111571 3300005834 Bacteria 1460
120 Ga0068863_100276597 3300005841 Bacteria 1626
121 Ga0068863_101031522 3300005841 Bacteria 826
122 Ga0068863_102127948 3300005841 Bacteria 571
123 Ga0068858_100252152 3300005842 Bacteria 1676
124 Ga0068860_100134545 3300005843 Bacteria 2374
125 Ga0068860_100262900 3300005843 Bacteria 1682
126 Ga0068860_100304562 3300005843 Bacteria 1562
127 Ga0068860_101225147 3300005843 Bacteria 771
128 Ga0068862_100114031 3300005844 Bacteria 2375
129 Ga0068862_100177327 3300005844 Bacteria 1911
130 Ga0081455_10779102 3300005937 Bacteria 602
131 Ga0075365_10039463 3300006038 Bacteria 3074
132 Ga0075365_10052571 3300006038 Bacteria 2695
133 Ga0075365_10202781 3300006038 Bacteria 1390
134 Ga0075365_10239282 3300006038 Bacteria 1275
135 Ga0075368_10007174 3300006042 Bacteria 3927
136 Ga0075368_10119702 3300006042 Bacteria 1090
137 Ga0075363_100001650 3300006048 Bacteria 8628
138 Ga0075363_100373831 3300006048 Bacteria 835
139 Ga0075364_10160045 3300006051 Bacteria 1520
140 Ga0075364_10218217 3300006051 Bacteria 1294
141 Ga0075364_10243112 3300006051 Bacteria 1223
142 Ga0075364_10869892 3300006051 Bacteria 614
143 Ga0075362_10002752 3300006177 Bacteria 5996
144 Ga0075362_10056719 3300006177 Bacteria 1764
145 Ga0075362_10589839 3300006177 Bacteria 574
146 Ga0075367_10054447 3300006178 Bacteria 2372
147 Ga0075367_10111355 3300006178 Bacteria 1680
148 Ga0075367_10116181 3300006178 Bacteria 1646
149 Ga0075367_10125088 3300006178 Bacteria 1586
150 Ga0075367_10142242 3300006178 Bacteria 1486
151 Ga0075367_10217764 3300006178 Bacteria 1194
152 Ga0075367_10936405 3300006178 Bacteria 553
153 Ga0075369_10172125 3300006186 Bacteria 995
154 Ga0075369_10184095 3300006186 Bacteria 961
155 Ga0075366_10024798 3300006195 Bacteria 3498
156 Ga0075366_10035548 3300006195 Bacteria 2937
157 Ga0075366_10169770 3300006195 Bacteria 1323
158 Ga0097621_100004522 3300006237 Bacteria 9692
159 Ga0097621_100954044 3300006237 Bacteria 801
160 Ga0075370_10004005 3300006353 Bacteria 7080
161 Ga0075370_10051002 3300006353 Bacteria 2347
162 Ga0075370_10112829 3300006353 Bacteria 1579
163 Ga0068871_100027319 3300006358 Bacteria 4463
164 Ga0068871_101506224 3300006358 Bacteria 636
165 Ga0097620_100538283 3300006931 Bacteria 1262
166 Ga0099824_1016622 3300006942 Bacteria 6617
167 Ga0105250_10168069 3300009092 Bacteria 917
168 Ga0105240_10024486 3300009093 Bacteria 7953
169 Ga0105240_10294803 3300009093 Bacteria 1858
170 Ga0105240_10361675 3300009093 Bacteria 1643
171 Ga0105245_10136564 3300009098 Bacteria 2305
172 Ga0105245_12248933 3300009098 Bacteria 599
173 Ga0105247_10123462 3300009101 Bacteria 1680
174 Ga0105247_10573530 3300009101 Bacteria 833
175 Ga0105243_10048008 3300009148 Bacteria 3364
176 Ga0105243_10256053 3300009148 Bacteria 1565
177 Ga0105241_10089422 3300009174 Bacteria 2426
178 Ga0105241_10281550 3300009174 Bacteria 1420
179 Ga0105248_10099852 3300009177 Bacteria 3270
180 Ga0105248_11194399 3300009177 Bacteria 860
181 Ga0105237_10001770 3300009545 Bacteria 27892
182 Ga0105237_10035674 3300009545 Bacteria 5031
183 Ga0105237_10342649 3300009545 Bacteria 1499
184 Ga0105237_11699223 3300009545 Bacteria 638
185 Ga0105238_10000178 3300009551 Bacteria 69458
186 Ga0105249_10154357 3300009553 Bacteria 2213
187 Ga0105239_10089934 3300010375 Bacteria 3386
188 Ga0105239_10233941 3300010375 Bacteria 2062
189 Ga0105239_10238225 3300010375 Bacteria 2042
190 Ga0105239_11163119 3300010375 Bacteria 889
191 Ga0105239_11571551 3300010375 Bacteria 760
192 Ga0105246_10041441 3300011119 Bacteria 3112
193 Ga0157347_1024357 3300012502 Bacteria 726
194 Ga0157373_10926955 3300013100 Bacteria 647
195 Ga0157371_10018923 3300013102 Bacteria 5084
196 Ga0157371_10948339 3300013102 Bacteria 654
197 Ga0157370_10754424 3300013104 Unclassified 887
198 Ga0157369_10003369 3300013105 Bacteria 18984
199 Ga0157374_10051371 3300013296 Bacteria 3836
200 Ga0157378_10763151 3300013297 Bacteria 991
201 Ga0163162_10000110 3300013306 Bacteria 73989
202 Ga0163162_10210147 3300013306 Bacteria 2076
203 Ga0163162_10752281 3300013306 Bacteria 1094
204 Ga0163162_12338517 3300013306 Bacteria 614
205 Ga0157372_10113515 3300013307 Bacteria 3105
206 Ga0157375_10028467 3300013308 Bacteria 5237
207 Ga0157375_10036930 3300013308 Bacteria 4676
208 Ga0163163_10138673 3300014325 Bacteria 2474
209 Ga0163163_10361097 3300014325 Bacteria 1509
210 Ga0182008_10654775 3300014497 Bacteria 595
211 Ga0157379_10172435 3300014968 Bacteria 1953
212 Ga0157379_11789756 3300014968 Bacteria 603
213 Ga0157376_10026499 3300014969 Bacteria 4582
214 Ga0157376_10104600 3300014969 Bacteria 2481
215 Ga0157376_11968383 3300014969 Bacteria 622
216 Ga0163161_10014561 3300017792 Bacteria 5474
217 Ga0209436_101892 3300025208 Bacteria 6761
218 Ga0209436_105876 3300025208 Bacteria 2755
219 Ga0209672_100230 3300025228 Bacteria 42658
220 Ga0209258_100022 3300025242 Bacteria 553584
221 Ga0207425_1000392 3300025245 Bacteria 29503
222 Ga0207425_1002099 3300025245 Bacteria 7364
223 Ga0207425_1063360 3300025245 Bacteria 648
224 Ga0209677_114264 3300025253 Bacteria 1091
225 Ga0209677_123473 3300025253 Bacteria 684
226 Ga0209148_1000034 3300025254 Bacteria 553584
227 Ga0209148_1027039 3300025254 Bacteria 886
228 Ga0209129_1000111 3300025258 Bacteria 148853
229 Ga0209129_1009569 3300025258 Bacteria 2531
230 Ga0209233_1002734 3300025261 Bacteria 6354
231 Ga0209565_1000146 3300025263 Bacteria 97720
232 Ga0209565_1007086 3300025263 Bacteria 3064
233 Ga0209673_1001463 3300025273 Bacteria 22194
