F475245

General Info

Members Datasets Scaffolds Average Seq Length
687 250 687 369

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100255543|Ga0075430_1002555431
Length 393
Sequence VIQGHGIMDWTTHEGYGIPIGLSFPHGFPKEVSLVSFTLHLSLFTRKQLYLCLQKAYGRGDLRVVRRIQALLALAEGHSVQEVAVMLNLGHQTIRDYRNGFLLQGVSSLTYKRPPGRPSKLTKSQRRQLANWIKAGPQAAGYSAGGWNTPMIQDLIQSRFGVSYHPHYLATVLHHLGFSYQKARFVSDHLNETKRLEWRRTKWPEILRHAQRRKALLLFGDEASFAQWGSLSYTWAPVGQQPEVPTSGKRKGYKIFGLIDYFSGRFFYKSHEGRFNSESYAAFLLDVLGQTRRHVVVIQDGARYHTSAAMKVFFKVHAARLTIEQLPSYSPDFNPIEHLWKKVKKEATHLKYFPDFSHLQAEVDRALLHFAQTPSEISVLMARYCETLGAKAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
147 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
148 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
161 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
162 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
163 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
170 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
218 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
222 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
223 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
224 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
233 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
234 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
235 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
236 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.44
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1450232 2162886007 Unclassified 1797
2 JGI24751J29686_10023150 3300002459 Bacteria 1288
3 JGI25406J46586_10035381 3300003203 Bacteria 1823
4 JGI25406J46586_10052708 3300003203 Bacteria 1354
5 rootH1_10150326 3300003316 Unclassified 1416
6 rootH1_10094301 3300003323 Unclassified 1442
7 JGI25407J50210_10006773 3300003373 Unclassified 2862
8 JGI25407J50210_10035173 3300003373 Bacteria 1292
9 JGI25405J52794_10022661 3300003911 Bacteria 1275
10 JGI25405J52794_10024172 3300003911 Unclassified 1239
11 Ga0065704_10139675 3300005289 Bacteria 1531
12 Ga0065707_10021882 3300005295 Unclassified 1326
13 Ga0065707_10032764 3300005295 Bacteria 1337
14 Ga0065707_10158189 3300005295 Bacteria 1588
15 Ga0065707_10170125 3300005295 Bacteria 1491
16 Ga0065707_10189605 3300005295 Unclassified 1369
17 Ga0065707_10205135 3300005295 Bacteria 1292
18 Ga0065707_10218654 3300005295 Bacteria 1234
19 Ga0070690_100197406 3300005330 Bacteria 1398
20 Ga0070690_100206684 3300005330 Bacteria 1369
21 Ga0070670_100288357 3300005331 Bacteria 1434
22 Ga0070670_100308640 3300005331 Bacteria 1385
23 Ga0068869_100227435 3300005334 Bacteria 1481
24 Ga0068868_100362175 3300005338 Bacteria 1244
25 Ga0070689_100283517 3300005340 Bacteria 1375
26 Ga0070689_100343600 3300005340 Bacteria 1250
27 Ga0070687_100129125 3300005343 Bacteria 1457
28 Ga0070687_100141250 3300005343 Unclassified 1403
29 Ga0070687_100143569 3300005343 Bacteria 1393
30 Ga0070692_10118761 3300005345 Bacteria 1472
31 Ga0070668_100298096 3300005347 Bacteria 1351
32 Ga0070669_100265853 3300005353 Bacteria 1370
33 Ga0070674_100142693 3300005356 Bacteria 1799
34 Ga0070674_100280148 3300005356 Bacteria 1321
35 Ga0070667_100118780 3300005367 Bacteria 2298
36 Ga0070705_100182581 3300005440 Bacteria 1422
37 Ga0070705_100256223 3300005440 Bacteria 1231
38 Ga0070700_100182769 3300005441 Bacteria 1461
39 Ga0070694_100201387 3300005444 Unclassified 1484
40 Ga0070694_100257648 3300005444 Bacteria 1322
41 Ga0070708_100094957 3300005445 Bacteria 2721
42 Ga0070708_100368144 3300005445 Bacteria 1355
43 Ga0070708_100396659 3300005445 Unclassified 1301
44 Ga0070662_100184647 3300005457 Bacteria 1646
45 Ga0070662_100331590 3300005457 Bacteria 1243
46 Ga0070662_100337599 3300005457 Bacteria 1232
47 Ga0068867_100285033 3300005459 Bacteria 1356
48 Ga0070685_10027509 3300005466 Unclassified 3144
49 Ga0070685_10205237 3300005466 Bacteria 1283
50 Ga0070706_100056325 3300005467 Unclassified 3628
51 Ga0070706_100094551 3300005467 Bacteria 2773
52 Ga0070706_100195608 3300005467 Bacteria 1889
53 Ga0070707_100326093 3300005468 Unclassified 1492
54 Ga0070707_100414516 3300005468 Bacteria 1307
55 Ga0070707_100479504 3300005468 Unclassified 1205
56 Ga0070698_100071599 3300005471 Bacteria 3476
57 Ga0070698_100112422 3300005471 Bacteria 2688
58 Ga0070698_100332388 3300005471 Bacteria 1451
59 Ga0070698_100386638 3300005471 Bacteria 1332
60 Ga0070698_100439755 3300005471 Unclassified 1239
61 Ga0070699_100062461 3300005518 Bacteria 3228
62 Ga0070697_100118938 3300005536 Bacteria 2208
63 Ga0070697_100298733 3300005536 Bacteria 1384
64 Ga0070686_100128194 3300005544 Bacteria 1751
65 Ga0070686_100220794 3300005544 Bacteria 1369
66 Ga0070686_100271737 3300005544 Bacteria 1247
67 Ga0070696_100230670 3300005546 Unclassified 1393
68 Ga0070704_100316074 3300005549 Unclassified 1307
69 Ga0070664_100331194 3300005564 Bacteria 1381
70 Ga0068854_100287735 3300005578 Bacteria 1325
71 Ga0068856_100102883 3300005614 Unclassified 2850
72 Ga0070702_100065292 3300005615 Bacteria 2132
73 Ga0068859_100427119 3300005617 Bacteria 1422
74 Ga0068864_100416917 3300005618 Bacteria 1279
75 Ga0068866_10123579 3300005718 Bacteria 1462
76 Ga0068861_100051330 3300005719 Bacteria 3130
77 Ga0068861_100070440 3300005719 Bacteria 2708
78 Ga0068861_100230290 3300005719 Unclassified 1571
79 Ga0068861_100242509 3300005719 Bacteria 1534
80 Ga0068861_100378608 3300005719 Bacteria 1250
81 Ga0068870_10091246 3300005840 Bacteria 1703
82 Ga0068863_100394250 3300005841 Bacteria 1353
83 Ga0068860_100061739 3300005843 Unclassified 3561
84 Ga0068860_100266238 3300005843 Bacteria 1672
85 Ga0068860_100322245 3300005843 Bacteria 1517
86 Ga0068860_100440052 3300005843 Unclassified 1295
87 Ga0068860_100450404 3300005843 Bacteria 1280
88 Ga0068862_100391937 3300005844 Bacteria 1297
89 Ga0081455_10025104 3300005937 Bacteria 5506
90 Ga0081455_10033829 3300005937 Unclassified 4587
91 Ga0081455_10057992 3300005937 Bacteria 3279
92 Ga0081455_10199446 3300005937 Bacteria 1500
93 Ga0081455_10219275 3300005937 Unclassified 1411
94 Ga0081455_10222645 3300005937 Bacteria 1397
95 Ga0081455_10239152 3300005937 Unclassified 1335
96 Ga0081455_10243728 3300005937 Bacteria 1319
97 Ga0081538_10012461 3300005981 Bacteria 6814
98 Ga0081538_10021253 3300005981 Bacteria 4746
99 Ga0081538_10037776 3300005981 Unclassified 3125
100 Ga0081538_10087758 3300005981 Unclassified 1622
101 Ga0081538_10093472 3300005981 Unclassified 1544
102 Ga0081538_10110816 3300005981 Bacteria 1348
103 Ga0081538_10111158 3300005981 Bacteria 1345
104 Ga0081538_10111872 3300005981 Bacteria 1338
105 Ga0081538_10116598 3300005981 Bacteria 1295
106 Ga0081540_1008938 3300005983 Bacteria 6940
107 Ga0081540_1013776 3300005983 Bacteria 5237
108 Ga0081540_1031413 3300005983 Unclassified 2920
109 Ga0081539_10004581 3300005985 Bacteria 15091
110 Ga0081539_10050047 3300005985 Bacteria 2367
111 Ga0081539_10061593 3300005985 Unclassified 2055
112 Ga0081539_10065151 3300005985 Unclassified 1980
113 Ga0081539_10105875 3300005985 Unclassified 1425
114 Ga0081539_10106527 3300005985 Bacteria 1419
115 Ga0075432_10011272 3300006058 Bacteria 3038
116 Ga0075432_10020289 3300006058 Unclassified 2272
117 Ga0075432_10021146 3300006058 Bacteria 2225
118 Ga0075432_10038204 3300006058 Bacteria 1672
119 Ga0075432_10039483 3300006058 Bacteria 1646
120 Ga0075432_10060553 3300006058 Unclassified 1347
121 Ga0075427_10002360 3300006194 Plasmid 2525
122 Ga0075427_10002534 3300006194 Bacteria 2460
123 Ga0075427_10005504 3300006194 Bacteria 1806
124 Ga0075427_10005521 3300006194 Bacteria 1804
125 Ga0075427_10006062 3300006194 Bacteria 1741
126 Ga0075427_10009979 3300006194 Bacteria 1417
127 Ga0075428_100052452 3300006844 Bacteria 4470
128 Ga0075428_100104780 3300006844 Bacteria 3084
129 Ga0075428_100170395 3300006844 Bacteria 2360
130 Ga0075428_100175980 3300006844 Unclassified 2317
131 Ga0075428_100180585 3300006844 Bacteria 2284
132 Ga0075428_100210702 3300006844 Bacteria 2100
133 Ga0075428_100221419 3300006844 Bacteria 2043
134 Ga0075428_100261743 3300006844 Bacteria 1862
135 Ga0075428_100263022 3300006844 Unclassified 1857
136 Ga0075428_100379450 3300006844 Bacteria 1515
137 Ga0075428_100391476 3300006844 Bacteria 1490
138 Ga0075428_100396294 3300006844 Bacteria 1480
139 Ga0075428_100426239 3300006844 Bacteria 1421
140 Ga0075428_100475539 3300006844 Bacteria 1337
141 Ga0075428_100488728 3300006844 Unclassified 1317
142 Ga0075428_100559239 3300006844 Unclassified 1223
143 Ga0075430_100035020 3300006846 Bacteria 4262
144 Ga0075430_100047111 3300006846 Unclassified 3639
145 Ga0075430_100054380 3300006846 Bacteria 3368
146 Ga0075430_100086401 3300006846 Bacteria 2625
147 Ga0075430_100187468 3300006846 Unclassified 1720
148 Ga0075430_100218921 3300006846 Bacteria 1580
149 Ga0075430_100252630 3300006846 Unclassified 1461
150 Ga0075430_100255543 3300006846 Bacteria 1452
151 Ga0075430_100257759 3300006846 Bacteria 1445
152 Ga0075430_100261773 3300006846 Bacteria 1432
153 Ga0075430_100292775 3300006846 Unclassified 1347
154 Ga0075430_100299740 3300006846 Bacteria 1329
155 Ga0075431_100113625 3300006847 Bacteria 2795
156 Ga0075431_100177989 3300006847 Bacteria 2183
157 Ga0075431_100196125 3300006847 Bacteria 2067
158 Ga0075431_100237197 3300006847 Bacteria 1856
159 Ga0075431_100243968 3300006847 Bacteria 1826
160 Ga0075431_100263224 3300006847 Bacteria 1750
161 Ga0075431_100266273 3300006847 Unclassified 1738
162 Ga0075431_100279784 3300006847 Bacteria 1689
163 Ga0075431_100316879 3300006847 Bacteria 1573
164 Ga0075431_100329352 3300006847 Unclassified 1538
165 Ga0075431_100334480 3300006847 Bacteria 1525
166 Ga0075431_100369475 3300006847 Bacteria 1440
167 Ga0075431_100373193 3300006847 Bacteria 1431
168 Ga0075431_100426156 3300006847 Bacteria 1325
169 Ga0075433_10277333 3300006852 Unclassified 1485
170 Ga0075433_10291098 3300006852 Bacteria 1446
171 Ga0075433_10300032 3300006852 Unclassified 1422
172 Ga0075433_10313295 3300006852 Bacteria 1389
173 Ga0075433_10344750 3300006852 Bacteria 1317
174 Ga0075433_10367940 3300006852 Bacteria 1270
175 Ga0075433_10393704 3300006852 Unclassified 1223
176 Ga0075434_100184803 3300006871 Unclassified 2105
177 Ga0075434_100239769 3300006871 Bacteria 1833
178 Ga0075434_100262130 3300006871 Bacteria 1747
179 Ga0075434_100272223 3300006871 Bacteria 1713
180 Ga0075434_100294771 3300006871 Bacteria 1642
181 Ga0075434_100422862 3300006871 Bacteria 1353
182 Ga0075434_100505358 3300006871 Archaea 1229
183 Ga0075429_100030688 3300006880 Bacteria 4669
184 Ga0075429_100081487 3300006880 Bacteria 2821
185 Ga0075429_100114039 3300006880 Bacteria 2362
186 Ga0075429_100138002 3300006880 Bacteria 2134
187 Ga0075429_100167682 3300006880 Bacteria 1923
188 Ga0075429_100174096 3300006880 Bacteria 1885
189 Ga0075429_100192685 3300006880 Bacteria 1786
190 Ga0075429_100198468 3300006880 Bacteria 1758
191 Ga0075429_100211444 3300006880 Unclassified 1699
192 Ga0075429_100278239 3300006880 Bacteria 1465
193 Ga0075429_100279692 3300006880 Bacteria 1461
194 Ga0075429_100284939 3300006880 Bacteria 1447
195 Ga0075429_100306773 3300006880 Unclassified 1390
196 Ga0075429_100347265 3300006880 Bacteria 1299
197 Ga0075429_100376235 3300006880 Unclassified 1243
198 Ga0068865_100240934 3300006881 Bacteria 1423
199 Ga0068865_100250372 3300006881 Unclassified 1398