234 Ga0209673_1003920 3300025273 Bacteria 8347
235 Ga0209673_1079023 3300025273 Bacteria 759
236 Ga0209130_1000470 3300025284 Bacteria 41506
237 Ga0209130_1000492 3300025284 Bacteria 40584
238 Ga0209130_1004038 3300025284 Bacteria 5828
239 Ga0209675_1000331 3300025291 Bacteria 41480
240 Ga0209675_1010206 3300025291 Bacteria 3229
241 Ga0209675_1010601 3300025291 Bacteria 3132
242 Ga0209676_1000005 3300025292 Bacteria 1076001
243 Ga0209025_1000116 3300025294 Bacteria 218293
244 Ga0209564_1000155 3300025295 Bacteria 165859
245 Ga0209564_1000292 3300025295 Bacteria 101735
246 Ga0209564_1050065 3300025295 Bacteria 1026
247 Ga0209758_1000107 3300025297 Bacteria 218293
248 Ga0209758_1000560 3300025297 Bacteria 58586
249 Ga0209758_1014068 3300025297 Bacteria 4296
250 Ga0209758_1023566 3300025297 Bacteria 2779
251 Ga0209758_1031638 3300025297 Bacteria 2166
252 Ga0209050_1000007 3300025298 Bacteria 1187891
253 Ga0209256_1000038 3300025299 Bacteria 375225
254 Ga0209256_1000087 3300025299 Bacteria 218290
255 Ga0207426_1000090 3300025302 Bacteria 280662
256 Ga0207426_1000123 3300025302 Bacteria 218290
257 Ga0207426_1000721 3300025302 Bacteria 38161
258 Ga0207426_1002233 3300025302 Bacteria 12914
259 Ga0207426_1054138 3300025302 Bacteria 1182
260 Ga0209051_1000009 3300025303 Bacteria 706778
261 Ga0209051_1004594 3300025303 Bacteria 8422
262 Ga0209257_1000011 3300025304 Bacteria 1112630
263 Ga0209257_1001961 3300025304 Bacteria 22193
264 Ga0209257_1021240 3300025304 Bacteria 2367
265 Ga0207697_10010315 3300025315 Bacteria 3999
266 Ga0207656_10024934 3300025321 Bacteria 2424
267 Ga0207682_10003155 3300025893 Bacteria 7221
268 Ga0207710_10129595 3300025900 Bacteria 1211
269 Ga0207688_10133648 3300025901 Bacteria 1455
270 Ga0207680_10000005 3300025903 Bacteria 660983
271 Ga0207647_10011713 3300025904 Bacteria 6138
272 Ga0207645_10026326 3300025907 Bacteria 3760
273 Ga0207645_10298781 3300025907 Bacteria 1072
274 Ga0207643_10004555 3300025908 Bacteria 7445
275 Ga0207705_10023654 3300025909 Bacteria 4383
276 Ga0207705_10027327 3300025909 Bacteria 4070
277 Ga0207684_10005581 3300025910 Bacteria 11584
278 Ga0207654_10050199 3300025911 Bacteria 2396
279 Ga0207654_10811583 3300025911 Bacteria 676
280 Ga0207695_10070556 3300025913 Bacteria 3571
281 Ga0207695_10135301 3300025913 Bacteria 2418
282 Ga0207671_10082541 3300025914 Bacteria 2412
283 Ga0207671_10107312 3300025914 Bacteria 2121
284 Ga0207671_11133110 3300025914 Bacteria 614
285 Ga0207657_10135966 3300025919 Bacteria 2011
286 Ga0207649_10016493 3300025920 Bacteria 4168
287 Ga0207649_10054356 3300025920 Bacteria 2492
288 Ga0207649_11078196 3300025920 Bacteria 633
289 Ga0207646_10800759 3300025922 Bacteria 839
290 Ga0207681_10204591 3300025923 Bacteria 1518
291 Ga0207694_10000187 3300025924 Bacteria 62967
292 Ga0207650_10001814 3300025925 Bacteria 15112
293 Ga0207650_10159196 3300025925 Bacteria 1788
294 Ga0207659_10000544 3300025926 Bacteria 22498
295 Ga0207687_10011700 3300025927 Bacteria 5739
296 Ga0207687_11439329 3300025927 Bacteria 592
297 Ga0207644_10009377 3300025931 Bacteria 6429
298 Ga0207644_10184661 3300025931 Bacteria 1636
299 Ga0207690_10800956 3300025932 Bacteria 779
300 Ga0207706_10093896 3300025933 Bacteria 2639
301 Ga0207706_10155947 3300025933 Bacteria 2008
302 Ga0207706_10766204 3300025933 Bacteria 821
303 Ga0207709_10040458 3300025935 Bacteria 2791
304 Ga0207709_10730037 3300025935 Bacteria 795
305 Ga0207670_10743719 3300025936 Bacteria 814
306 Ga0207669_11845511 3300025937 Bacteria 516
307 Ga0207691_10000186 3300025940 Bacteria 58949
308 Ga0207711_10123427 3300025941 Bacteria 2314
309 Ga0207689_10099054 3300025942 Bacteria 2395
310 Ga0207689_10102890 3300025942 Bacteria 2347
311 Ga0207689_10164947 3300025942 Bacteria 1826
312 Ga0207689_10200495 3300025942 Bacteria 1647
313 Ga0207679_10067762 3300025945 Bacteria 2679
314 Ga0207679_10099579 3300025945 Bacteria 2270
315 Ga0207667_10063180 3300025949 Bacteria 3869
316 Ga0207667_10291743 3300025949 Bacteria 1666
317 Ga0207651_10276936 3300025960 Bacteria 1384
318 Ga0207651_10288782 3300025960 Bacteria 1359
319 Ga0207712_10758076 3300025961 Bacteria 851
320 Ga0207668_10527235 3300025972 Bacteria 1020
321 Ga0207668_11380235 3300025972 Bacteria 635
322 Ga0207640_10057513 3300025981 Bacteria 2558
323 Ga0207640_10587450 3300025981 Bacteria 941
324 Ga0207658_10068331 3300025986 Bacteria 2681
325 Ga0207658_10079792 3300025986 Bacteria 2505
326 Ga0207658_10111212 3300025986 Bacteria 2166
327 Ga0207658_10166589 3300025986 Bacteria 1811
328 Ga0207658_11022758 3300025986 Bacteria 754
329 Ga0207658_11279264 3300025986 Bacteria 671
330 Ga0207658_11819689 3300025986 Bacteria 555
331 Ga0207677_11060663 3300026023 Bacteria 737
332 Ga0207703_10377016 3300026035 Bacteria 1311
333 Ga0207639_10013550 3300026041 Bacteria 5712
334 Ga0207639_10378590 3300026041 Bacteria 1270
335 Ga0207639_10422403 3300026041 Bacteria 1205
336 Ga0207678_10158522 3300026067 Bacteria 1933
337 Ga0207702_10276208 3300026078 Bacteria 1586
338 Ga0207702_10294328 3300026078 Bacteria 1539
339 Ga0207702_10970656 3300026078 Bacteria 843
340 Ga0207641_10093821 3300026088 Bacteria 2631
341 Ga0207641_10254720 3300026088 Bacteria 1641
342 Ga0207641_11843481 3300026088 Bacteria 606
343 Ga0207648_10000629 3300026089 Bacteria 39533
344 Ga0207648_10134043 3300026089 Bacteria 2181
345 Ga0207648_10256265 3300026089 Bacteria 1560
346 Ga0207676_10317132 3300026095 Bacteria 1429
347 Ga0207676_11522550 3300026095 Bacteria 666