200 Ga0075436_100166045 3300006914 Bacteria 1557
201 Ga0075436_100178461 3300006914 Unclassified 1500
202 Ga0097620_100427082 3300006931 Bacteria 1422
203 Ga0075435_100109188 3300007076 Bacteria 2299
204 Ga0075435_100182053 3300007076 Bacteria 1776
205 Ga0075435_100304253 3300007076 Unclassified 1364
206 Ga0075435_100306875 3300007076 Unclassified 1358
207 Ga0075435_100344161 3300007076 Bacteria 1278
208 Ga0099794_10018029 3300007265 Unclassified 3158
209 Ga0099794_10084420 3300007265 Bacteria 1570
210 Ga0105240_10377329 3300009093 Bacteria 1602
211 Ga0111539_10135612 3300009094 Bacteria 2883
212 Ga0111539_10194493 3300009094 Bacteria 2366
213 Ga0111539_10207377 3300009094 Bacteria 2284
214 Ga0111539_10266020 3300009094 Bacteria 1996
215 Ga0111539_10277560 3300009094 Unclassified 1950
216 Ga0111539_10292073 3300009094 Bacteria 1897
217 Ga0111539_10328411 3300009094 Bacteria 1780
218 Ga0111539_10340733 3300009094 Unclassified 1745
219 Ga0111539_10350574 3300009094 Bacteria 1718
220 Ga0111539_10444050 3300009094 Unclassified 1510
221 Ga0111539_10470499 3300009094 Bacteria 1463
222 Ga0111539_10484443 3300009094 Bacteria 1441
223 Ga0111539_10488965 3300009094 Unclassified 1433
224 Ga0111539_10520496 3300009094 Unclassified 1386
225 Ga0111539_10595765 3300009094 Bacteria 1287
226 Ga0105245_10185147 3300009098 Unclassified 1992
227 Ga0105245_10189526 3300009098 Bacteria 1969
228 Ga0105245_10292692 3300009098 Unclassified 1595
229 Ga0105245_10332509 3300009098 Bacteria 1500
230 Ga0114129_10188149 3300009147 Bacteria 2805
231 Ga0114129_10209485 3300009147 Bacteria 2636
232 Ga0114129_10243706 3300009147 Unclassified 2416
233 Ga0114129_10271198 3300009147 Bacteria 2270
234 Ga0114129_10272497 3300009147 Bacteria 2264
235 Ga0114129_10313919 3300009147 Bacteria 2086
236 Ga0114129_10316823 3300009147 Unclassified 2074
237 Ga0114129_10344519 3300009147 Bacteria 1975
238 Ga0114129_10354240 3300009147 Bacteria 1943
239 Ga0114129_10391532 3300009147 Bacteria 1833
240 Ga0114129_10414191 3300009147 Bacteria 1774
241 Ga0114129_10447390 3300009147 Bacteria 1695
242 Ga0114129_10538923 3300009147 Unclassified 1519
243 Ga0114129_10550828 3300009147 Unclassified 1500
244 Ga0114129_10575349 3300009147 Unclassified 1462
245 Ga0114129_10599503 3300009147 Unclassified 1427
246 Ga0114129_10736461 3300009147 Bacteria 1263
247 Ga0114129_10744201 3300009147 Unclassified 1256
248 Ga0114129_10761316 3300009147 Bacteria 1239
249 Ga0114129_10770198 3300009147 Bacteria 1230
250 Ga0105243_10225590 3300009148 Bacteria 1659
251 Ga0105237_10223308 3300009545 Bacteria 1884
252 Ga0105249_10040418 3300009553 Bacteria 4236
253 Ga0105249_10082855 3300009553 Bacteria 2984
254 Ga0105249_10103142 3300009553 Bacteria 2686
255 Ga0105249_10276547 3300009553 Unclassified 1675
256 Ga0105249_10286280 3300009553 Bacteria 1648
257 Ga0105249_10301847 3300009553 Bacteria 1606
258 Ga0105249_10325858 3300009553 Unclassified 1548
259 Ga0105249_10428343 3300009553 Bacteria 1358
260 Ga0105239_10300099 3300010375 Bacteria 1809
261 Ga0105246_10159643 3300011119 Bacteria 1716
262 Ga0105246_10183288 3300011119 Bacteria 1614
263 Ga0157324_1001442 3300012506 Bacteria 1314
264 Ga0157378_10359110 3300013297 Unclassified 1425
265 Ga0163162_10048868 3300013306 Unclassified 4239
266 Ga0163162_10301931 3300013306 Bacteria 1733
267 Ga0163162_10380240 3300013306 Bacteria 1545
268 Ga0163162_10385344 3300013306 Unclassified 1535
269 Ga0163162_10468651 3300013306 Bacteria 1391
270 Ga0157375_10087560 3300013308 Bacteria 3167
271 Ga0157375_10508606 3300013308 Bacteria 1368
272 Ga0163163_10353225 3300014325 Bacteria 1526
273 Ga0157380_10251223 3300014326 Bacteria 1601
274 Ga0157377_10099960 3300014745 Bacteria 1726
275 Ga0157379_10259244 3300014968 Bacteria 1580
276 Ga0157376_10341054 3300014969 Bacteria 1431
277 Ga0163161_10097646 3300017792 Bacteria 2182
278 Ga0163161_10171308 3300017792 Bacteria 1660
279 Ga0206356_10452140 3300020070 Bacteria 1628
280 Ga0206350_11538935 3300020080 Unclassified 1620
281 Ga0224712_10050766 3300022467 Bacteria 1613
282 Ga0207653_10056932 3300025885 Bacteria 1312
283 Ga0207642_10118396 3300025899 Bacteria 1362
284 Ga0207688_10016169 3300025901 Bacteria 4045
285 Ga0207688_10116542 3300025901 Unclassified 1555
286 Ga0207647_10159642 3300025904 Bacteria 1315
287 Ga0207643_10112425 3300025908 Bacteria 1605
288 Ga0207684_10163513 3300025910 Bacteria 1917
289 Ga0207684_10252292 3300025910 Bacteria 1522
290 Ga0207684_10289512 3300025910 Bacteria 1412
291 Ga0207684_10319141 3300025910 Unclassified 1339
292 Ga0207684_10384875 3300025910 Bacteria 1206
293 Ga0207695_10324062 3300025913 Bacteria 1430
294 Ga0207671_10219906 3300025914 Bacteria 1488
295 Ga0207663_10232485 3300025916 Bacteria 1348
296 Ga0207662_10046538 3300025918 Bacteria 2566
297 Ga0207646_10243422 3300025922 Bacteria 1625
298 Ga0207646_10387626 3300025922 Bacteria 1262
299 Ga0207681_10205613 3300025923 Bacteria 1514
300 Ga0207650_10238882 3300025925 Archaea 1468
301 Ga0207650_10312138 3300025925 Bacteria 1286
302 Ga0207687_10306538 3300025927 Bacteria 1281
303 Ga0207687_10320330 3300025927 Bacteria 1255
304 Ga0207706_10065226 3300025933 Bacteria 3206
305 Ga0207706_10174528 3300025933 Bacteria 1888
306 Ga0207706_10179793 3300025933 Unclassified 1858
307 Ga0207706_10305824 3300025933 Bacteria 1385
308 Ga0207670_10230660 3300025936 Bacteria 1422
309 Ga0207689_10134238 3300025942 Unclassified 2038
310 Ga0207712_10102494 3300025961 Bacteria 2131
311 Ga0207712_10125643 3300025961 Bacteria 1947
312 Ga0207712_10323275 3300025961 Bacteria 1274
313 Ga0207668_10334251 3300025972 Bacteria 1261
314 Ga0207677_10279693 3300026023 Bacteria 1369
315 Ga0207703_10410266 3300026035 Bacteria 1258
316 Ga0207708_10027329 3300026075 Unclassified 4319
317 Ga0207708_10234035 3300026075 Bacteria 1476
318 Ga0207648_10236693 3300026089 Bacteria 1625
319 Ga0207676_10343809 3300026095 Bacteria 1377
320 Ga0207675_100035730 3300026118 Bacteria 4635
321 Ga0207675_100225132 3300026118 Bacteria 1808
322 Ga0207675_100250767 3300026118 Bacteria 1713
323 Ga0207675_100272317 3300026118 Unclassified 1643
324 Ga0207675_100371289 3300026118 Bacteria 1405
325 Ga0207675_100376890 3300026118 Bacteria 1395
326 Ga0207428_10049433 3300027907 Bacteria 3370
327 Ga0207428_10079714 3300027907 Bacteria 2560
328 Ga0207428_10189130 3300027907 Unclassified 1553
329 Ga0207428_10206318 3300027907 Unclassified 1478
330 Ga0207428_10226711 3300027907 Bacteria 1399
331 Ga0207428_10251559 3300027907 Archaea 1318
332 Ga0207428_10259343 3300027907 Unclassified 1295
333 Ga0207428_10263904 3300027907 Unclassified 1282
334 Ga0207428_10263969 3300027907 Unclassified 1282
335 Ga0207428_10266794 3300027907 Unclassified 1274
336 Ga0207428_10273698 3300027907 Bacteria 1255
337 Ga0268265_10395017 3300028380 Bacteria 1276
338 Ga0268264_10218562 3300028381 Bacteria 1753
339 Ga0268264_10239967 3300028381 Bacteria 1678
340 Ga0268264_10360681 3300028381 Bacteria 1386
341 Ga0268264_10514274 3300028381 Unclassified 1169
342 Ga0265326_10040341 3300028558 Bacteria 1325
343 Ga0265323_10057317 3300028653 Bacteria 1363
344 Ga0265322_10009529 3300028654 Unclassified 2819
345 Ga0265322_10044659 3300028654 Bacteria 1261
346 Ga0265329_10044600 3300031242 Bacteria 1417
347 Ga0265327_10113525 3300031251 Bacteria 1291
348 Ga0265316_10135538 3300031344 Bacteria 1852
349 Ga0307408_100271403 3300031548 Unclassified 1408
350 Ga0307408_100282010 3300031548 Bacteria 1384
351 Ga0316579_10116700 3300031691 Unclassified 1281
352 Ga0316576_10101342 3300031727 Bacteria 2152
353 Ga0316577_10096998 3300031733 Bacteria 1651
354 Ga0316577_10175352 3300031733 Bacteria 1210
355 Ga0307413_10155688 3300031824 Unclassified 1598
356 Ga0307413_10243667 3300031824 Bacteria 1329
357 Ga0307410_10225319 3300031852 Bacteria 1444
358 Ga0307410_10258237 3300031852 Bacteria 1358
359 Ga0307410_10295853 3300031852 Unclassified 1275
360 Ga0307410_10359232 3300031852 Unclassified 1166
361 Ga0307406_10165814 3300031901 Bacteria 1593
362 Ga0307406_10221102 3300031901 Bacteria 1407
363 Ga0307407_10179157 3300031903 Unclassified 1403
364 Ga0307407_10216808 3300031903 Unclassified 1291
365 Ga0307412_10207422 3300031911 Bacteria 1493
366 Ga0307409_100064746 3300031995 Unclassified 2873
367 Ga0307409_100302609 3300031995 Unclassified 1488
368 Ga0307409_100400079 3300031995 Bacteria 1311
369 Ga0307409_100417231 3300031995 Unclassified 1286
370 Ga0307416_100415505 3300032002 Unclassified 1387
371 Ga0307416_100418275 3300032002 Unclassified 1383
372 Ga0307416_100492352 3300032002 Unclassified 1288
373 Ga0307416_100522604 3300032002 Unclassified 1255
374 Ga0307414_10177622 3300032004 Bacteria 1709
375 Ga0307414_10338167 3300032004 Unclassified 1287
376 Ga0307414_10374971 3300032004 Unclassified 1228
377 Ga0307411_10254647 3300032005 Bacteria 1382
378 Ga0307415_100268504 3300032126 Bacteria 1396
379 Ga0307415_100287042 3300032126 Unclassified 1356
380 Ga0307415_100343599 3300032126 Bacteria 1253
381 Ga0307415_100352686 3300032126 Bacteria 1239
382 Ga0373948_0024183 3300034817 Unclassified 1184
383 Ga0373958_0007932 3300034819 Unclassified 1706
384 Ga0373929_0025322 3300035085 Unclassified 1231
385 Ga0373939_0033271 3300035114 Unclassified 1504
386 Ga0373939_0060727 3300035114 Bacteria 1202
387 Ga0373962_0051117 3300035242 Unclassified 1192
388 Ga0316574_0117106 3300035398 Unclassified 1709
389 Ga0316582_0115575 3300036647 Bacteria 1790
390 Ga0316582_0192297 3300036647 Unclassified 1390
391 Ga0316582_0202193 3300036647 Bacteria 1355
392 Ga0316584_0129294 3300036712 Bacteria 1886
393 Ga0316584_0205383 3300036712 Bacteria 1452
394 Ga0316584_0278722 3300036712 Unclassified 1215
395 Ga0316584_0337504 3300036712 Unclassified 1084
396 Ga0395900_0379041 3300037418 Bacteria 1383
397 Ga0395905_0098016 3300037471 Bacteria 2753
398 Ga0395901_0449332 3300038443 Bacteria 1318
399 Ga0400490_32959 3300038726 Unclassified 1364
400 Ga0400488_01064 3300038741 Bacteria 1481
401 Ga0400488_02457 3300038741 Bacteria 2561
402 Ga0242420_011479 3300038996 Bacteria 1487
403 Ga0400483_017133 3300039062 Unclassified 1172
404 Ga0400483_132929 3300039062 Unclassified 2807
405 Ga0400483_197280 3300039062 Bacteria 1805
406 Ga0400483_214141 3300039062 Unclassified 1644
407 Ga0400489_10039 3300039093 Bacteria 1398
408 Ga0400489_21675 3300039093 Bacteria 2653
409 Ga0400487_52752 3300039110 Bacteria 1545
410 Ga0400487_53805 3300039110 Bacteria 1558
411 Ga0436362_0433787 3300039453 Bacteria 1722
412 Ga0439447_034592 3300041407 Bacteria 1255
413 Ga0439443_006102 3300042003 Unclassified 1637
414 Ga0439443_008142 3300042003 Unclassified 1472
415 Ga0439443_009215 3300042003 Unclassified 1411
416 Ga0439448_0011339 3300042005 Bacteria 2656
417 Ga0439448_0028073 3300042005 Unclassified 1775
418 Ga0439448_0035428 3300042005 Bacteria 1598
419 Ga0439448_0045357 3300042005 Unclassified 1430
420 Ga0439448_0047303 3300042005 Unclassified 1403
421 Ga0439448_0053099 3300042005 Unclassified 1329
422 Ga0439450_001474 3300042008 Bacteria 3456
423 Ga0439450_003051 3300042008 Bacteria 2721
424 Ga0439450_003971 3300042008 Bacteria 2490
425 Ga0439450_017945 3300042008 Unclassified 1481
426 Ga0439450_025034 3300042008 Unclassified 1305
427 Ga0439454_001057 3300042011 Bacteria 2498
428 Ga0439454_009929 3300042011 Unclassified 1245
429 Ga0439463_014820 3300042016 Bacteria 1925
430 Ga0439463_019755 3300042016 Bacteria 1679
431 Ga0439463_024096 3300042016 Bacteria 1524
432 Ga0439463_024626 3300042016 Bacteria 1508
433 Ga0439463_026327 3300042016 Archaea 1461
434 Ga0439463_026803 3300042016 Unclassified 1449
435 Ga0450923_017903 3300042125 Bacteria 1350
436 Ga0450900_002950 3300042136 Bacteria 1848
437 Ga0450900_008075 3300042136 Unclassified 1308
438 Ga0450905_006746 3300042142 Bacteria 1556
439 Ga0450906_021414 3300042145 Bacteria 1155
440 Ga0450908_016235 3300042184 Bacteria 1329
441 Ga0439444_0005389 3300042437 Unclassified 1896
442 Ga0439444_0009605 3300042437 Bacteria 1528
443 Ga0439444_0009871 3300042437 Bacteria 1513
444 Ga0439444_0012998 3300042437 Unclassified 1373
445 Ga0439444_0017317 3300042437 Unclassified 1235
446 Ga0439464_0023973 3300042439 Bacteria 1686
447 Ga0439464_0039545 3300042439 Unclassified 1341
448 Ga0439464_0051313 3300042439 Unclassified 1193
449 Ga0439460_0020842 3300042461 Bacteria 1785
450 Ga0439460_0035990 3300042461 Bacteria 1434
451 Ga0439460_0037036 3300042461 Unclassified 1417
452 Ga0439460_0039851 3300042461 Unclassified 1374
453 Ga0439460_0043405 3300042461 Unclassified 1328
454 Ga0439460_0047747 3300042461 Unclassified 1275
455 Ga0450916_005407 3300042530 Bacteria 1476
456 Ga0450918_017355 3300042531 Bacteria 1252
457 Ga0450901_006407 3300042533 Bacteria 1210
458 Ga0439440_0004951 3300042993 Unclassified 2629
459 Ga0439440_0016231 3300042993 Unclassified 1626
460 Ga0439440_0020380 3300042993 Unclassified 1486
461 Ga0439440_0026952 3300042993 Unclassified 1332
462 Ga0439440_0028023 3300042993 Bacteria 1312
463 Ga0439440_0029336 3300042993 Unclassified 1289
464 Ga0439440_0030534 3300042993 Unclassified 1269
465 Ga0466969_0080112 3300044656 Unclassified 1560
466 Ga0453683_0134582 3300044673 Bacteria 1558
467 Ga0453683_0163990 3300044673 Unclassified 1406
468 Ga0466966_0143972 3300044684 Bacteria 1455
469 Ga0466968_0030029 3300044735 Bacteria 2250
470 Ga0466970_0128606 3300044765 Bacteria 1390
471 Ga0466959_0269570 3300045049 Unclassified 1170
472 Ga0451576_0525403 3300045051 Bacteria 1243
473 Ga0466958_0126544 3300045836 Bacteria 1602
474 Ga0466967_0330733 3300045976 Bacteria 1471
475 Ga0495584_0111497 3300046491 Unclassified 1384
476 Ga0495584_0113609 3300046491 Bacteria 1370
477 Ga0495596_0065073 3300046500 Bacteria 1418
478 Ga0495607_0109187 3300046501 Unclassified 1469
479 Ga0495607_0135055 3300046501 Bacteria 1278
480 Ga0495616_0026051 3300046513 Bacteria 3117
481 Ga0495631_0030113 3300046518 Unclassified 2464
482 Ga0495644_0059718 3300046523 Bacteria 1433
483 Ga0495644_0076805 3300046523 Bacteria 1258
484 Ga0495663_0007305 3300046525 Bacteria 3050
485 Ga0495663_0033455 3300046525 Bacteria 1535
486 Ga0495663_0056424 3300046525 Unclassified 1226
487 Ga0495598_0032512 3300046537 Unclassified 1474
488 Ga0495598_0037494 3300046537 Bacteria 1398
489 Ga0495621_0071139 3300046539 Unclassified 1281
490 Ga0495597_0092377 3300046542 Bacteria 1283
491 Ga0495633_0110478 3300046558 Bacteria 1274
492 Ga0495656_0015833 3300046615 Plasmid 2853
493 Ga0495656_0058378 3300046615 Bacteria 1674
494 Ga0495656_0101936 3300046615 Unclassified 1329
495 Ga0495656_0104674 3300046615 Bacteria 1314
496 Ga0495656_0113134 3300046615 Unclassified 1272
497 Ga0495668_0138997 3300046616 Bacteria 1329
498 Ga0495668_0171303 3300046616 Bacteria 1189
499 Ga0495611_0079926 3300046648 Bacteria 1502
500 Ga0495611_0101827 3300046648 Unclassified 1334
501 Ga0495659_0055660 3300046664 Unclassified 1450
502 Ga0495661_0095698 3300046665 Bacteria 1680
503 Ga0495661_0138659 3300046665 Unclassified 1325
504 Ga0495670_0099949 3300046691 Bacteria 1493
505 Ga0495670_0139450 3300046691 Bacteria 1267
506 Ga0495636_0100772 3300047318 Bacteria 1262
507 Ga0495677_0055739 3300047445 Bacteria 1459
508 Ga0495677_0062561 3300047445 Unclassified 1381
509 Ga0495677_0068333 3300047445 Bacteria 1322
510 Ga0495685_065270 3300047447 Unclassified 1223
511 Ga0496102_0277086 3300048905 Bacteria 1581
512 Ga0496110_0063641 3300048913 Bacteria 3259
513 Ga0496111_0100076 3300048914 Bacteria 2129
514 Ga0501298_018058 3300049521 Unclassified 1293
515 Ga0501036_0053550 3300049572 Bacteria 3417
516 Ga0501038_0283719 3300049574 Unclassified 1303
517 Ga0501039_0156457 3300049575 Unclassified 1790
518 Ga0501041_0058331 3300049577 Unclassified 2361
519 Ga0501042_0019192 3300049578 Bacteria 4744
520 Ga0501042_0248662 3300049578 Bacteria 1283
521 Ga0501046_0136322 3300049580 Unclassified 1859
522 Ga0501046_0181803 3300049580 Unclassified 1572
523 Ga0501048_0132949 3300049582 Bacteria 1758
524 Ga0501048_0197686 3300049582 Bacteria 1425
525 Ga0501071_0304052 3300049587 Unclassified 1209
526 Ga0501072_0071887 3300049588 Unclassified 2733
527 Ga0501072_0334398 3300049588 Bacteria 1203
528 Ga0501074_0215813 3300049590 Unclassified 1366
529 Ga0501075_0195805 3300049591 Unclassified 1541
530 Ga0501075_0267599 3300049591 Unclassified 1302
531 Ga0501076_0276062 3300049592 Unclassified 1376
532 Ga0501076_0362753 3300049592 Bacteria 1190
533 Ga0501077_0065439 3300049593 Bacteria 2305
534 Ga0501077_0186071 3300049593 Bacteria 1319
535 Ga0501077_0188778 3300049593 Bacteria 1309
536 Ga0501216_016090 3300049660 Unclassified 1266
537 Ga0501240_011677 3300049673 Unclassified 1187
538 Ga0501243_013018 3300049675 Bacteria 1317
539 Ga0501249_021889 3300049679 Unclassified 1397
540 Ga0501251_005346 3300049681 Unclassified 1360
541 Ga0501253_016510 3300049683 Unclassified 1230
542 Ga0501255_005284 3300049684 Unclassified 1283
543 Ga0501256_003700 3300049685 Unclassified 1283
544 Ga0501259_016264 3300049688 Unclassified 1277
545 Ga0501221_007776 3300049704 Unclassified 1848
546 Ga0501225_0034722 3300049705 Unclassified 1388
547 Ga0501245_015317 3300049708 Unclassified 1152
548 Ga0501079_0292334 3300049741 Unclassified 1274
549 Ga0501079_0307860 3300049741 Bacteria 1239
550 Ga0501080_0311602 3300049742 Bacteria 1426
551 Ga0501080_0368988 3300049742 Bacteria 1294
552 Ga0501081_0225227 3300049743 Unclassified 1364
553 Ga0501081_0236349 3300049743 Bacteria 1332
554 Ga0501081_0329962 3300049743 Unclassified 1122
555 Ga0501264_004496 3300049761 Unclassified 1264
556 Ga0501265_003790 3300049762 Bacteria 1717
557 Ga0501276_002468 3300049773 Unclassified 1303
558 Ga0501280_008729 3300049776 Bacteria 1411
559 Ga0501283_012308 3300049779 Unclassified 1284
560 Ga0501035_0203058 3300049822 Bacteria 1699
561 Ga0501045_0228987 3300049824 Unclassified 1383
562 Ga0501045_0251598 3300049824 Bacteria 1315
563 nmdc:mga05p37_165322_c1 3300050507 Bacteria 2701
564 nmdc:mga05p37_180802_c1 3300050507 Bacteria 2566
565 nmdc:mga05p37_183084_c1 3300050507 Bacteria 2548
566 nmdc:mga05p37_192828_c1 3300050507 Bacteria 2473
567 nmdc:mga05p37_199905_c1 3300050507 Bacteria 2422
568 nmdc:mga05p37_221074_c1 3300050507 Unclassified 2286
569 nmdc:mga05p37_23339_c1 3300050507 Bacteria 7506
570 nmdc:mga05p37_262614_c1 3300050507 Bacteria 2066
571 nmdc:mga05p37_333694_c1 3300050507 Bacteria 1790
572 nmdc:mga05p37_343995_c1 3300050507 Bacteria 1758
573 nmdc:mga05p37_376444_c1 3300050507 Bacteria 1665
574 nmdc:mga05p37_390546_c1 3300050507 Bacteria 1628
575 nmdc:mga05p37_42564_c1 3300050507 Bacteria 5581
576 nmdc:mga05p37_429262_c1 3300050507 Bacteria 1536
577 nmdc:mga05p37_443510_c1 3300050507 Unclassified 1505
578 nmdc:mga05p37_446176_c1 3300050507 Unclassified 1499
579 nmdc:mga05p37_487721_c1 3300050507 Bacteria 1418
580 nmdc:mga05p37_495579_c1 3300050507 Unclassified 1404
581 nmdc:mga05p37_501609_c1 3300050507 Bacteria 1393
582 nmdc:mga05p37_520572_c1 3300050507 Bacteria 1361
583 nmdc:mga05p37_529384_c1 3300050507 Unclassified 1346
584 nmdc:mga05p37_55997_c1 3300050507 Unclassified 4854
585 nmdc:mga05p37_574122_c1 3300050507 Archaea 1279
586 nmdc:mga05p37_575219_c1 3300050507 Unclassified 1277
587 nmdc:mga05p37_583180_c1 3300050507 Bacteria 1266
588 nmdc:mga05p37_615841_c1 3300050507 Bacteria 1223
589 nmdc:mga05p37_655509_c1 3300050507 Unclassified 1175
590 nmdc:mga05p37_72061_c1 3300050507 Bacteria 4251
591 nmdc:mga05p37_803699_c1 3300050507 Unclassified 1029
592 nmdc:mga05p37_92982_c1 3300050507 Plasmid 3716
593 nmdc:mga09592_165391_c1 3300050508 Bacteria 1912
594 nmdc:mga09592_172768_c1 3300050508 Bacteria 1869
595 nmdc:mga09592_19965_c1 3300050508 Bacteria 5504
596 nmdc:mga09592_272598_c1 3300050508 Unclassified 1468
597 nmdc:mga09592_283165_c1 3300050508 Bacteria 1438
598 nmdc:mga09592_294282_c1 3300050508 Unclassified 1408
599 nmdc:mga09592_296221_c1 3300050508 Unclassified 1403
600 nmdc:mga09592_313772_c1 3300050508 Bacteria 1359
601 nmdc:mga09592_352471_c1 3300050508 Unclassified 1274
602 nmdc:mga09592_359200_c1 3300050508 Bacteria 1261
603 nmdc:mga09592_366913_c1 3300050508 Archaea 1246
604 nmdc:mga09592_380284_c1 3300050508 Bacteria 1221
605 nmdc:mga09592_40609_c1 3300050508 Bacteria 3909
606 nmdc:mga09592_41669_c1 3300050508 Bacteria 3861
607 nmdc:mga09592_45642_c1 3300050508 Bacteria 3691
608 nmdc:mga09592_84120_c1 3300050508 Bacteria 2713
609 nmdc:mga09592_98664_c1 3300050508 Bacteria 2501
610 nmdc:mga0qj67_103698_c1 3300050509 Bacteria 2295
611 nmdc:mga0qj67_130563_c1 3300050509 Bacteria 2035
612 nmdc:mga0qj67_156982_c1 3300050509 Unclassified 1847
613 nmdc:mga0qj67_167567_c1 3300050509 Bacteria 1784
614 nmdc:mga0qj67_194592_c1 3300050509 Unclassified 1648
615 nmdc:mga0qj67_239541_c1 3300050509 Bacteria 1472
616 nmdc:mga0qj67_278600_c1 3300050509 Unclassified 1356
617 nmdc:mga0qj67_286202_c1 3300050509 Bacteria 1336
618 nmdc:mga0qj67_296352_c1 3300050509 Bacteria 1311
619 nmdc:mga0qj67_307258_c1 3300050509 Unclassified 1285
620 nmdc:mga0qj67_320557_c1 3300050509 Bacteria 1255
621 nmdc:mga0qj67_434564_c1 3300050509 Bacteria 1058
622 nmdc:mga0qj67_83425_c1 3300050509 Bacteria 2562
623 nmdc:mga06r32_121521_c1 3300050510 Bacteria 2577
624 nmdc:mga06r32_125337_c1 3300050510 Plasmid 2536
625 nmdc:mga06r32_14847_c1 3300050510 Bacteria 7066
626 nmdc:mga06r32_178309_c1 3300050510 Unclassified 2110
627 nmdc:mga06r32_178804_c1 3300050510 Bacteria 2107
628 nmdc:mga06r32_203225_c1 3300050510 Unclassified 1969
629 nmdc:mga06r32_249733_c1 3300050510 Bacteria 1762
630 nmdc:mga06r32_283801_c1 3300050510 Bacteria 1643
631 nmdc:mga06r32_284712_c1 3300050510 Bacteria 1640
632 nmdc:mga06r32_296950_c1 3300050510 Bacteria 1602
633 nmdc:mga06r32_307861_c1 3300050510 Bacteria 1570
634 nmdc:mga06r32_372693_c1 3300050510 Bacteria 1411
635 nmdc:mga06r32_409520_c1 3300050510 Unclassified 1338
636 nmdc:mga06r32_414439_c1 3300050510 Bacteria 1329
637 nmdc:mga06r32_415492_c1 3300050510 Bacteria 1327
638 nmdc:mga06r32_439241_c1 3300050510 Unclassified 1285
639 nmdc:mga06r32_46589_c1 3300050510 Bacteria 4138
640 nmdc:mga06r32_5955_c1 3300050510 Bacteria 10973
641 nmdc:mga08y16_100612_c1 3300050511 Bacteria 3010
642 nmdc:mga08y16_108221_c1 3300050511 Unclassified 2894
643 nmdc:mga08y16_168985_c1 3300050511 Bacteria 2272
644 nmdc:mga08y16_228546_c1 3300050511 Bacteria 1925
645 nmdc:mga08y16_229352_c1 3300050511 Bacteria 1921
646 nmdc:mga08y16_336654_c1 3300050511 Bacteria 1552
647 nmdc:mga08y16_424933_c1 3300050511 Unclassified 1358
648 nmdc:mga08y16_453416_c1 3300050511 Unclassified 1308
649 nmdc:mga08y16_471211_c1 3300050511 Archaea 1279
650 nmdc:mga08y16_501066_c1 3300050511 Bacteria 1234
651 nmdc:mga08y16_83689_c1 3300050511 Unclassified 3325