348 Ga0207674_10022322 3300026116 Bacteria 6796
349 Ga0207674_10117439 3300026116 Bacteria 2631
350 Ga0207674_10455243 3300026116 Bacteria 1237
351 Ga0207675_101163692 3300026118 Bacteria 791
352 Ga0207683_10010974 3300026121 Bacteria 7725
353 Ga0207683_10187908 3300026121 Bacteria 1875
354 Ga0207698_10149897 3300026142 Bacteria 2022
355 Ga0207698_11105065 3300026142 Bacteria 806
356 Ga0209389_1000025 3300027296 Bacteria 149588
357 Ga0209589_1000066 3300027357 Bacteria 100795
358 Ga0209489_100030 3300027361 Bacteria 185999
359 Ga0209998_10123498 3300027717 Bacteria 654
360 Ga0209813_10018694 3300027866 Bacteria 1917
361 Ga0209974_10003650 3300027876 Bacteria 5526
362 Ga0268266_10000051 3300028379 Bacteria 296231
363 Ga0268266_10008473 3300028379 Bacteria 9138
364 Ga0268266_10064413 3300028379 Bacteria 3166
365 Ga0268266_10442246 3300028379 Bacteria 1235
366 Ga0268266_10581948 3300028379 Bacteria 1074
367 Ga0268266_11609506 3300028379 Bacteria 625
368 Ga0268266_12231182 3300028379 Bacteria 519
369 Ga0268265_10009645 3300028380 Bacteria 6518
370 Ga0268265_10053454 3300028380 Bacteria 3060
371 Ga0268265_11125856 3300028380 Bacteria 780
372 Ga0268264_10091715 3300028381 Bacteria 2621
373 Ga0268264_10173195 3300028381 Bacteria 1954
374 Ga0268264_10945235 3300028381 Bacteria 867
375 Ga0307517_10000024 3300028786 Bacteria 185597
376 Ga0307517_10221165 3300028786 Bacteria 1151
377 Ga0307515_10000572 3300028794 Bacteria 86935
378 Ga0307515_10039883 3300028794 Bacteria 7447
379 Ga0307515_10048367 3300028794 Bacteria 6431
380 Ga0307515_10097511 3300028794 Bacteria 3592
381 Ga0307515_10827884 3300028794 Bacteria 550
382 Ga0307512_10099062 3300030522 Bacteria 1986
383 Ga0316180_1185350 3300030736 Bacteria 2733
384 Ga0307513_10011603 3300031456 Bacteria 10940
385 Ga0307513_10019885 3300031456 Bacteria 7978
386 Ga0307513_10091911 3300031456 Bacteria 3091
387 Ga0307513_10158103 3300031456 Bacteria 2163
388 Ga0307513_10329066 3300031456 Bacteria 1283
389 Ga0307513_10621626 3300031456 Bacteria 788
390 Ga0307513_11008989 3300031456 Bacteria 542
391 Ga0307509_10000778 3300031507 Bacteria 54586
392 Ga0307509_10089931 3300031507 Bacteria 3147
393 Ga0307508_10017904 3300031616 Bacteria 6438
394 Ga0307516_10011416 3300031730 Bacteria 9650
395 Ga0307516_10014057 3300031730 Bacteria 8487
396 Ga0307516_10082809 3300031730 Bacteria 3050
397 Ga0307516_10179875 3300031730 Bacteria 1849
398 Ga0307406_10499334 3300031901 Bacteria 986
399 Ga0307510_10049877 3300033180 Bacteria 4448
400 Ga0395900_0292066 3300037418 Bacteria 1619
401 Ga0395905_0019296 3300037471 Bacteria 6464
402 Ga0395905_0076843 3300037471 Bacteria 3129
403 Ga0395905_0808610 3300037471 Bacteria 840
404 Ga0395901_0112041 3300038443 Bacteria 2866
405 Ga0395901_0268855 3300038443 Bacteria 1774
406 Ga0451791_1202226 3300041451 Bacteria 531
407 Ga0451793_1617958 3300041452 Bacteria 1605
408 Ga0451804_0864300 3300041463 Bacteria 732
409 Ga0451833_1488514 3300041491 Bacteria 2254
410 Ga0451835_0233361 3300041492 Bacteria 1219
411 Ga0451845_0605482 3300041501 Bacteria 1067
412 Ga0451851_1070308 3300041507 Bacteria 1038
413 Ga0451843_1372200 3300041509 Bacteria 607
414 Ga0451855_1272962 3300041511 Bacteria 915
415 Ga0451853_3203472 3300041512 Bacteria 1757
416 Ga0466969_0001480 3300044656 Bacteria 12627
417 Ga0466969_0004808 3300044656 Bacteria 7193
418 Ga0466969_0014853 3300044656 Bacteria 4088
419 Ga0466972_0000807 3300044658 Bacteria 14916
420 Ga0453683_0905587 3300044673 Bacteria 583
421 Ga0466966_0001348 3300044684 Bacteria 15776
422 Ga0466966_0023654 3300044684 Bacteria 4021
423 Ga0466961_0000120 3300044693 Bacteria 52569
424 Ga0466961_0008103 3300044693 Bacteria 6692
425 Ga0466961_0211955 3300044693 Bacteria 1195
426 Ga0466963_0356664 3300044694 Bacteria 1030
427 Ga0466971_0000095 3300044719 Bacteria 32391
428 Ga0466970_0395994 3300044765 Bacteria 787
429 Ga0466957_0005130 3300044842 Bacteria 7320
430 Ga0466959_0000240 3300045049 Bacteria 34052
431 Ga0466958_0000923 3300045836 Bacteria 13221
432 Ga0495617_158665 3300046452 Bacteria 718
433 Ga0495590_0105262 3300046457 Bacteria 1004
434 Ga0495629_0004834 3300046459 Bacteria 10101
435 Ga0495638_0080378 3300046460 Bacteria 1981
436 Ga0495638_0249562 3300046460 Unclassified 979
437 Ga0495651_0061972 3300046462 Bacteria 2862
438 Ga0495650_0005807 3300046471 Bacteria 7871
439 Ga0495607_0207588 3300046501 Bacteria 966
440 Ga0495606_0054446 3300046507 Bacteria 2591
441 Ga0495606_0209727 3300046507 Bacteria 1104
442 Ga0495620_0027728 3300046515 Bacteria 2646
443 Ga0495620_0362554 3300046515 Bacteria 549
444 Ga0495631_0124431 3300046518 Bacteria 1109
445 Ga0495631_0244360 3300046518 Bacteria 765
446 Ga0495632_0045232 3300046519 Bacteria 2194
447 Ga0495632_0070199 3300046519 Bacteria 1685
448 Ga0495632_0085945 3300046519 Bacteria 1496
449 Ga0495643_0018248 3300046522 Bacteria 4082
450 Ga0495648_0135996 3300046524 Bacteria 1300
451 Ga0495666_0185742 3300046526 Bacteria 959
452 Ga0495656_0011297 3300046615 Bacteria 3275
453 Ga0495668_0083471 3300046616 Bacteria 1752
454 Ga0495668_0086160 3300046616 Bacteria 1723
455 Ga0495668_0278150 3300046616 Bacteria 917
456 Ga0495634_0236678 3300046642 Bacteria 1122
457 Ga0495625_0004298 3300046660 Bacteria 13552
458 Ga0495625_0016332 3300046660 Bacteria 5845
459 Ga0495625_0100603 3300046660 Bacteria 1987
460 Ga0495635_0046740 3300046663 Bacteria 2985
461 Ga0495659_0141034 3300046664 Bacteria 962
462 Ga0495659_0289622 3300046664 Bacteria 690