652 nmdc:mga08y16_97863_c1 3300050511 Bacteria 3056
653 nmdc:mga0n895_176930_c1 3300050512 Bacteria 2165
654 nmdc:mga0n895_202070_c1 3300050512 Bacteria 2018
655 nmdc:mga0n895_354119_c1 3300050512 Unclassified 1487
656 nmdc:mga0n895_386417_c1 3300050512 Bacteria 1416
657 nmdc:mga0n895_393627_c1 3300050512 Unclassified 1402
658 nmdc:mga0n895_425973_c1 3300050512 Bacteria 1341
659 nmdc:mga0n895_436718_c1 3300050512 Bacteria 1323
660 nmdc:mga0n895_488941_c1 3300050512 Unclassified 1241
661 nmdc:mga0n895_518322_c1 3300050512 Bacteria 1200
662 nmdc:mga0n895_82417_c1 3300050512 Bacteria 3207
663 nmdc:mga0rr50_194531_c1 3300050513 Bacteria 1664
664 nmdc:mga0rr50_323620_c1 3300050513 Unclassified 1293
665 nmdc:mga0rr50_344451_c1 3300050513 Bacteria 1253
666 nmdc:mga0rr50_86499_c1 3300050513 Bacteria 2432
667 nmdc:mga08x19_210152_c1 3300050514 Bacteria 1336
668 nmdc:mga08x19_225142_c1 3300050514 Archaea 1290
669 nmdc:mga0a205_168227_c1 3300050515 Bacteria 2088
670 nmdc:mga0a205_170572_c1 3300050515 Unclassified 2072
671 nmdc:mga0a205_195852_c1 3300050515 Unclassified 1912
672 nmdc:mga0a205_273556_c1 3300050515 Archaea 1566
673 nmdc:mga0a205_278341_c1 3300050515 Unclassified 1549
674 nmdc:mga0a205_301519_c1 3300050515 Bacteria 1475
675 nmdc:mga0a205_309617_c1 3300050515 Bacteria 1452
676 nmdc:mga0a205_320543_c1 3300050515 Unclassified 1421
677 nmdc:mga0a205_350161_c1 3300050515 Bacteria 1345
678 nmdc:mga0a205_355963_c1 3300050515 Bacteria 1331
679 nmdc:mga0a205_79896_c1 3300050515 Bacteria 3161
680 Ga0501084_0209127 3300054114 Bacteria 1646
681 Ga0501084_0227119 3300054114 Bacteria 1575
682 Ga0501084_0407909 3300054114 Bacteria 1148
683 Ga0501082_0303508 3300060353 Unclassified 1390
684 Ga0501082_0331748 3300060353 Bacteria 1325
685 Ga0501082_0422209 3300060353 Unclassified 1164
686 Ga0530510_0158696 3300061734 Unclassified 1672
687 Ga0530510_0271087 3300061734 Unclassified 1266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10018029 Ga0099794_100180291 298
2 3300050507 nmdc:mga05p37_165322_c1 nmdc:mga05p37_165322_c1_1736_2686 298
3 3300009147 Ga0114129_10538923 Ga0114129_105389231 299
4 3300042145 Ga0450906_021414 Ga0450906_021414_164_1117 299
5 3300050507 nmdc:mga05p37_803699_c1 nmdc:mga05p37_803699_c1_23_976 299
6 3300050508 nmdc:mga09592_84120_c1 nmdc:mga09592_84120_c1_23_976 299
7 3300003373 JGI25407J50210_10035173 JGI25407J50210_100351731 303
8 3300005367 Ga0070667_100118780 Ga0070667_1001187802 303
9 3300005471 Ga0070698_100071599 Ga0070698_1000715992 303
10 3300005981 Ga0081538_10012461 Ga0081538_100124616 303
11 3300031852 Ga0307410_10258237 Ga0307410_102582371 306
12 3300009147 Ga0114129_10550828 Ga0114129_105508281 309
13 3300005719 Ga0068861_100378608 Ga0068861_1003786081 310
14 3300050507 nmdc:mga05p37_443510_c1 nmdc:mga05p37_443510_c1_270_1256 310
15 3300050508 nmdc:mga09592_98664_c1 nmdc:mga09592_98664_c1_128_1114 310
16 3300050509 nmdc:mga0qj67_194592_c1 nmdc:mga0qj67_194592_c1_93_1079 310
17 3300050509 nmdc:mga0qj67_296352_c1 nmdc:mga0qj67_296352_c1_29_1015 310
18 3300050510 nmdc:mga06r32_307861_c1 nmdc:mga06r32_307861_c1_343_1329 310
19 3300050511 nmdc:mga08y16_108221_c1 nmdc:mga08y16_108221_c1_314_1300 310
20 3300009147 Ga0114129_10736461 Ga0114129_107364612 311
21 3300027907 Ga0207428_10049433 Ga0207428_100494332 315
22 3300054114 Ga0501084_0407909 Ga0501084_0407909_80_1081 315
23 3300007076 Ga0075435_100306875 Ga0075435_1003068752 316
24 3300050507 nmdc:mga05p37_55997_c1 nmdc:mga05p37_55997_c1_3021_4010 316
25 3300050509 nmdc:mga0qj67_434564_c1 nmdc:mga0qj67_434564_c1_37_1041 316
26 3300050515 nmdc:mga0a205_301519_c1 nmdc:mga0a205_301519_c1_87_1091 316
27 3300060353 Ga0501082_0422209 Ga0501082_0422209_112_1116 316
28 3300005471 Ga0070698_100439755 Ga0070698_1004397551 319
29 3300006058 Ga0075432_10011272 Ga0075432_100112722 321
30 3300006194 Ga0075427_10006062 Ga0075427_100060621 321
31 3300006846 Ga0075430_100299740 Ga0075430_1002997401 321
32 3300006847 Ga0075431_100196125 Ga0075431_1001961252 321
33 3300006871 Ga0075434_100239769 Ga0075434_1002397691 321
34 3300006880 Ga0075429_100174096 Ga0075429_1001740963 321
35 3300039062 Ga0400483_017133 Ga0400483_017133_141_1160 321
36 3300005440 Ga0070705_100182581 Ga0070705_1001825812 323
37 3300005578 Ga0068854_100287735 Ga0068854_1002877352 323
38 3300025925 Ga0207650_10238882 Ga0207650_102388821 323
39 3300042437 Ga0439444_0005389 Ga0439444_0005389_792_1838 323
40 3300050507 nmdc:mga05p37_192828_c1 nmdc:mga05p37_192828_c1_277_1347 323
41 3300050512 nmdc:mga0n895_354119_c1 nmdc:mga0n895_354119_c1_430_1455 323
42 3300036647 Ga0316582_0202193 Ga0316582_0202193_123_1157 325
43 3300036712 Ga0316584_0205383 Ga0316584_0205383_309_1343 325
44 3300009094 Ga0111539_10277560 Ga0111539_102775602 327
45 3300009147 Ga0114129_10272497 Ga0114129_102724973 327
46 3300009147 Ga0114129_10414191 Ga0114129_104141912 327
47 3300009147 Ga0114129_10770198 Ga0114129_107701981 327
48 3300037418 Ga0395900_0379041 Ga0395900_0379041_197_1234 327
49 3300042005 Ga0439448_0035428 Ga0439448_0035428_301_1338 327
50 3300042016 Ga0439463_019755 Ga0439463_019755_438_1475 327
51 3300044673 Ga0453683_0134582 Ga0453683_0134582_457_1494 327
52 3300050507 nmdc:mga05p37_376444_c1 nmdc:mga05p37_376444_c1_252_1289 327
53 3300050507 nmdc:mga05p37_501609_c1 nmdc:mga05p37_501609_c1_109_1146 327
54 3300050507 nmdc:mga05p37_72061_c1 nmdc:mga05p37_72061_c1_669_1706 327
55 3300050512 nmdc:mga0n895_386417_c1 nmdc:mga0n895_386417_c1_198_1235 327
56 3300050512 nmdc:mga0n895_425973_c1 nmdc:mga0n895_425973_c1_261_1298 327
57 3300050513 nmdc:mga0rr50_194531_c1 nmdc:mga0rr50_194531_c1_331_1368 327
58 3300050514 nmdc:mga08x19_210152_c1 nmdc:mga08x19_210152_c1_119_1156 327
59 3300050515 nmdc:mga0a205_195852_c1 nmdc:mga0a205_195852_c1_225_1262 327
60 3300050515 nmdc:mga0a205_355963_c1 nmdc:mga0a205_355963_c1_204_1241 327
61 3300005331 Ga0070670_100288357 Ga0070670_1002883571 328
62 3300025925 Ga0207650_10312138 Ga0207650_103121382 328
63 3300036712 Ga0316584_0337504 Ga0316584_0337504_18_1058 328
64 3300009147 Ga0114129_10316823 Ga0114129_103168232 329
65 3300048913 Ga0496110_0063641 Ga0496110_0063641_393_1436 329
66 3300048914 Ga0496111_0100076 Ga0496111_0100076_734_1777 329
67 3300050515 nmdc:mga0a205_350161_c1 nmdc:mga0a205_350161_c1_129_1172 329
68 3300038726 Ga0400490_32959 Ga0400490_32959_24_1073 330
69 3300039093 Ga0400489_10039 Ga0400489_10039_216_1265 330
70 3300005983 Ga0081540_1013776 Ga0081540_10137763 331
71 3300020070 Ga0206356_10452140 Ga0206356_104521402 331
72 3300020080 Ga0206350_11538935 Ga0206350_115389351 331
73 3300022467 Ga0224712_10050766 Ga0224712_100507662 331
74 3300049743 Ga0501081_0329962 Ga0501081_0329962_26_1075 331
75 3300050509 nmdc:mga0qj67_239541_c1 nmdc:mga0qj67_239541_c1_54_1103 331
76 3300005981 Ga0081538_10037776 Ga0081538_100377762 332
77 3300005985 Ga0081539_10106527 Ga0081539_101065271 335
78 3300037471 Ga0395905_0098016 Ga0395905_0098016_1550_2626 338
79 3300038443 Ga0395901_0449332 Ga0395901_0449332_82_1158 338
80 3300031727 Ga0316576_10101342 Ga0316576_101013422 340
81 3300031733 Ga0316577_10096998 Ga0316577_100969981 340
82 3300031852 Ga0307410_10359232 Ga0307410_103592321 340
83 3300035398 Ga0316574_0117106 Ga0316574_0117106_305_1381 340
84 3300036647 Ga0316582_0192297 Ga0316582_0192297_179_1255 340
85 3300036712 Ga0316584_0129294 Ga0316584_0129294_153_1229 340
86 3300036712 Ga0316584_0278722 Ga0316584_0278722_113_1189 340
87 3300050510 nmdc:mga06r32_284712_c1 nmdc:mga06r32_284712_c1_403_1563 340
88 3300003316 rootH1_10150326 rootH1_101503261 341
89 3300003323 rootH1_10094301 rootH1_100943011 341
90 3300005937 Ga0081455_10025104 Ga0081455_100251042 341
91 3300005937 Ga0081455_10057992 Ga0081455_100579921 341
92 3300005981 Ga0081538_10021253 Ga0081538_100212534 341
93 3300005981 Ga0081538_10093472 Ga0081538_100934722 341
94 3300005981 Ga0081538_10111158 Ga0081538_101111581 341
95 3300005983 Ga0081540_1031413 Ga0081540_10314131 341
96 3300005985 Ga0081539_10061593 Ga0081539_100615931 341
97 3300005985 Ga0081539_10065151 Ga0081539_100651512 341
98 3300006844 Ga0075428_100488728 Ga0075428_1004887281 341
99 3300006846 Ga0075430_100187468 Ga0075430_1001874682 341
100 3300006846 Ga0075430_100218921 Ga0075430_1002189213 341
101 3300006847 Ga0075431_100426156 Ga0075431_1004261562 341
102 3300006880 Ga0075429_100198468 Ga0075429_1001984682 341
103 3300006880 Ga0075429_100347265 Ga0075429_1003472652 341
104 3300007076 Ga0075435_100344161 Ga0075435_1003441611 341
105 3300009094 Ga0111539_10266020 Ga0111539_102660201 341
106 3300009147 Ga0114129_10761316 Ga0114129_107613161 341
107 3300014745 Ga0157377_10099960 Ga0157377_100999601 341
108 3300027907 Ga0207428_10079714 Ga0207428_100797142 341
109 3300028558 Ga0265326_10040341 Ga0265326_100403411 341
110 3300028653 Ga0265323_10057317 Ga0265323_100573172 341
111 3300028654 Ga0265322_10044659 Ga0265322_100446591 341
112 3300031242 Ga0265329_10044600 Ga0265329_100446001 341
113 3300031344 Ga0265316_10135538 Ga0265316_101355383 341
114 3300031691 Ga0316579_10116700 Ga0316579_101167001 341
115 3300031824 Ga0307413_10243667 Ga0307413_102436671 341
116 3300031911 Ga0307412_10207422 Ga0307412_102074222 341
117 3300032002 Ga0307416_100415505 Ga0307416_1004155051 341
118 3300032004 Ga0307414_10177622 Ga0307414_101776221 341
119 3300032126 Ga0307415_100343599 Ga0307415_1003435991 341
120 3300035114 Ga0373939_0060727 Ga0373939_0060727_57_1136 341
121 3300036647 Ga0316582_0115575 Ga0316582_0115575_473_1552 341
122 3300050507 nmdc:mga05p37_390546_c1 nmdc:mga05p37_390546_c1_428_1588 341
123 3300050508 nmdc:mga09592_41669_c1 nmdc:mga09592_41669_c1_697_1857 341
124 3300050509 nmdc:mga0qj67_320557_c1 nmdc:mga0qj67_320557_c1_44_1204 341
125 3300050511 nmdc:mga08y16_168985_c1 nmdc:mga08y16_168985_c1_323_1483 341
126 3300050512 nmdc:mga0n895_202070_c1 nmdc:mga0n895_202070_c1_803_1963 341
127 3300050513 nmdc:mga0rr50_344451_c1 nmdc:mga0rr50_344451_c1_76_1236 341
128 3300050515 nmdc:mga0a205_79896_c1 nmdc:mga0a205_79896_c1_160_1320 341
129 3300038741 Ga0400488_01064 Ga0400488_01064_261_1361 342
130 3300039062 Ga0400483_132929 Ga0400483_132929_273_1364 342
131 3300039062 Ga0400483_197280 Ga0400483_197280_236_1336 342
132 3300039062 Ga0400483_214141 Ga0400483_214141_156_1247 342
133 3300039093 Ga0400489_21675 Ga0400489_21675_1212_2312 342
134 3300039110 Ga0400487_53805 Ga0400487_53805_301_1401 342
135 3300005295 Ga0065707_10032764 Ga0065707_100327641 343
136 3300005467 Ga0070706_100195608 Ga0070706_1001956081 343
137 3300005468 Ga0070707_100414516 Ga0070707_1004145161 343
138 3300005614 Ga0068856_100102883 Ga0068856_1001028833 343
139 3300005981 Ga0081538_10116598 Ga0081538_101165982 343
140 3300006852 Ga0075433_10291098 Ga0075433_102910982 343
141 3300006852 Ga0075433_10367940 Ga0075433_103679401 343
142 3300006871 Ga0075434_100184803 Ga0075434_1001848032 343
143 3300009094 Ga0111539_10520496 Ga0111539_105204962 343
144 3300009553 Ga0105249_10040418 Ga0105249_100404187 343
145 3300025910 Ga0207684_10319141 Ga0207684_103191411 343
146 3300028654 Ga0265322_10009529 Ga0265322_100095292 343
147 3300031251 Ga0265327_10113525 Ga0265327_101135251 343
148 3300031733 Ga0316577_10175352 Ga0316577_101753521 343
149 3300031824 Ga0307413_10155688 Ga0307413_101556881 343
150 3300031852 Ga0307410_10295853 Ga0307410_102958531 343
151 3300031901 Ga0307406_10221102 Ga0307406_102211021 343
152 3300031903 Ga0307407_10216808 Ga0307407_102168081 343
153 3300031995 Ga0307409_100417231 Ga0307409_1004172311 343
154 3300032002 Ga0307416_100418275 Ga0307416_1004182751 343
155 3300032004 Ga0307414_10338167 Ga0307414_103381671 343
156 3300032005 Ga0307411_10254647 Ga0307411_102546471 343
157 3300032126 Ga0307415_100352686 Ga0307415_1003526861 343
158 3300038741 Ga0400488_02457 Ga0400488_02457_202_1293 343
159 3300039110 Ga0400487_52752 Ga0400487_52752_94_1185 343
160 3300039453 Ga0436362_0433787 Ga0436362_0433787_564_1649 343
161 3300042005 Ga0439448_0053099 Ga0439448_0053099_188_1273 343
162 3300042439 Ga0439464_0023973 Ga0439464_0023973_134_1219 343
163 3300042993 Ga0439440_0020380 Ga0439440_0020380_183_1268 343
164 3300044656 Ga0466969_0080112 Ga0466969_0080112_401_1486 343
165 3300044735 Ga0466968_0030029 Ga0466968_0030029_630_1715 343
166 3300044765 Ga0466970_0128606 Ga0466970_0128606_269_1354 343
167 3300045976 Ga0466967_0330733 Ga0466967_0330733_338_1423 343
168 3300046523 Ga0495644_0076805 Ga0495644_0076805_47_1132 343
169 3300046615 Ga0495656_0104674 Ga0495656_0104674_197_1282 343
170 3300046616 Ga0495668_0171303 Ga0495668_0171303_81_1166 343
171 3300047445 Ga0495677_0062561 Ga0495677_0062561_135_1220 343
172 3300049521 Ga0501298_018058 Ga0501298_018058_150_1235 343
173 3300049660 Ga0501216_016090 Ga0501216_016090_139_1224 343
174 3300049673 Ga0501240_011677 Ga0501240_011677_80_1165 343
175 3300049675 Ga0501243_013018 Ga0501243_013018_140_1225 343
176 3300049679 Ga0501249_021889 Ga0501249_021889_159_1244 343
177 3300049681 Ga0501251_005346 Ga0501251_005346_110_1195 343
178 3300049683 Ga0501253_016510 Ga0501253_016510_111_1196 343
179 3300049684 Ga0501255_005284 Ga0501255_005284_149_1234 343
180 3300049685 Ga0501256_003700 Ga0501256_003700_165_1250 343
181 3300049688 Ga0501259_016264 Ga0501259_016264_63_1148 343
182 3300049704 Ga0501221_007776 Ga0501221_007776_144_1229 343
183 3300049705 Ga0501225_0034722 Ga0501225_0034722_145_1230 343
184 3300049708 Ga0501245_015317 Ga0501245_015317_19_1104 343
185 3300049761 Ga0501264_004496 Ga0501264_004496_40_1125 343
186 3300049762 Ga0501265_003790 Ga0501265_003790_155_1240 343
187 3300049773 Ga0501276_002468 Ga0501276_002468_136_1221 343
188 3300049776 Ga0501280_008729 Ga0501280_008729_216_1304 343
189 3300049779 Ga0501283_012308 Ga0501283_012308_151_1236 343
190 3300050507 nmdc:mga05p37_262614_c1 nmdc:mga05p37_262614_c1_245_1336 343
191 3300050507 nmdc:mga05p37_529384_c1 nmdc:mga05p37_529384_c1_122_1207 343
192 3300050515 nmdc:mga0a205_170572_c1 nmdc:mga0a205_170572_c1_682_1767 343
193 3300005468 Ga0070707_100479504 Ga0070707_1004795041 344
194 3300014969 Ga0157376_10341054 Ga0157376_103410541 344
195 3300042461 Ga0439460_0047747 Ga0439460_0047747_169_1257 344
196 3300044684 Ga0466966_0143972 Ga0466966_0143972_154_1242 344
197 3300045049 Ga0466959_0269570 Ga0466959_0269570_59_1147 344
198 3300045836 Ga0466958_0126544 Ga0466958_0126544_169_1257 344
199 3300005289 Ga0065704_10139675 Ga0065704_101396751 345
200 3300005295 Ga0065707_10021882 Ga0065707_100218821 345
201 3300005295 Ga0065707_10158189 Ga0065707_101581892 345
202 3300005295 Ga0065707_10189605 Ga0065707_101896051 345
203 3300005295 Ga0065707_10218654 Ga0065707_102186541 345
204 3300005445 Ga0070708_100094957 Ga0070708_1000949574 345
205 3300005445 Ga0070708_100396659 Ga0070708_1003966591 345
206 3300005457 Ga0070662_100337599 Ga0070662_1003375991 345
207 3300005467 Ga0070706_100056325 Ga0070706_1000563251 345
208 3300005467 Ga0070706_100094551 Ga0070706_1000945511 345
209 3300005468 Ga0070707_100326093 Ga0070707_1003260932 345
210 3300005471 Ga0070698_100112422 Ga0070698_1001124221 345
211 3300005471 Ga0070698_100332388 Ga0070698_1003323881 345
212 3300005471 Ga0070698_100386638 Ga0070698_1003866381 345
213 3300005536 Ga0070697_100298733 Ga0070697_1002987331 345
214 3300005719 Ga0068861_100070440 Ga0068861_1000704402 345
215 3300005843 Ga0068860_100450404 Ga0068860_1004504042 345
216 3300006058 Ga0075432_10020289 Ga0075432_100202892 345
217 3300006844 Ga0075428_100210702 Ga0075428_1002107022 345
218 3300006846 Ga0075430_100257759 Ga0075430_1002577592 345
219 3300006846 Ga0075430_100292775 Ga0075430_1002927752 345
220 3300006847 Ga0075431_100263224 Ga0075431_1002632241 345
221 3300006847 Ga0075431_100266273 Ga0075431_1002662732 345
222 3300006847 Ga0075431_100316879 Ga0075431_1003168792 345
223 3300006847 Ga0075431_100334480 Ga0075431_1003344802 345
224 3300006852 Ga0075433_10277333 Ga0075433_102773332 345
225 3300006852 Ga0075433_10313295 Ga0075433_103132951 345
226 3300006852 Ga0075433_10344750 Ga0075433_103447501 345
227 3300006852 Ga0075433_10393704 Ga0075433_103937041 345
228 3300006871 Ga0075434_100294771 Ga0075434_1002947712 345
229 3300006880 Ga0075429_100167682 Ga0075429_1001676822 345
230 3300006880 Ga0075429_100284939 Ga0075429_1002849392 345
231 3300006880 Ga0075429_100306773 Ga0075429_1003067731 345
232 3300006914 Ga0075436_100178461 Ga0075436_1001784612 345
233 3300007076 Ga0075435_100109188 Ga0075435_1001091882 345
234 3300007076 Ga0075435_100182053 Ga0075435_1001820531 345
235 3300007076 Ga0075435_100304253 Ga0075435_1003042532 345
236 3300009094 Ga0111539_10194493 Ga0111539_101944932 345
237 3300009094 Ga0111539_10292073 Ga0111539_102920731 345
238 3300009094 Ga0111539_10328411 Ga0111539_103284111 345
239 3300009094 Ga0111539_10340733 Ga0111539_103407331 345
240 3300009094 Ga0111539_10444050 Ga0111539_104440502 345
241 3300009094 Ga0111539_10488965 Ga0111539_104889651 345
242 3300009094 Ga0111539_10595765 Ga0111539_105957651 345
243 3300009147 Ga0114129_10209485 Ga0114129_102094851 345
244 3300009147 Ga0114129_10271198 Ga0114129_102711981 345
245 3300009147 Ga0114129_10447390 Ga0114129_104473902 345
246 3300009553 Ga0105249_10082855 Ga0105249_100828552 345
247 3300009553 Ga0105249_10286280 Ga0105249_102862802 345
248 3300009553 Ga0105249_10301847 Ga0105249_103018472 345
249 3300012506 Ga0157324_1001442 Ga0157324_10014421 345
250 3300013306 Ga0163162_10380240 Ga0163162_103802401 345
251 3300013306 Ga0163162_10385344 Ga0163162_103853441 345
252 3300013306 Ga0163162_10468651 Ga0163162_104686511 345
253 3300017792 Ga0163161_10097646 Ga0163161_100976461 345
254 3300025910 Ga0207684_10163513 Ga0207684_101635132 345
255 3300025910 Ga0207684_10384875 Ga0207684_103848751 345
256 3300025922 Ga0207646_10243422 Ga0207646_102434221 345
257 3300025933 Ga0207706_10065226 Ga0207706_100652262 345
258 3300025933 Ga0207706_10174528 Ga0207706_101745282 345
259 3300025933 Ga0207706_10179793 Ga0207706_101797931 345
260 3300025961 Ga0207712_10323275 Ga0207712_103232751 345
261 3300026075 Ga0207708_10234035 Ga0207708_102340351 345
262 3300026118 Ga0207675_100371289 Ga0207675_1003712891 345
263 3300027907 Ga0207428_10226711 Ga0207428_102267112 345
264 3300027907 Ga0207428_10259343 Ga0207428_102593432 345
265 3300028381 Ga0268264_10514274 Ga0268264_105142741 345
266 3300034817 Ga0373948_0024183 Ga0373948_0024183_71_1162 345
267 3300034819 Ga0373958_0007932 Ga0373958_0007932_56_1147 345
268 3300035085 Ga0373929_0025322 Ga0373929_0025322_83_1174 345
269 3300035114 Ga0373939_0033271 Ga0373939_0033271_401_1492 345
270 3300035242 Ga0373962_0051117 Ga0373962_0051117_29_1120 345
271 3300038996 Ga0242420_011479 Ga0242420_011479_151_1242 345
272 3300042003 Ga0439443_008142 Ga0439443_008142_150_1241 345
273 3300042005 Ga0439448_0028073 Ga0439448_0028073_309_1400 345
274 3300042005 Ga0439448_0045357 Ga0439448_0045357_228_1319 345
275 3300042005 Ga0439448_0047303 Ga0439448_0047303_128_1219 345
276 3300042008 Ga0439450_001474 Ga0439450_001474_797_1888 345
277 3300042008 Ga0439450_003051 Ga0439450_003051_1293_2384 345
278 3300042008 Ga0439450_025034 Ga0439450_025034_38_1129 345
279 3300042011 Ga0439454_001057 Ga0439454_001057_126_1217 345
280 3300042016 Ga0439463_024096 Ga0439463_024096_194_1285 345
281 3300042016 Ga0439463_026327 Ga0439463_026327_256_1347 345
282 3300042136 Ga0450900_008075 Ga0450900_008075_131_1222 345
283 3300042437 Ga0439444_0009871 Ga0439444_0009871_305_1396 345
284 3300042437 Ga0439444_0017317 Ga0439444_0017317_29_1120 345
285 3300042439 Ga0439464_0051313 Ga0439464_0051313_47_1138 345
286 3300042461 Ga0439460_0020842 Ga0439460_0020842_200_1291 345
287 3300042461 Ga0439460_0035990 Ga0439460_0035990_222_1313 345
288 3300042461 Ga0439460_0039851 Ga0439460_0039851_199_1290 345
289 3300042993 Ga0439440_0004951 Ga0439440_0004951_1380_2471 345
290 3300042993 Ga0439440_0016231 Ga0439440_0016231_317_1408 345
291 3300042993 Ga0439440_0028023 Ga0439440_0028023_152_1243 345
292 3300044673 Ga0453683_0163990 Ga0453683_0163990_268_1359 345
293 3300045051 Ga0451576_0525403 Ga0451576_0525403_85_1176 345
294 3300046491 Ga0495584_0111497 Ga0495584_0111497_164_1255 345
295 3300046491 Ga0495584_0113609 Ga0495584_0113609_118_1209 345
296 3300046500 Ga0495596_0065073 Ga0495596_0065073_259_1350 345
297 3300046501 Ga0495607_0109187 Ga0495607_0109187_358_1449 345
298 3300046501 Ga0495607_0135055 Ga0495607_0135055_156_1247 345
299 3300046513 Ga0495616_0026051 Ga0495616_0026051_113_1204 345
300 3300046523 Ga0495644_0059718 Ga0495644_0059718_292_1383 345
301 3300046525 Ga0495663_0007305 Ga0495663_0007305_1836_2927 345
302 3300046525 Ga0495663_0033455 Ga0495663_0033455_375_1466 345
303 3300046525 Ga0495663_0056424 Ga0495663_0056424_50_1141 345
304 3300046537 Ga0495598_0032512 Ga0495598_0032512_203_1294 345
305 3300046537 Ga0495598_0037494 Ga0495598_0037494_186_1277 345
306 3300046539 Ga0495621_0071139 Ga0495621_0071139_117_1208 345
307 3300046558 Ga0495633_0110478 Ga0495633_0110478_56_1147 345
308 3300046615 Ga0495656_0058378 Ga0495656_0058378_346_1437 345
309 3300046615 Ga0495656_0113134 Ga0495656_0113134_55_1146 345
310 3300046648 Ga0495611_0079926 Ga0495611_0079926_154_1245 345
311 3300046648 Ga0495611_0101827 Ga0495611_0101827_34_1125 345
312 3300046664 Ga0495659_0055660 Ga0495659_0055660_125_1216 345
313 3300046665 Ga0495661_0095698 Ga0495661_0095698_167_1258 345
314 3300046665 Ga0495661_0138659 Ga0495661_0138659_190_1281 345
315 3300046691 Ga0495670_0099949 Ga0495670_0099949_296_1387 345
316 3300046691 Ga0495670_0139450 Ga0495670_0139450_105_1196 345
317 3300047318 Ga0495636_0100772 Ga0495636_0100772_39_1130 345
318 3300047445 Ga0495677_0055739 Ga0495677_0055739_221_1312 345
319 3300047447 Ga0495685_065270 Ga0495685_065270_63_1154 345
320 3300049588 Ga0501072_0334398 Ga0501072_0334398_72_1163 345
321 3300049592 Ga0501076_0362753 Ga0501076_0362753_76_1167 345
322 3300049593 Ga0501077_0186071 Ga0501077_0186071_54_1145 345
323 3300049824 Ga0501045_0251598 Ga0501045_0251598_55_1146 345
324 3300050507 nmdc:mga05p37_199905_c1 nmdc:mga05p37_199905_c1_345_1436 345
325 3300050507 nmdc:mga05p37_343995_c1 nmdc:mga05p37_343995_c1_427_1518 345
326 3300050507 nmdc:mga05p37_429262_c1 nmdc:mga05p37_429262_c1_261_1352 345
327 3300050507 nmdc:mga05p37_487721_c1 nmdc:mga05p37_487721_c1_200_1291 345
328 3300050507 nmdc:mga05p37_655509_c1 nmdc:mga05p37_655509_c1_55_1146 345
329 3300050507 nmdc:mga05p37_92982_c1 nmdc:mga05p37_92982_c1_2403_3494 345
330 3300050508 nmdc:mga09592_172768_c1 nmdc:mga09592_172768_c1_578_1669 345
331 3300050508 nmdc:mga09592_294282_c1 nmdc:mga09592_294282_c1_154_1245 345