463 Ga0495588_0042839 3300046674 Bacteria 2315
464 Ga0495657_0139213 3300046675 Bacteria 1514
465 Ga0495646_0112632 3300046680 Bacteria 1548
466 Ga0495624_0840139 3300046690 Bacteria 542
467 Ga0495670_0473822 3300046691 Bacteria 679
468 Ga0495649_0030817 3300046694 Bacteria 2960
469 Ga0495649_0188890 3300046694 Bacteria 1073
470 Ga0495600_0058038 3300046809 Bacteria 2528
471 Ga0495581_0141997 3300047315 Bacteria 1401
472 Ga0495604_0070415 3300047317 Bacteria 2648
473 Ga0495636_0118701 3300047318 Bacteria 1168
474 Ga0495687_011038 3300047443 Bacteria 4891
475 Ga0495673_0176623 3300047469 Bacteria 811
476 Ga0495686_0034809 3300047472 Bacteria 3241
477 Ga0495686_0100780 3300047472 Bacteria 1742
478 Ga0495686_0102336 3300047472 Bacteria 1726
479 Ga0495593_0102751 3300047673 Bacteria 1465
480 Ga0495614_0312453 3300048089 Bacteria 728
481 Ga0496100_0272880 3300048903 Bacteria 1258
482 Ga0496100_0581477 3300048903 Bacteria 868
483 Ga0496101_0129363 3300048904 Bacteria 1916
484 Ga0496101_0506490 3300048904 Bacteria 954
485 Ga0496102_0034116 3300048905 Bacteria 4576
486 Ga0496102_0209752 3300048905 Bacteria 1837
487 Ga0496102_1195943 3300048905 Bacteria 680
488 Ga0496103_0002701 3300048906 Bacteria 11067
489 Ga0496104_0075514 3300048907 Bacteria 3209
490 Ga0496105_0099818 3300048908 Bacteria 2397
491 Ga0496105_0145330 3300048908 Bacteria 1950
492 Ga0496106_0609890 3300048909 Bacteria 874
493 Ga0496107_0651931 3300048910 Bacteria 776
494 Ga0496108_0010766 3300048911 Bacteria 7425
495 Ga0496108_0083771 3300048911 Bacteria 2705
496 Ga0496108_1370920 3300048911 Bacteria 592
497 Ga0496109_0053400 3300048912 Bacteria 3685
498 Ga0496109_1150309 3300048912 Bacteria 713
499 Ga0496112_0111850 3300048915 Bacteria 2700
500 Ga0496112_0134434 3300048915 Bacteria 2443
501 Ga0496112_0256141 3300048915 Bacteria 1700
502 Ga0496113_0111091 3300048916 Bacteria 2134
503 Ga0496113_0121398 3300048916 Bacteria 2043
504 Ga0496113_0438421 3300048916 Bacteria 1049
505 Ga0496115_0146479 3300048918 Bacteria 1949
506 Ga0496115_0560678 3300048918 Bacteria 912
507 Ga0496115_0997367 3300048918 Bacteria 640
508 Ga0496117_0053343 3300048920 Bacteria 2842
509 Ga0496117_0118188 3300048920 Bacteria 1635
510 Ga0496117_0401008 3300048920 Bacteria 692
511 Ga0496118_0018021 3300048921 Bacteria 6394
512 Ga0496118_0026318 3300048921 Bacteria 4959
513 Ga0496118_0056090 3300048921 Bacteria 2965
514 Ga0496118_0068786 3300048921 Bacteria 2569
515 Ga0496118_0149727 3300048921 Bacteria 1463
516 Ga0496119_0011409 3300048922 Bacteria 7362
517 Ga0496119_0082411 3300048922 Bacteria 1850
518 Ga0496119_0147315 3300048922 Bacteria 1265
519 Ga0496120_0110715 3300048923 Bacteria 1435
520 Ga0496121_0209690 3300048924 Bacteria 1381
521 Ga0496121_0352834 3300048924 Bacteria 979
522 Ga0496122_0370153 3300048925 Bacteria 740
523 Ga0496124_0039510 3300048927 Bacteria 4090
524 Ga0496125_0076413 3300048928 Bacteria 2586
525 Ga0496125_0094222 3300048928 Bacteria 2232
526 Ga0496125_0311952 3300048928 Bacteria 958
527 Ga0496126_0048730 3300048929 Bacteria 3870
528 Ga0496126_0063564 3300048929 Bacteria 3309
529 Ga0496126_0108826 3300048929 Bacteria 2416
530 Ga0496126_0440086 3300048929 Bacteria 1051
531 Ga0495682_0344314 3300049460 Bacteria 525
532 Ga0501034_0460748 3300049571 Bacteria 1188
533 Ga0501216_106498 3300049660 Bacteria 624
534 nmdc:mga03683_123032_c1 3300050489 Bacteria 1155
535 nmdc:mga03683_245606_c1 3300050489 Bacteria 830
536 nmdc:mga03683_57034_c1 3300050489 Bacteria 1643
537 nmdc:mga03n38_110225_c1 3300050490 Bacteria 1339
538 nmdc:mga03n38_140241_c1 3300050490 Bacteria 1206
539 nmdc:mga03n38_152399_c1 3300050490 Bacteria 1164
540 nmdc:mga00v17_114811_c1 3300050491 Bacteria 1711
541 nmdc:mga00v17_44386_c1 3300050491 Bacteria 2680
542 nmdc:mga00v17_93241_c1 3300050491 Bacteria 1893
543 nmdc:mga0yw44_11693_c1 3300050492 Bacteria 4545
544 nmdc:mga0yw44_243591_c1 3300050492 Bacteria 1196
545 nmdc:mga0k408_124922_c1 3300050493 Bacteria 1526
546 nmdc:mga0k408_161149_c1 3300050493 Bacteria 1337
547 nmdc:mga0k408_33345_c1 3300050493 Bacteria 2945
548 nmdc:mga0k408_67221_c1 3300050493 Bacteria 2089
549 nmdc:mga06z11_130566_c1 3300050494 Bacteria 1411
550 nmdc:mga06z11_191815_c1 3300050494 Bacteria 1183
551 nmdc:mga06z11_35955_c1 3300050494 Bacteria 2441
552 nmdc:mga06z11_74027_c1 3300050494 Bacteria 1810
553 nmdc:mga06z11_820207_c1 3300050494 Bacteria 567
554 nmdc:mga04h51_123430_c1 3300050495 Bacteria 967
555 nmdc:mga04h51_22238_c1 3300050495 Bacteria 1917
556 nmdc:mga04h51_90079_c1 3300050495 Bacteria 1102
557 nmdc:mga07m45_31269_c1 3300050496 Bacteria 2950
558 nmdc:mga07m45_555983_c1 3300050496 Bacteria 664
559 nmdc:mga07m45_6469_c1 3300050496 Bacteria 5924
560 nmdc:mga07m45_74294_c1 3300050496 Bacteria 1937
561 nmdc:mga0rr50_789168_c1 3300050513 Bacteria 810
562 nmdc:mga0sz30_109954_c1 3300050516 Bacteria 1208
563 nmdc:mga0sz30_183411_c1 3300050516 Bacteria 929
564 nmdc:mga0sz30_248552_c1 3300050516 Bacteria 792
565 nmdc:mga0sz30_27135_c1 3300050516 Bacteria 2351
566 nmdc:mga0sz30_464763_c1 3300050516 Bacteria 568
567 Ga0495601_0734711 3300053077 Bacteria 629
568 Ga0500610_0002738 3300053079 Bacteria 6585
569 Ga0500610_0143202 3300053079 Bacteria 1205
570 Ga0500610_0244925 3300053079 Bacteria 831
571 Ga0495655_0064872 3300053083 Bacteria 1006
572 Ga0495619_1062312 3300053085 Bacteria 540
573 Ga0500578_0098214 3300053086 Bacteria 1855
574 Ga0500578_0124204 3300053086 Bacteria 1621
575 Ga0500647_0138368 3300053091 Bacteria 1144