332 3300050508 nmdc:mga09592_313772_c1 nmdc:mga09592_313772_c1_146_1237 345
333 3300050508 nmdc:mga09592_380284_c1 nmdc:mga09592_380284_c1_15_1106 345
334 3300050508 nmdc:mga09592_45642_c1 nmdc:mga09592_45642_c1_381_1472 345
335 3300050509 nmdc:mga0qj67_130563_c1 nmdc:mga0qj67_130563_c1_203_1294 345
336 3300050509 nmdc:mga0qj67_167567_c1 nmdc:mga0qj67_167567_c1_400_1491 345
337 3300050509 nmdc:mga0qj67_307258_c1 nmdc:mga0qj67_307258_c1_54_1145 345
338 3300050509 nmdc:mga0qj67_83425_c1 nmdc:mga0qj67_83425_c1_480_1571 345
339 3300050510 nmdc:mga06r32_121521_c1 nmdc:mga06r32_121521_c1_62_1153 345
340 3300050510 nmdc:mga06r32_125337_c1 nmdc:mga06r32_125337_c1_324_1415 345
341 3300050510 nmdc:mga06r32_178804_c1 nmdc:mga06r32_178804_c1_136_1227 345
342 3300050510 nmdc:mga06r32_409520_c1 nmdc:mga06r32_409520_c1_126_1217 345
343 3300050510 nmdc:mga06r32_415492_c1 nmdc:mga06r32_415492_c1_145_1236 345
344 3300050510 nmdc:mga06r32_439241_c1 nmdc:mga06r32_439241_c1_148_1239 345
345 3300050510 nmdc:mga06r32_5955_c1 nmdc:mga06r32_5955_c1_9615_10706 345
346 3300050511 nmdc:mga08y16_100612_c1 nmdc:mga08y16_100612_c1_1712_2803 345
347 3300050511 nmdc:mga08y16_336654_c1 nmdc:mga08y16_336654_c1_276_1367 345
348 3300050511 nmdc:mga08y16_453416_c1 nmdc:mga08y16_453416_c1_99_1190 345
349 3300050511 nmdc:mga08y16_501066_c1 nmdc:mga08y16_501066_c1_72_1163 345
350 3300050511 nmdc:mga08y16_83689_c1 nmdc:mga08y16_83689_c1_48_1139 345
351 3300050512 nmdc:mga0n895_393627_c1 nmdc:mga0n895_393627_c1_79_1170 345
352 3300050512 nmdc:mga0n895_488941_c1 nmdc:mga0n895_488941_c1_64_1155 345
353 3300050512 nmdc:mga0n895_518322_c1 nmdc:mga0n895_518322_c1_26_1117 345
354 3300050512 nmdc:mga0n895_82417_c1 nmdc:mga0n895_82417_c1_2106_3197 345
355 3300050513 nmdc:mga0rr50_323620_c1 nmdc:mga0rr50_323620_c1_94_1185 345
356 3300050514 nmdc:mga08x19_225142_c1 nmdc:mga08x19_225142_c1_59_1150 345
357 3300050515 nmdc:mga0a205_168227_c1 nmdc:mga0a205_168227_c1_53_1144 345
358 3300050515 nmdc:mga0a205_278341_c1 nmdc:mga0a205_278341_c1_164_1255 345
359 3300050515 nmdc:mga0a205_320543_c1 nmdc:mga0a205_320543_c1_195_1286 345
360 3300009094 Ga0111539_10350574 Ga0111539_103505741 347
361 3300014325 Ga0163163_10353225 Ga0163163_103532252 349
362 3300025901 Ga0207688_10016169 Ga0207688_100161692 349
363 3300049743 Ga0501081_0236349 Ga0501081_0236349_148_1305 349
364 3300050507 nmdc:mga05p37_615841_c1 nmdc:mga05p37_615841_c1_107_1213 350
365 3300050510 nmdc:mga06r32_296950_c1 nmdc:mga06r32_296950_c1_483_1589 350
366 3300002459 JGI24751J29686_10023150 JGI24751J29686_100231501 351
367 3300005330 Ga0070690_100206684 Ga0070690_1002066841 351
368 3300005331 Ga0070670_100308640 Ga0070670_1003086401 351
369 3300005338 Ga0068868_100362175 Ga0068868_1003621751 351
370 3300005340 Ga0070689_100283517 Ga0070689_1002835171 351
371 3300005343 Ga0070687_100129125 Ga0070687_1001291251 351
372 3300005356 Ga0070674_100280148 Ga0070674_1002801481 351
373 3300005457 Ga0070662_100331590 Ga0070662_1003315901 351
374 3300005466 Ga0070685_10027509 Ga0070685_100275091 351
375 3300005544 Ga0070686_100220794 Ga0070686_1002207941 351
376 3300005544 Ga0070686_100271737 Ga0070686_1002717371 351
377 3300005564 Ga0070664_100331194 Ga0070664_1003311941 351
378 3300005618 Ga0068864_100416917 Ga0068864_1004169171 351
379 3300005840 Ga0068870_10091246 Ga0068870_100912461 351
380 3300005843 Ga0068860_100266238 Ga0068860_1002662381 351
381 3300006194 Ga0075427_10002360 Ga0075427_100023602 351
382 3300006844 Ga0075428_100175980 Ga0075428_1001759802 351
383 3300006880 Ga0075429_100376235 Ga0075429_1003762351 351
384 3300009098 Ga0105245_10332509 Ga0105245_103325091 351
385 3300009147 Ga0114129_10243706 Ga0114129_102437063 351
386 3300009147 Ga0114129_10344519 Ga0114129_103445191 351
387 3300009147 Ga0114129_10575349 Ga0114129_105753491 351
388 3300011119 Ga0105246_10183288 Ga0105246_101832882 351
389 3300013308 Ga0157375_10508606 Ga0157375_105086061 351
390 3300025908 Ga0207643_10112425 Ga0207643_101124251 351
391 3300025918 Ga0207662_10046538 Ga0207662_100465381 351
392 3300025933 Ga0207706_10305824 Ga0207706_103058241 351
393 3300026095 Ga0207676_10343809 Ga0207676_103438091 351
394 3300042125 Ga0450923_017903 Ga0450923_017903_62_1216 351
395 3300042531 Ga0450918_017355 Ga0450918_017355_65_1219 351
396 3300050507 nmdc:mga05p37_221074_c1 nmdc:mga05p37_221074_c1_680_1834 351
397 3300050507 nmdc:mga05p37_446176_c1 nmdc:mga05p37_446176_c1_136_1257 351
398 3300050508 nmdc:mga09592_165391_c1 nmdc:mga09592_165391_c1_325_1479 351
399 3300050508 nmdc:mga09592_19965_c1 nmdc:mga09592_19965_c1_4293_5447 351
400 3300050508 nmdc:mga09592_272598_c1 nmdc:mga09592_272598_c1_247_1368 351
401 3300050509 nmdc:mga0qj67_156982_c1 nmdc:mga0qj67_156982_c1_458_1579 351
402 3300050510 nmdc:mga06r32_178309_c1 nmdc:mga06r32_178309_c1_67_1221 351
403 3300050510 nmdc:mga06r32_283801_c1 nmdc:mga06r32_283801_c1_120_1241 351
404 3300050511 nmdc:mga08y16_424933_c1 nmdc:mga08y16_424933_c1_161_1315 351
405 3300049582 Ga0501048_0197686 Ga0501048_0197686_105_1274 353
406 3300026118 Ga0207675_100272317 Ga0207675_1002723172 355
407 3300003373 JGI25407J50210_10006773 JGI25407J50210_100067732 356
408 3300005457 Ga0070662_100184647 Ga0070662_1001846472 356
409 3300050510 nmdc:mga06r32_203225_c1 nmdc:mga06r32_203225_c1_93_1241 357
410 3300046542 Ga0495597_0092377 Ga0495597_0092377_70_1236 359
411 3300050507 nmdc:mga05p37_583180_c1 nmdc:mga05p37_583180_c1_31_1197 359
412 3300003203 JGI25406J46586_10052708 JGI25406J46586_100527081 361
413 3300005937 Ga0081455_10222645 Ga0081455_102226452 361
414 3300005937 Ga0081455_10243728 Ga0081455_102437281 361
415 3300005981 Ga0081538_10110816 Ga0081538_101108161 361
416 3300005981 Ga0081538_10111872 Ga0081538_101118721 361
417 3300006844 Ga0075428_100104780 Ga0075428_1001047802 361
418 3300006844 Ga0075428_100261743 Ga0075428_1002617432 361
419 3300006844 Ga0075428_100396294 Ga0075428_1003962941 361
420 3300006846 Ga0075430_100054380 Ga0075430_1000543803 361
421 3300006846 Ga0075430_100255543 Ga0075430_1002555431 361
422 3300006847 Ga0075431_100237197 Ga0075431_1002371972 361
423 3300006880 Ga0075429_100138002 Ga0075429_1001380021 361
424 3300009094 Ga0111539_10470499 Ga0111539_104704991 361
425 3300009147 Ga0114129_10744201 Ga0114129_107442011 361
426 3300025916 Ga0207663_10232485 Ga0207663_102324851 361
427 3300027907 Ga0207428_10266794 Ga0207428_102667941 361
428 3300031995 Ga0307409_100400079 Ga0307409_1004000791 361
429 3300042003 Ga0439443_009215 Ga0439443_009215_90_1250 361
430 3300042008 Ga0439450_017945 Ga0439450_017945_99_1259 361
431 3300042136 Ga0450900_002950 Ga0450900_002950_17_1177 361
432 3300042142 Ga0450905_006746 Ga0450905_006746_49_1209 361
433 3300042437 Ga0439444_0009605 Ga0439444_0009605_292_1452 361
434 3300042530 Ga0450916_005407 Ga0450916_005407_95_1255 361
435 3300042533 Ga0450901_006407 Ga0450901_006407_38_1198 361
436 3300042993 Ga0439440_0026952 Ga0439440_0026952_48_1208 361
437 3300046615 Ga0495656_0101936 Ga0495656_0101936_76_1236 361
438 3300049578 Ga0501042_0248662 Ga0501042_0248662_16_1176 361
439 3300049593 Ga0501077_0188778 Ga0501077_0188778_118_1278 361
440 3300049741 Ga0501079_0307860 Ga0501079_0307860_20_1180 361
441 3300049743 Ga0501081_0225227 Ga0501081_0225227_111_1271 361
442 3300050507 nmdc:mga05p37_180802_c1 nmdc:mga05p37_180802_c1_65_1225 361
443 3300050508 nmdc:mga09592_283165_c1 nmdc:mga09592_283165_c1_101_1261 361
444 3300050509 nmdc:mga0qj67_286202_c1 nmdc:mga0qj67_286202_c1_45_1205 361
445 3300050510 nmdc:mga06r32_372693_c1 nmdc:mga06r32_372693_c1_201_1361 361
446 3300054114 Ga0501084_0209127 Ga0501084_0209127_382_1542 361
447 3300060353 Ga0501082_0331748 Ga0501082_0331748_92_1252 361
448 3300005518 Ga0070699_100062461 Ga0070699_1000624614 362
449 3300005536 Ga0070697_100118938 Ga0070697_1001189382 362
450 3300006194 Ga0075427_10005521 Ga0075427_100055211 362
451 3300006846 Ga0075430_100035020 Ga0075430_1000350201 362
452 3300006871 Ga0075434_100422862 Ga0075434_1004228621 362
453 3300006871 Ga0075434_100505358 Ga0075434_1005053581 362
454 3300006914 Ga0075436_100166045 Ga0075436_1001660452 362
455 3300009147 Ga0114129_10391532 Ga0114129_103915322 362
456 3300025910 Ga0207684_10252292 Ga0207684_102522922 362
457 3300025922 Ga0207646_10387626 Ga0207646_103876261 362
458 3300027907 Ga0207428_10251559 Ga0207428_102515591 362
459 3300042461 Ga0439460_0043405 Ga0439460_0043405_115_1257 362
460 3300049742 Ga0501080_0368988 Ga0501080_0368988_141_1283 362
461 3300050507 nmdc:mga05p37_520572_c1 nmdc:mga05p37_520572_c1_133_1275 362
462 3300050507 nmdc:mga05p37_574122_c1 nmdc:mga05p37_574122_c1_84_1226 362
463 3300050507 nmdc:mga05p37_575219_c1 nmdc:mga05p37_575219_c1_110_1252 362
464 3300050508 nmdc:mga09592_366913_c1 nmdc:mga09592_366913_c1_92_1234 362
465 3300050509 nmdc:mga0qj67_103698_c1 nmdc:mga0qj67_103698_c1_1042_2184 362
466 3300050510 nmdc:mga06r32_46589_c1 nmdc:mga06r32_46589_c1_2535_3677 362
467 3300050511 nmdc:mga08y16_471211_c1 nmdc:mga08y16_471211_c1_91_1233 362
468 3300050512 nmdc:mga0n895_176930_c1 nmdc:mga0n895_176930_c1_83_1225 362
469 3300050512 nmdc:mga0n895_436718_c1 nmdc:mga0n895_436718_c1_121_1263 362
470 3300050513 nmdc:mga0rr50_86499_c1 nmdc:mga0rr50_86499_c1_190_1332 362
471 3300050515 nmdc:mga0a205_273556_c1 nmdc:mga0a205_273556_c1_44_1186 362
472 3300050515 nmdc:mga0a205_309617_c1 nmdc:mga0a205_309617_c1_181_1323 362
473 3300049580 Ga0501046_0181803 Ga0501046_0181803_369_1520 365
474 3300049590 Ga0501074_0215813 Ga0501074_0215813_59_1210 365
475 3300049591 Ga0501075_0267599 Ga0501075_0267599_69_1220 365
476 3300049592 Ga0501076_0276062 Ga0501076_0276062_112_1263 365
477 3300049593 Ga0501077_0065439 Ga0501077_0065439_1026_2177 365
478 3300049742 Ga0501080_0311602 Ga0501080_0311602_49_1200 365
479 3300061734 Ga0530510_0158696 Ga0530510_0158696_395_1546 365
480 2162886007 SwRhRL2b_contig_1450232 SwRhRL2b_0844.00003340 366
481 3300003203 JGI25406J46586_10035381 JGI25406J46586_100353811 366
482 3300003911 JGI25405J52794_10022661 JGI25405J52794_100226611 366
483 3300003911 JGI25405J52794_10024172 JGI25405J52794_100241721 366
484 3300005295 Ga0065707_10170125 Ga0065707_101701251 366
485 3300005295 Ga0065707_10205135 Ga0065707_102051351 366
486 3300005330 Ga0070690_100197406 Ga0070690_1001974061 366
487 3300005334 Ga0068869_100227435 Ga0068869_1002274351 366
488 3300005340 Ga0070689_100343600 Ga0070689_1003436001 366
489 3300005343 Ga0070687_100141250 Ga0070687_1001412501 366
490 3300005343 Ga0070687_100143569 Ga0070687_1001435691 366
491 3300005345 Ga0070692_10118761 Ga0070692_101187611 366
492 3300005347 Ga0070668_100298096 Ga0070668_1002980962 366
493 3300005353 Ga0070669_100265853 Ga0070669_1002658532 366
494 3300005356 Ga0070674_100142693 Ga0070674_1001426931 366
495 3300005440 Ga0070705_100256223 Ga0070705_1002562231 366
496 3300005441 Ga0070700_100182769 Ga0070700_1001827691 366
497 3300005444 Ga0070694_100201387 Ga0070694_1002013871 366
498 3300005444 Ga0070694_100257648 Ga0070694_1002576481 366
499 3300005445 Ga0070708_100368144 Ga0070708_1003681441 366
500 3300005459 Ga0068867_100285033 Ga0068867_1002850332 366
501 3300005466 Ga0070685_10205237 Ga0070685_102052371 366
502 3300005544 Ga0070686_100128194 Ga0070686_1001281942 366
503 3300005546 Ga0070696_100230670 Ga0070696_1002306701 366