576 Ga0500647_0201837 3300053091 Bacteria 901
577 Ga0500583_0023891 3300053092 Bacteria 2584
578 Ga0500583_0026123 3300053092 Bacteria 2503
579 Ga0500651_0012808 3300053093 Bacteria 5091
580 Ga0500651_0141773 3300053093 Bacteria 1448
581 Ga0500566_0158471 3300053094 Bacteria 1182
582 Ga0500640_023004 3300053095 Bacteria 2697
583 Ga0500641_0347308 3300053096 Bacteria 597
584 Ga0500648_338574 3300053097 Bacteria 625
585 Ga0500562_016324 3300053108 Bacteria 1909
586 Ga0500562_034602 3300053108 Bacteria 1337
587 Ga0500569_003017 3300053109 Bacteria 3384
588 Ga0500572_106961 3300053111 Bacteria 897
589 Ga0500595_002634 3300053119 Bacteria 8733
590 Ga0500595_013952 3300053119 Bacteria 3063
591 Ga0500595_032100 3300053119 Bacteria 1756
592 Ga0500607_006049 3300053121 Bacteria 7752
593 Ga0500607_011476 3300053121 Bacteria 5240
594 Ga0500608_161459 3300053122 Bacteria 970
595 Ga0500614_179891 3300053123 Bacteria 646
596 Ga0500642_0010960 3300053130 Bacteria 3221
597 Ga0500642_0030447 3300053130 Bacteria 2245
598 Ga0500652_086492 3300053131 Bacteria 1307
599 Ga0500652_097562 3300053131 Bacteria 1228
600 Ga0500658_0053565 3300053134 Bacteria 1655
601 Ga0500658_0086002 3300053134 Bacteria 1352
602 Ga0500658_0166661 3300053134 Unclassified 999
603 Ga0500658_0258836 3300053134 Bacteria 800
604 Ga0500559_0013563 3300053136 Bacteria 3449
605 Ga0500568_0006793 3300053139 Bacteria 5703
606 Ga0500568_0017833 3300053139 Unclassified 3123
607 Ga0500577_0053208 3300053142 Bacteria 1529
608 Ga0500590_137134 3300053148 Bacteria 1123
609 Ga0500604_0003450 3300053151 Bacteria 4258
610 Ga0500616_0099466 3300053153 Bacteria 1425
611 Ga0500616_0189413 3300053153 Bacteria 920
612 Ga0500619_151015 3300053154 Bacteria 790
613 Ga0500620_020852 3300053155 Bacteria 1950
614 Ga0500622_0210600 3300053156 Unclassified 878
615 Ga0500639_217339 3300053163 Bacteria 802
616 Ga0500636_0000076 3300053177 Bacteria 48321
617 Ga0500611_002748 3300053727 Bacteria 2155
618 Ga0500609_001166 3300053731 Bacteria 3911
619 Ga0500599_002866 3300053736 Bacteria 2090
620 Ga0500587_000134 3300053739 Bacteria 6898
621 Ga0500587_022052 3300053739 Bacteria 836
622 Ga0466962_0001879 3300061719 Bacteria 9888
623 2507510025 2507262055 Bacteria 8048963
624 2511397575 2511231028 Bacteria 8046582
625 2513649009 2513237095 Bacteria 8976980
626 2514039146 2513237164 Bacteria 7563725
627 2517107520 2517093001 Bacteria 9002274
628 2535520316 2534681796 Bacteria 7146037
629 2585392343 2582581866 Bacteria 6859583
630 2587758282 2585428062 Bacteria 6842168
631 2643880920 2643221573 Bacteria 4784121
632 2644661489 2643221720 Bacteria 4694283
633 2644699570 2643221728 Bacteria 4797149
634 2739792169 2739367756 Bacteria 4553612
635 2792747245 2791355123 Bacteria 8049106
636 2818241587 2816332527 Bacteria 8933356
637 2819596271 2818991446 Bacteria 7757362
638 2824605609 2824600985 Bacteria 8488197
639 2824609859 2824609381 Bacteria 8672835
640 2824655742 2824653114 Bacteria 8493680
641 2824669451 2824661429 Bacteria 9877870
642 2831270382 2831265667 Bacteria 7184833
643 2838056609 2838054893 Bacteria 7451788
644 2841959494 2841957949 Bacteria 8652217
645 2849080683 2849076700 Bacteria 7039503
646 2874172500 2874168670 Bacteria 8062617
647 2874623216 2874620515 Bacteria 8290088
648 2874636036 2874628541 Bacteria 8630250
649 2882635280 2882632389 Bacteria 8154593
650 2885199782 2885198086 Bacteria 7212419
651 2885213433 2885211737 Bacteria 7212420
652 2888382466 2888378607 Bacteria 9652610
653 2888388223 2888388044 Bacteria 7304136
654 2888423046 2888419890 Bacteria 7857137
655 2894417003 2894414249 Bacteria 4405451
656 2899925652 2899924645 Bacteria 7487985
657 2904670036 2904666416 Bacteria 8226587
658 2928038247 2928037797 Bacteria 7273642
659 2928046148 2928044640 Bacteria 7271509
660 2928053843 2928051484 Bacteria 7773759
661 2928067390 2928064002 Bacteria 7419480
662 2928526130 2928521798 Bacteria 4960112
663 2932797325 2932794094 Bacteria 7915132
664 2932804790 2932801729 Bacteria 7987968
665 2935619022 2935616580 Bacteria 9032984
666 2935643161 2935638405 Bacteria 10015038
667 2935669787 2935665750 Bacteria 9571747
668 2935677073 2935675223 Bacteria 9928132
669 2935693112 2935684952 Bacteria 9590419
670 2935719720 2935713505 Bacteria 9608509
671 2935729513 2935722832 Bacteria 9608746
672 2935739603 2935732158 Bacteria 9706831
673 2935748641 2935741537 Bacteria 9707219
674 2935756772 2935750917 Bacteria 9590372
675 2935832695 2935827899 Bacteria 10038562
676 2935839226 2935837841 Bacteria 9454360
677 2935857387 2935855204 Bacteria 9035059
678 2935864916 2935864058 Bacteria 9784707
679 2935876694 2935873716 Bacteria 9632195
680 2935884974 2935883170 Bacteria 7964738
681 2935998955 2935992306 Bacteria 9802711
682 2937825472 2937822353 Bacteria 7290551
683 2940562686 2940556831 Bacteria 9590747
684 2941539916 2941538514 Bacteria 9402094
685 2954014972 2954011201 Bacteria 4762601
686 2954771846 2954767861 Bacteria 5535784
687 8005548060 8005542996 Bacteria 7077758
688 nmdc:mga0k408_37301_c1
689 MBSR1b_contig_5120920
690 JGI25152J39213_1000902
691 JGI25150J39212_1000529
692 JGI25159J45721_1000714
693 JGI25159J45721_1015530
694 JGI25151J46595_10001672
695 JGI25153J46596_10001378
696 rootH1_10084038
697 JGI25160J50197_1000504
698 JGI25160J50197_1001019
699 JGI25160J50197_1016594
700 JGI25161J50226_1001946
701 JGI25161J50226_1007453
702 Ga0055539_1023106
703 Ga0055535_1000544
704 Ga0055542_1000004
705 Ga0055526_1001885
706 Ga0055526_1020268
707 Ga0055537_1000532
708 Ga0055537_1021503
709 Ga0055524_1001312
710 Ga0055524_1003577
711 Ga0055524_1008003
712 Ga0055536_1001009
713 Ga0055534_1000806
714 Ga0055534_1006267
715 Ga0055528_1000780
716 Ga0055528_1016555
717 Ga0055530_10000730
718 Ga0055530_10001183
719 Ga0055540_1001469
720 Ga0055540_1005496
721 Ga0055531_10002619
722 Ga0055531_10008256
723 Ga0055543_1000702
724 Ga0055543_1001310
725 Ga0065165_1000278
726 Ga0065165_1002519
727 Ga0065165_1016865
728 Ga0065165_1024980
729 Ga0065714_10404806
730 Ga0065715_10136549
731 Ga0070658_10005436
732 Ga0070676_10067141
733 Ga0070670_100061462
734 Ga0070670_100065897
735 Ga0070670_100136746
736 Ga0070677_10011531
737 Ga0068869_100367635
738 Ga0068869_101690182
739 Ga0070666_10000008
740 Ga0070661_100013390
741 Ga0070668_100026997
742 Ga0070668_100787774
743 Ga0070668_101231803
744 Ga0070669_100022638
745 Ga0070669_100118587
746 Ga0070675_100000730
747 Ga0070671_100002821
748 Ga0070671_100034351
749 Ga0070671_100234860
750 Ga0070671_100781906
751 Ga0070674_101268572
752 Ga0070673_100016466
753 Ga0070673_100087038
754 Ga0070673_100429956
755 Ga0070667_100023464
756 Ga0070667_100035512
757 Ga0070667_100230615
758 Ga0070667_100412982
759 Ga0070667_100457391
760 Ga0070667_100701117
761 Ga0070667_101396241
762 Ga0070667_101416414
763 Ga0070708_100173250
764 Ga0070708_100289057
765 Ga0070663_100003812
766 Ga0070678_100011111
767 Ga0070662_100224876
768 Ga0070662_100403870
769 Ga0068867_100001685
770 Ga0068867_100020669
771 Ga0068867_100243945
772 Ga0070706_100000297
773 Ga0070707_100016306
774 Ga0070698_100156206
775 Ga0070697_101469464
776 Ga0068853_100001340
777 Ga0068853_100059971
778 Ga0068853_100398065
779 Ga0070672_100000424
780 Ga0070665_100009026
781 Ga0070665_100031156
782 Ga0070665_100363659
783 Ga0070665_100687013
784 Ga0070665_100841690
785 Ga0070665_100932919
786 Ga0068855_100123638
787 Ga0068855_100150995
788 Ga0070664_100096689
789 Ga0070664_100457789
790 Ga0070664_101272953
791 Ga0068857_100018893
792 Ga0068857_100285909
793 Ga0068857_100763917
794 Ga0068854_100073055
795 Ga0068854_100649103
796 Ga0068856_100482528
797 Ga0068856_101101422
798 Ga0068852_100045272
799 Ga0068852_100172206
800 Ga0068859_100538291
801 Ga0068864_100022500
802 Ga0068864_100240584
803 Ga0068866_10043543
804 Ga0068861_100009698
805 Ga0068851_10014519
806 Ga0068851_10111571
807 Ga0068863_100276597
808 Ga0068863_101031522
809 Ga0068863_102127948
810 Ga0068858_100252152
811 Ga0068860_100134545
812 Ga0068860_100262900
813 Ga0068860_100304562
814 Ga0068860_101225147
815 Ga0068862_100114031
816 Ga0068862_100177327
817 Ga0081455_10779102
818 Ga0075365_10039463
819 Ga0075365_10052571
820 Ga0075365_10202781
821 Ga0075365_10239282
822 Ga0075368_10007174
823 Ga0075368_10119702
824 Ga0075363_100001650
825 Ga0075363_100373831
826 Ga0075364_10160045
827 Ga0075364_10218217
828 Ga0075364_10243112
829 Ga0075364_10869892
830 Ga0075362_10002752
831 Ga0075362_10056719
832 Ga0075362_10589839
833 Ga0075367_10054447
834 Ga0075367_10111355
835 Ga0075367_10116181
836 Ga0075367_10125088
837 Ga0075367_10142242
838 Ga0075367_10217764
839 Ga0075367_10936405
840 Ga0075369_10172125
841 Ga0075369_10184095
842 Ga0075366_10024798
843 Ga0075366_10035548
844 Ga0075366_10169770
845 Ga0097621_100004522
846 Ga0097621_100954044
847 Ga0075370_10004005
848 Ga0075370_10051002
849 Ga0075370_10112829
850 Ga0068871_100027319
851 Ga0068871_101506224
852 Ga0097620_100538283
853 Ga0099824_1016622
854 Ga0105250_10168069
855 Ga0105240_10024486
856 Ga0105240_10294803
857 Ga0105240_10361675
858 Ga0105245_10136564
859 Ga0105245_12248933
860 Ga0105247_10123462
861 Ga0105247_10573530
862 Ga0105243_10048008
863 Ga0105243_10256053
864 Ga0105241_10089422
865 Ga0105241_10281550
866 Ga0105248_10099852
867 Ga0105248_11194399
868 Ga0105237_10001770
869 Ga0105237_10035674
870 Ga0105237_10342649
871 Ga0105237_11699223
872 Ga0105238_10000178
873 Ga0105249_10154357
874 Ga0105239_10089934
875 Ga0105239_10233941
876 Ga0105239_10238225
877 Ga0105239_11163119
878 Ga0105239_11571551
879 Ga0105246_10041441
880 Ga0157347_1024357
881 Ga0157373_10926955
882 Ga0157371_10018923
883 Ga0157371_10948339
884 Ga0157370_10754424
885 Ga0157369_10003369
886 Ga0157374_10051371
887 Ga0157378_10763151
888 Ga0163162_10000110
889 Ga0163162_10210147
890 Ga0163162_10752281
891 Ga0163162_12338517
892 Ga0157372_10113515
893 Ga0157375_10028467
894 Ga0157375_10036930
895 Ga0163163_10138673
896 Ga0163163_10361097
897 Ga0182008_10654775
898 Ga0157379_10172435
899 Ga0157379_11789756
900 Ga0157376_10026499
901 Ga0157376_10104600
902 Ga0157376_11968383
903 Ga0163161_10014561
904 Ga0209436_101892
905 Ga0209436_105876
906 Ga0209672_100230
907 Ga0209258_100022
908 Ga0207425_1000392
909 Ga0207425_1002099
910 Ga0207425_1063360
911 Ga0209677_114264
912 Ga0209677_123473
913 Ga0209148_1000034
914 Ga0209148_1027039
915 Ga0209129_1000111
916 Ga0209129_1009569
917 Ga0209233_1002734
918 Ga0209565_1000146
919 Ga0209565_1007086
920 Ga0209673_1001463
921 Ga0209673_1003920
922 Ga0209673_1079023
923 Ga0209130_1000470
924 Ga0209130_1000492
925 Ga0209130_1004038
926 Ga0209675_1000331
927 Ga0209675_1010206
928 Ga0209675_1010601
929 Ga0209676_1000005
930 Ga0209025_1000116
931 Ga0209564_1000155
932 Ga0209564_1000292
933 Ga0209564_1050065
934 Ga0209758_1000107
935 Ga0209758_1000560
936 Ga0209758_1014068
937 Ga0209758_1023566
938 Ga0209758_1031638
939 Ga0209050_1000007
940 Ga0209256_1000038
941 Ga0209256_1000087
942 Ga0207426_1000090
943 Ga0207426_1000123
944 Ga0207426_1000721