504 3300005549 Ga0070704_100316074 Ga0070704_1003160741 366
505 3300005615 Ga0070702_100065292 Ga0070702_1000652921 366
506 3300005617 Ga0068859_100427119 Ga0068859_1004271192 366
507 3300005718 Ga0068866_10123579 Ga0068866_101235792 366
508 3300005719 Ga0068861_100051330 Ga0068861_1000513303 366
509 3300005719 Ga0068861_100230290 Ga0068861_1002302901 366
510 3300005719 Ga0068861_100242509 Ga0068861_1002425092 366
511 3300005841 Ga0068863_100394250 Ga0068863_1003942501 366
512 3300005843 Ga0068860_100061739 Ga0068860_1000617392 366
513 3300005843 Ga0068860_100322245 Ga0068860_1003222452 366
514 3300005843 Ga0068860_100440052 Ga0068860_1004400522 366
515 3300005844 Ga0068862_100391937 Ga0068862_1003919371 366
516 3300005937 Ga0081455_10033829 Ga0081455_100338294 366
517 3300005937 Ga0081455_10199446 Ga0081455_101994461 366
518 3300005937 Ga0081455_10219275 Ga0081455_102192751 366
519 3300005937 Ga0081455_10239152 Ga0081455_102391521 366
520 3300005981 Ga0081538_10087758 Ga0081538_100877582 366
521 3300005983 Ga0081540_1008938 Ga0081540_10089386 366
522 3300005985 Ga0081539_10004581 Ga0081539_100045812 366
523 3300005985 Ga0081539_10050047 Ga0081539_100500472 366
524 3300005985 Ga0081539_10105875 Ga0081539_101058752 366
525 3300006058 Ga0075432_10021146 Ga0075432_100211463 366
526 3300006058 Ga0075432_10038204 Ga0075432_100382042 366
527 3300006058 Ga0075432_10039483 Ga0075432_100394831 366
528 3300006058 Ga0075432_10060553 Ga0075432_100605532 366
529 3300006194 Ga0075427_10002534 Ga0075427_100025342 366
530 3300006194 Ga0075427_10005504 Ga0075427_100055042 366
531 3300006194 Ga0075427_10009979 Ga0075427_100099791 366
532 3300006844 Ga0075428_100052452 Ga0075428_1000524522 366
533 3300006844 Ga0075428_100170395 Ga0075428_1001703953 366
534 3300006844 Ga0075428_100180585 Ga0075428_1001805852 366
535 3300006844 Ga0075428_100221419 Ga0075428_1002214192 366
536 3300006844 Ga0075428_100263022 Ga0075428_1002630221 366
537 3300006844 Ga0075428_100379450 Ga0075428_1003794501 366
538 3300006844 Ga0075428_100391476 Ga0075428_1003914762 366
539 3300006844 Ga0075428_100426239 Ga0075428_1004262392 366
540 3300006844 Ga0075428_100475539 Ga0075428_1004755392 366
541 3300006844 Ga0075428_100559239 Ga0075428_1005592391 366
542 3300006846 Ga0075430_100047111 Ga0075430_1000471113 366
543 3300006846 Ga0075430_100086401 Ga0075430_1000864012 366
544 3300006846 Ga0075430_100252630 Ga0075430_1002526302 366
545 3300006846 Ga0075430_100261773 Ga0075430_1002617732 366
546 3300006847 Ga0075431_100113625 Ga0075431_1001136253 366
547 3300006847 Ga0075431_100177989 Ga0075431_1001779893 366
548 3300006847 Ga0075431_100243968 Ga0075431_1002439681 366
549 3300006847 Ga0075431_100279784 Ga0075431_1002797842 366
550 3300006847 Ga0075431_100329352 Ga0075431_1003293521 366
551 3300006847 Ga0075431_100369475 Ga0075431_1003694752 366
552 3300006847 Ga0075431_100373193 Ga0075431_1003731931 366
553 3300006852 Ga0075433_10300032 Ga0075433_103000322 366
554 3300006871 Ga0075434_100262130 Ga0075434_1002621302 366
555 3300006871 Ga0075434_100272223 Ga0075434_1002722231 366
556 3300006880 Ga0075429_100030688 Ga0075429_1000306883 366
557 3300006880 Ga0075429_100081487 Ga0075429_1000814871 366
558 3300006880 Ga0075429_100114039 Ga0075429_1001140391 366
559 3300006880 Ga0075429_100192685 Ga0075429_1001926851 366
560 3300006880 Ga0075429_100211444 Ga0075429_1002114442 366
561 3300006880 Ga0075429_100278239 Ga0075429_1002782391 366
562 3300006880 Ga0075429_100279692 Ga0075429_1002796921 366
563 3300006881 Ga0068865_100240934 Ga0068865_1002409342 366
564 3300006881 Ga0068865_100250372 Ga0068865_1002503722 366
565 3300006931 Ga0097620_100427082 Ga0097620_1004270822 366
566 3300007265 Ga0099794_10084420 Ga0099794_100844202 366
567 3300009093 Ga0105240_10377329 Ga0105240_103773292 366
568 3300009094 Ga0111539_10135612 Ga0111539_101356122 366
569 3300009094 Ga0111539_10207377 Ga0111539_102073772 366
570 3300009094 Ga0111539_10484443 Ga0111539_104844432 366
571 3300009098 Ga0105245_10185147 Ga0105245_101851472 366
572 3300009098 Ga0105245_10189526 Ga0105245_101895263 366
573 3300009098 Ga0105245_10292692 Ga0105245_102926921 366
574 3300009147 Ga0114129_10188149 Ga0114129_101881492 366
575 3300009147 Ga0114129_10313919 Ga0114129_103139192 366
576 3300009147 Ga0114129_10354240 Ga0114129_103542402 366
577 3300009147 Ga0114129_10599503 Ga0114129_105995031 366
578 3300009148 Ga0105243_10225590 Ga0105243_102255902 366
579 3300009545 Ga0105237_10223308 Ga0105237_102233082 366
580 3300009553 Ga0105249_10103142 Ga0105249_101031424 366
581 3300009553 Ga0105249_10276547 Ga0105249_102765471 366
582 3300009553 Ga0105249_10325858 Ga0105249_103258581 366
583 3300009553 Ga0105249_10428343 Ga0105249_104283431 366
584 3300010375 Ga0105239_10300099 Ga0105239_103000991 366
585 3300011119 Ga0105246_10159643 Ga0105246_101596432 366
586 3300013297 Ga0157378_10359110 Ga0157378_103591101 366
587 3300013306 Ga0163162_10048868 Ga0163162_100488683 366
588 3300013306 Ga0163162_10301931 Ga0163162_103019312 366
589 3300013308 Ga0157375_10087560 Ga0157375_100875603 366
590 3300014326 Ga0157380_10251223 Ga0157380_102512231 366
591 3300014968 Ga0157379_10259244 Ga0157379_102592442 366
592 3300017792 Ga0163161_10171308 Ga0163161_101713082 366
593 3300025885 Ga0207653_10056932 Ga0207653_100569322 366
594 3300025899 Ga0207642_10118396 Ga0207642_101183961 366
595 3300025901 Ga0207688_10116542 Ga0207688_101165422 366
596 3300025904 Ga0207647_10159642 Ga0207647_101596421 366
597 3300025910 Ga0207684_10289512 Ga0207684_102895122 366
598 3300025913 Ga0207695_10324062 Ga0207695_103240621 366
599 3300025914 Ga0207671_10219906 Ga0207671_102199061 366
600 3300025923 Ga0207681_10205613 Ga0207681_102056132 366
601 3300025927 Ga0207687_10306538 Ga0207687_103065381 366
602 3300025927 Ga0207687_10320330 Ga0207687_103203301 366
603 3300025936 Ga0207670_10230660 Ga0207670_102306601 366
604 3300025942 Ga0207689_10134238 Ga0207689_101342382 366
605 3300025961 Ga0207712_10102494 Ga0207712_101024941 366
606 3300025961 Ga0207712_10125643 Ga0207712_101256432 366
607 3300025972 Ga0207668_10334251 Ga0207668_103342511 366
608 3300026023 Ga0207677_10279693 Ga0207677_102796931 366
609 3300026035 Ga0207703_10410266 Ga0207703_104102661 366
610 3300026075 Ga0207708_10027329 Ga0207708_100273291 366
611 3300026089 Ga0207648_10236693 Ga0207648_102366932 366
612 3300026118 Ga0207675_100035730 Ga0207675_1000357303 366
613 3300026118 Ga0207675_100225132 Ga0207675_1002251321 366
614 3300026118 Ga0207675_100250767 Ga0207675_1002507671 366
615 3300026118 Ga0207675_100376890 Ga0207675_1003768901 366
616 3300027907 Ga0207428_10189130 Ga0207428_101891301 366
617 3300027907 Ga0207428_10206318 Ga0207428_102063181 366
618 3300027907 Ga0207428_10263904 Ga0207428_102639041 366
619 3300027907 Ga0207428_10263969 Ga0207428_102639691 366
620 3300027907 Ga0207428_10273698 Ga0207428_102736981 366
621 3300028380 Ga0268265_10395017 Ga0268265_103950171 366
622 3300028381 Ga0268264_10218562 Ga0268264_102185621 366
623 3300028381 Ga0268264_10239967 Ga0268264_102399671 366
624 3300028381 Ga0268264_10360681 Ga0268264_103606811 366
625 3300031548 Ga0307408_100271403 Ga0307408_1002714032 366
626 3300031548 Ga0307408_100282010 Ga0307408_1002820101 366
627 3300031852 Ga0307410_10225319 Ga0307410_102253192 366
628 3300031901 Ga0307406_10165814 Ga0307406_101658141 366
629 3300031903 Ga0307407_10179157 Ga0307407_101791571 366
630 3300031995 Ga0307409_100064746 Ga0307409_1000647463 366
631 3300031995 Ga0307409_100302609 Ga0307409_1003026091 366
632 3300032002 Ga0307416_100492352 Ga0307416_1004923521 366
633 3300032002 Ga0307416_100522604 Ga0307416_1005226041 366
634 3300032004 Ga0307414_10374971 Ga0307414_103749711 366
635 3300032126 Ga0307415_100268504 Ga0307415_1002685041 366
636 3300032126 Ga0307415_100287042 Ga0307415_1002870421 366
637 3300041407 Ga0439447_034592 Ga0439447_034592_71_1225 366
638 3300042003 Ga0439443_006102 Ga0439443_006102_155_1309 366
639 3300042005 Ga0439448_0011339 Ga0439448_0011339_1311_2465 366
640 3300042008 Ga0439450_003971 Ga0439450_003971_886_2040 366
641 3300042011 Ga0439454_009929 Ga0439454_009929_78_1232 366
642 3300042016 Ga0439463_014820 Ga0439463_014820_32_1186 366
643 3300042016 Ga0439463_024626 Ga0439463_024626_257_1411 366
644 3300042016 Ga0439463_026803 Ga0439463_026803_36_1190 366
645 3300042184 Ga0450908_016235 Ga0450908_016235_114_1268 366
646 3300042437 Ga0439444_0012998 Ga0439444_0012998_99_1253 366
647 3300042439 Ga0439464_0039545 Ga0439464_0039545_72_1226 366
648 3300042461 Ga0439460_0037036 Ga0439460_0037036_191_1345 366
649 3300042993 Ga0439440_0029336 Ga0439440_0029336_96_1250 366
650 3300042993 Ga0439440_0030534 Ga0439440_0030534_50_1204 366
651 3300046518 Ga0495631_0030113 Ga0495631_0030113_1281_2435 366
652 3300046615 Ga0495656_0015833 Ga0495656_0015833_1486_2640 366
653 3300046616 Ga0495668_0138997 Ga0495668_0138997_81_1235 366
654 3300047445 Ga0495677_0068333 Ga0495677_0068333_36_1190 366
655 3300048905 Ga0496102_0277086 Ga0496102_0277086_36_1190 366
656 3300049572 Ga0501036_0053550 Ga0501036_0053550_155_1309 366
657 3300049574 Ga0501038_0283719 Ga0501038_0283719_47_1201 366
658 3300049575 Ga0501039_0156457 Ga0501039_0156457_595_1749 366
659 3300049577 Ga0501041_0058331 Ga0501041_0058331_197_1351 366
660 3300049578 Ga0501042_0019192 Ga0501042_0019192_1790_2944 366
661 3300049580 Ga0501046_0136322 Ga0501046_0136322_324_1478 366
662 3300049582 Ga0501048_0132949 Ga0501048_0132949_502_1656 366
663 3300049587 Ga0501071_0304052 Ga0501071_0304052_37_1191 366
664 3300049588 Ga0501072_0071887 Ga0501072_0071887_61_1215 366
665 3300049591 Ga0501075_0195805 Ga0501075_0195805_294_1448 366
666 3300049741 Ga0501079_0292334 Ga0501079_0292334_74_1228 366
667 3300049822 Ga0501035_0203058 Ga0501035_0203058_460_1614 366
668 3300049824 Ga0501045_0228987 Ga0501045_0228987_113_1267 366
669 3300050507 nmdc:mga05p37_183084_c1 nmdc:mga05p37_183084_c1_959_2113 366
670 3300050507 nmdc:mga05p37_23339_c1 nmdc:mga05p37_23339_c1_1550_2704 366
671 3300050507 nmdc:mga05p37_333694_c1 nmdc:mga05p37_333694_c1_154_1308 366
672 3300050507 nmdc:mga05p37_42564_c1 nmdc:mga05p37_42564_c1_2783_3937 366
673 3300050507 nmdc:mga05p37_495579_c1 nmdc:mga05p37_495579_c1_211_1365 366
674 3300050508 nmdc:mga09592_296221_c1 nmdc:mga09592_296221_c1_74_1228 366
675 3300050508 nmdc:mga09592_352471_c1 nmdc:mga09592_352471_c1_87_1241 366
676 3300050508 nmdc:mga09592_359200_c1 nmdc:mga09592_359200_c1_70_1224 366
677 3300050508 nmdc:mga09592_40609_c1 nmdc:mga09592_40609_c1_2639_3793 366
678 3300050509 nmdc:mga0qj67_278600_c1 nmdc:mga0qj67_278600_c1_103_1257 366
679 3300050510 nmdc:mga06r32_14847_c1 nmdc:mga06r32_14847_c1_424_1578 366
680 3300050510 nmdc:mga06r32_249733_c1 nmdc:mga06r32_249733_c1_572_1726 366
681 3300050510 nmdc:mga06r32_414439_c1 nmdc:mga06r32_414439_c1_78_1232 366
682 3300050511 nmdc:mga08y16_228546_c1 nmdc:mga08y16_228546_c1_200_1354 366
683 3300050511 nmdc:mga08y16_229352_c1 nmdc:mga08y16_229352_c1_571_1725 366
684 3300050511 nmdc:mga08y16_97863_c1 nmdc:mga08y16_97863_c1_1625_2779 366
685 3300054114 Ga0501084_0227119 Ga0501084_0227119_252_1406 366
686 3300060353 Ga0501082_0303508 Ga0501082_0303508_88_1242 366
687 3300061734 Ga0530510_0271087 Ga0530510_0271087_67_1221 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