945 Ga0207426_1002233
946 Ga0207426_1054138
947 Ga0209051_1000009
948 Ga0209051_1004594
949 Ga0209257_1000011
950 Ga0209257_1001961
951 Ga0209257_1021240
952 Ga0207697_10010315
953 Ga0207656_10024934
954 Ga0207682_10003155
955 Ga0207710_10129595
956 Ga0207688_10133648
957 Ga0207680_10000005
958 Ga0207647_10011713
959 Ga0207645_10026326
960 Ga0207645_10298781
961 Ga0207643_10004555
962 Ga0207705_10023654
963 Ga0207705_10027327
964 Ga0207684_10005581
965 Ga0207654_10050199
966 Ga0207654_10811583
967 Ga0207695_10070556
968 Ga0207695_10135301
969 Ga0207671_10082541
970 Ga0207671_10107312
971 Ga0207671_11133110
972 Ga0207657_10135966
973 Ga0207649_10016493
974 Ga0207649_10054356
975 Ga0207649_11078196
976 Ga0207646_10800759
977 Ga0207681_10204591
978 Ga0207694_10000187
979 Ga0207650_10001814
980 Ga0207650_10159196
981 Ga0207659_10000544
982 Ga0207687_10011700
983 Ga0207687_11439329
984 Ga0207644_10009377
985 Ga0207644_10184661
986 Ga0207690_10800956
987 Ga0207706_10093896
988 Ga0207706_10155947
989 Ga0207706_10766204
990 Ga0207709_10040458
991 Ga0207709_10730037
992 Ga0207670_10743719
993 Ga0207669_11845511
994 Ga0207691_10000186
995 Ga0207711_10123427
996 Ga0207689_10099054
997 Ga0207689_10102890
998 Ga0207689_10164947
999 Ga0207689_10200495
1000 Ga0207679_10067762
1001 Ga0207679_10099579
1002 Ga0207667_10063180
1003 Ga0207667_10291743
1004 Ga0207651_10276936
1005 Ga0207651_10288782
1006 Ga0207712_10758076
1007 Ga0207668_10527235
1008 Ga0207668_11380235
1009 Ga0207640_10057513
1010 Ga0207640_10587450
1011 Ga0207658_10068331
1012 Ga0207658_10079792
1013 Ga0207658_10111212
1014 Ga0207658_10166589
1015 Ga0207658_11022758
1016 Ga0207658_11279264
1017 Ga0207658_11819689
1018 Ga0207677_11060663
1019 Ga0207703_10377016
1020 Ga0207639_10013550
1021 Ga0207639_10378590
1022 Ga0207639_10422403
1023 Ga0207678_10158522
1024 Ga0207702_10276208
1025 Ga0207702_10294328
1026 Ga0207702_10970656
1027 Ga0207641_10093821
1028 Ga0207641_10254720
1029 Ga0207641_11843481
1030 Ga0207648_10000629
1031 Ga0207648_10134043
1032 Ga0207648_10256265
1033 Ga0207676_10317132
1034 Ga0207676_11522550
1035 Ga0207674_10022322
1036 Ga0207674_10117439
1037 Ga0207674_10455243
1038 Ga0207675_101163692
1039 Ga0207683_10010974
1040 Ga0207683_10187908
1041 Ga0207698_10149897
1042 Ga0207698_11105065
1043 Ga0209389_1000025
1044 Ga0209589_1000066
1045 Ga0209489_100030
1046 Ga0209998_10123498
1047 Ga0209813_10018694
1048 Ga0209974_10003650
1049 Ga0268266_10000051
1050 Ga0268266_10008473
1051 Ga0268266_10064413
1052 Ga0268266_10442246
1053 Ga0268266_10581948
1054 Ga0268266_11609506
1055 Ga0268266_12231182
1056 Ga0268265_10009645
1057 Ga0268265_10053454
1058 Ga0268265_11125856
1059 Ga0268264_10091715
1060 Ga0268264_10173195
1061 Ga0268264_10945235
1062 Ga0307517_10000024
1063 Ga0307517_10221165
1064 Ga0307515_10000572
1065 Ga0307515_10039883
1066 Ga0307515_10048367
1067 Ga0307515_10097511
1068 Ga0307515_10827884
1069 Ga0307512_10099062
1070 Ga0316180_1185350
1071 Ga0307513_10011603
1072 Ga0307513_10019885
1073 Ga0307513_10091911
1074 Ga0307513_10158103
1075 Ga0307513_10329066
1076 Ga0307513_10621626
1077 Ga0307513_11008989
1078 Ga0307509_10000778
1079 Ga0307509_10089931
1080 Ga0307508_10017904
1081 Ga0307516_10011416
1082 Ga0307516_10014057
1083 Ga0307516_10082809
1084 Ga0307516_10179875
1085 Ga0307406_10499334
1086 Ga0307510_10049877
1087 Ga0395900_0292066
1088 Ga0395905_0019296
1089 Ga0395905_0076843
1090 Ga0395905_0808610
1091 Ga0395901_0112041
1092 Ga0395901_0268855
1093 Ga0451791_1202226
1094 Ga0451793_1617958
1095 Ga0451804_0864300
1096 Ga0451833_1488514
1097 Ga0451835_0233361
1098 Ga0451845_0605482
1099 Ga0451851_1070308
1100 Ga0451843_1372200
1101 Ga0451855_1272962
1102 Ga0451853_3203472
1103 Ga0466969_0001480
1104 Ga0466969_0004808
1105 Ga0466969_0014853
1106 Ga0466972_0000807
1107 Ga0453683_0905587
1108 Ga0466966_0001348
1109 Ga0466966_0023654
1110 Ga0466961_0000120
1111 Ga0466961_0008103
1112 Ga0466961_0211955
1113 Ga0466963_0356664
1114 Ga0466971_0000095
1115 Ga0466970_0395994
1116 Ga0466957_0005130
1117 Ga0466959_0000240
1118 Ga0466958_0000923
1119 Ga0495617_158665
1120 Ga0495590_0105262
1121 Ga0495629_0004834
1122 Ga0495638_0080378
1123 Ga0495638_0249562
1124 Ga0495651_0061972
1125 Ga0495650_0005807
1126 Ga0495607_0207588
1127 Ga0495606_0054446
1128 Ga0495606_0209727
1129 Ga0495620_0027728
1130 Ga0495620_0362554
1131 Ga0495631_0124431
1132 Ga0495631_0244360
1133 Ga0495632_0045232
1134 Ga0495632_0070199
1135 Ga0495632_0085945
1136 Ga0495643_0018248
1137 Ga0495648_0135996
1138 Ga0495666_0185742
1139 Ga0495656_0011297
1140 Ga0495668_0083471
1141 Ga0495668_0086160
1142 Ga0495668_0278150
1143 Ga0495634_0236678
1144 Ga0495625_0004298
1145 Ga0495625_0016332
1146 Ga0495625_0100603
1147 Ga0495635_0046740
1148 Ga0495659_0141034
1149 Ga0495659_0289622
1150 Ga0495588_0042839
1151 Ga0495657_0139213
1152 Ga0495646_0112632
1153 Ga0495624_0840139
1154 Ga0495670_0473822
1155 Ga0495649_0030817
1156 Ga0495649_0188890
1157 Ga0495600_0058038
1158 Ga0495581_0141997
1159 Ga0495604_0070415
1160 Ga0495636_0118701
1161 Ga0495687_011038
1162 Ga0495673_0176623
1163 Ga0495686_0034809
1164 Ga0495686_0100780
1165 Ga0495686_0102336
1166 Ga0495593_0102751
1167 Ga0495614_0312453
1168 Ga0496100_0272880
1169 Ga0496100_0581477
1170 Ga0496101_0129363
1171 Ga0496101_0506490
1172 Ga0496102_0034116
1173 Ga0496102_0209752
1174 Ga0496102_1195943
1175 Ga0496103_0002701
1176 Ga0496104_0075514
1177 Ga0496105_0099818
1178 Ga0496105_0145330
1179 Ga0496106_0609890