216

360

0.98

PF13592

HTH_33

Winged helix-turn helix

143

202

0.95

PF13551

HTH_29

Winged helix-turn helix

67

128

0.93

PF13384

HTH_23

Homeodomain-like domain

61

110

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5clv-assembly4.cif.gz_N crystal structure of kora-operator dna complex (kora-oa) 0.6712 25 97
5clv-assembly4.cif.gz_M crystal structure of kora-operator dna complex (kora-oa) 0.6701 25 97
5clv-assembly2.cif.gz_E crystal structure of kora-operator dna complex (kora-oa) 0.6689 25 97
1bcm-assembly1.cif.gz_B bacteriophage mu transposase core domain with 2 monomers per asymmetric unit 0.6687 205 291
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.6537 32 97
ID Description Score Start End Superfamily
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.853 53 93 1.10.10.10
4go1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8122 51 94 1.10.10.10
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8104 53 94 1.10.10.10
4l5iD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8101 53 94 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7988 51 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G8FBP8-F1-model_v4 DDE superfamily endonuclease 0.8825 203 293 GO:0003676
GO:0004519
AF-A0A2V9SSY2-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.8698 203 354
AF-A0A7T6Z0K9-F1-model_v4 Transposase 0.8671 204 292
AF-A0A1Q5P3C7-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.8666 205 353 GO:0003676
AF-A0A832B5Q3-F1-model_v4 IS630 family transposase 0.8554 203 352 GO:0003676

Feature Viewer

pLDDT pTM Quality
80.56 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map