1180 Ga0496107_0651931
1181 Ga0496108_0010766
1182 Ga0496108_0083771
1183 Ga0496108_1370920
1184 Ga0496109_0053400
1185 Ga0496109_1150309
1186 Ga0496112_0111850
1187 Ga0496112_0134434
1188 Ga0496112_0256141
1189 Ga0496113_0111091
1190 Ga0496113_0121398
1191 Ga0496113_0438421
1192 Ga0496115_0146479
1193 Ga0496115_0560678
1194 Ga0496115_0997367
1195 Ga0496117_0053343
1196 Ga0496117_0118188
1197 Ga0496117_0401008
1198 Ga0496118_0018021
1199 Ga0496118_0026318
1200 Ga0496118_0056090
1201 Ga0496118_0068786
1202 Ga0496118_0149727
1203 Ga0496119_0011409
1204 Ga0496119_0082411
1205 Ga0496119_0147315
1206 Ga0496120_0110715
1207 Ga0496121_0209690
1208 Ga0496121_0352834
1209 Ga0496122_0370153
1210 Ga0496124_0039510
1211 Ga0496125_0076413
1212 Ga0496125_0094222
1213 Ga0496125_0311952
1214 Ga0496126_0048730
1215 Ga0496126_0063564
1216 Ga0496126_0108826
1217 Ga0496126_0440086
1218 Ga0495682_0344314
1219 Ga0501034_0460748
1220 Ga0501216_106498
1221 nmdc:mga03683_123032_c1
1222 nmdc:mga03683_245606_c1
1223 nmdc:mga03683_57034_c1
1224 nmdc:mga03n38_110225_c1
1225 nmdc:mga03n38_140241_c1
1226 nmdc:mga03n38_152399_c1
1227 nmdc:mga00v17_114811_c1
1228 nmdc:mga00v17_44386_c1
1229 nmdc:mga00v17_93241_c1
1230 nmdc:mga0yw44_11693_c1
1231 nmdc:mga0yw44_243591_c1
1232 nmdc:mga0k408_124922_c1
1233 nmdc:mga0k408_161149_c1
1234 nmdc:mga0k408_33345_c1
1235 nmdc:mga0k408_67221_c1
1236 nmdc:mga06z11_130566_c1
1237 nmdc:mga06z11_191815_c1
1238 nmdc:mga06z11_35955_c1
1239 nmdc:mga06z11_74027_c1
1240 nmdc:mga06z11_820207_c1
1241 nmdc:mga04h51_123430_c1
1242 nmdc:mga04h51_22238_c1
1243 nmdc:mga04h51_90079_c1
1244 nmdc:mga07m45_31269_c1
1245 nmdc:mga07m45_555983_c1
1246 nmdc:mga07m45_6469_c1
1247 nmdc:mga07m45_74294_c1
1248 nmdc:mga0rr50_789168_c1
1249 nmdc:mga0sz30_109954_c1
1250 nmdc:mga0sz30_183411_c1
1251 nmdc:mga0sz30_248552_c1
1252 nmdc:mga0sz30_27135_c1
1253 nmdc:mga0sz30_464763_c1
1254 Ga0495601_0734711
1255 Ga0500610_0002738
1256 Ga0500610_0143202
1257 Ga0500610_0244925
1258 Ga0495655_0064872
1259 Ga0495619_1062312
1260 Ga0500578_0098214
1261 Ga0500578_0124204
1262 Ga0500647_0138368
1263 Ga0500647_0201837
1264 Ga0500583_0023891
1265 Ga0500583_0026123
1266 Ga0500651_0012808
1267 Ga0500651_0141773
1268 Ga0500566_0158471
1269 Ga0500640_023004
1270 Ga0500641_0347308
1271 Ga0500648_338574
1272 Ga0500562_016324
1273 Ga0500562_034602
1274 Ga0500569_003017
1275 Ga0500572_106961
1276 Ga0500595_002634
1277 Ga0500595_013952
1278 Ga0500595_032100
1279 Ga0500607_006049
1280 Ga0500607_011476
1281 Ga0500608_161459
1282 Ga0500614_179891
1283 Ga0500642_0010960
1284 Ga0500642_0030447
1285 Ga0500652_086492
1286 Ga0500652_097562
1287 Ga0500658_0053565
1288 Ga0500658_0086002
1289 Ga0500658_0166661
1290 Ga0500658_0258836
1291 Ga0500559_0013563
1292 Ga0500568_0006793
1293 Ga0500568_0017833
1294 Ga0500577_0053208
1295 Ga0500590_137134
1296 Ga0500604_0003450
1297 Ga0500616_0099466
1298 Ga0500616_0189413
1299 Ga0500619_151015
1300 Ga0500620_020852
1301 Ga0500622_0210600
1302 Ga0500639_217339
1303 Ga0500636_0000076
1304 Ga0500611_002748
1305 Ga0500609_001166
1306 Ga0500599_002866
1307 Ga0500587_000134
1308 Ga0500587_022052
1309 Ga0466962_0001879
1310 2507510025
1311 2511397575
1312 2513649009
1313 2514039146
1314 2517107520
1315 2535520316
1316 2585392343
1317 2587758282
1318 2643880920
1319 2644661489
1320 2644699570
1321 2739792169
1322 2792747245
1323 2818241587
1324 2819596271
1325 2824605609
1326 2824609859
1327 2824655742
1328 2824669451
1329 2831270382
1330 2838056609
1331 2841959494
1332 2849080683
1333 2874172500
1334 2874623216
1335 2874636036
1336 2882635280
1337 2885199782
1338 2885213433
1339 2888382466
1340 2888388223
1341 2888423046
1342 2894417003
1343 2899925652
1344 2904670036
1345 2928038247
1346 2928046148
1347 2928053843
1348 2928067390
1349 2928526130
1350 2932797325
1351 2932804790
1352 2935619022
1353 2935643161
1354 2935669787
1355 2935677073
1356 2935693112
1357 2935719720
1358 2935729513
1359 2935739603
1360 2935748641
1361 2935756772
1362 2935832695
1363 2935839226
1364 2935857387
1365 2935864916
1366 2935876694
1367 2935884974
1368 2935998955
1369 2937825472
1370 2940562686
1371 2941539916
1372 2954014972
1373 2954771846
1374 8005548060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

45

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.9163 3 137
4hr6-assembly1.cif.gz_B crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips 0.8514 58 88
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8509 3 137
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.8495 58 86
5y42-assembly2.cif.gz_E native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina 0.8482 58 88
ID Description Score Start End Superfamily
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8514 58 88 3.40.420.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8266 4 131 3.90.1590.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.825 58 85 3.40.420.10
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8227 58 87 3.40.420.10
1yf8A01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8055 58 86 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A3S3RGJ6-F1-model_v4 GFA family protein 0.9795 5 112 GO:0016846
GO:0046872
AF-A0A7C9G102-F1-model_v4 Aldehyde-activating protein 0.9781 5 137 GO:0016846
GO:0046872
AF-A0A4R3JFK9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9771 2 136 GO:0016846
GO:0046872
AF-A5EH59-F1-model_v4 deleted 0.9749 24 137
AF-A0A2P2DRP6-F1-model_v4 deleted 0.9748 38 137

Map