F475063

General Info

Members Datasets Scaffolds Average Seq Length
684 339 641 377

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10138102|Ga0307414_101381022
Length 375
Sequence MSGRRRILIVFGTRPEAIKLFPLVHALAADARLESRVCVTGQHRELLDQVLTLTGIAPDYDLDIMRAGQSLDSLTSGLLSGLEGVLDEVRPDWVVVQGDTTTAMAAALSAYYRRIPVCHVEAGLRSGDIHQPWPEEVNRKIVGAIATLHCAPTETAARALRAENVDPATIHVTGNTVVDALRWMVARLESQPCLAAGLAELETRFAGKRIVGVTCHRRESFGDGMEAIAAAVRRLAAREDVALILPAHLNPNVRGVMEQLDYPNFVRLLAVSSLILTDSGGVQEEAPALGTPVLVMRETTERYEGVAAGTAKLIGTDPHRIVAEAERLLNDGAAHAVXXXXHNPFGDGRSAARIVELLALSRHERMPDQSRPMLT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
9 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
10 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
11 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
12 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
13 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
14 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
15 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
16 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
19 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
20 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
21 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
22 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
23 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
24 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
25 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
26 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
27 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
28 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
29 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
30 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
31 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
32 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
33 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
34 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
35 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
36 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
37 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
38 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
39 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
40 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
41 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
42 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
43 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
44 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
45 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
226 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
227 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
265 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
298 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
299 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
320 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
321 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
322 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
334 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
335 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
336 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
337 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 0.44
Isolates 6.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.06
Nodule 1.32
Rhizoplane 4.97
Rhizosphere 63.16
Stem 0
Stem Tuber 0
Unclassified 15.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1296284 2162886007 Bacteria 3281
2 SwRhRL2b_contig_2472434 2162886007 Bacteria 15512
3 SwRhRL2b_contig_564562 2162886007 Bacteria 15552
4 JGI24736J21556_1000271 3300001904 Bacteria 9558
5 JGI24741J21665_1000044 3300001915 Bacteria 30118
6 JGI24740J21852_10000438 3300001979 Bacteria 17777
7 JGI24740J21852_10001049 3300001979 Bacteria 12423
8 JGI24739J22299_10003034 3300001989 Bacteria 6418
9 JGI24739J22299_10005696 3300001989 Bacteria 4720
10 JGI24737J22298_10001592 3300001990 Bacteria 8069
11 JGI24737J22298_10032163 3300001990 Bacteria 1635
12 JGI24735J21928_10017734 3300002067 Bacteria 2200
13 JGI24735J21928_10020922 3300002067 Bacteria 2001
14 JGI24751J29686_10000427 3300002459 Bacteria 13121
15 JGI24751J29686_10003145 3300002459 Bacteria 3325
16 JGI25165J46597_1000007 3300003214 Bacteria 518996
17 JGI25153J46596_10000008 3300003215 Bacteria 376808
18 rootH2_10140464 3300003320 Bacteria 1423
19 rootL2_10188478 3300003322 Bacteria 2435
20 rootH1_10012774 3300003323 Bacteria 9119
21 rootH1_10066050 3300003323 Bacteria 1864
22 rootH1_10085742 3300003323 Unclassified 2041
23 Ga0055532_1005765 3300003758 Bacteria 1708
24 Ga0055525_1000063 3300003759 Bacteria 198877
25 Ga0055525_1000064 3300003759 Bacteria 198750
26 Ga0055542_1000040 3300003762 Bacteria 214035
27 Ga0055529_1000037 3300003763 Bacteria 237307
28 Ga0055530_10000142 3300003791 Bacteria 64055
29 Ga0055531_10000013 3300003794 Bacteria 187583
30 Ga0058863_11813500 3300004799 Bacteria 1922
31 Ga0058862_10285799 3300004803 Bacteria 1814
32 Ga0058862_12261043 3300004803 Bacteria 1384
33 Ga0065165_1002027 3300005262 Bacteria 18861
34 Ga0065165_1010792 3300005262 Bacteria 3895
35 Ga0065704_10070288 3300005289 Bacteria 39072
36 Ga0065704_10070386 3300005289 Bacteria 27813
37 Ga0065704_10125720 3300005289 Bacteria 1699
38 Ga0070658_10000458 3300005327 Bacteria 35479
39 Ga0070658_10001263 3300005327 Bacteria 21651
40 Ga0070683_100028024 3300005329 Bacteria 5087
41 Ga0070670_100003675 3300005331 Bacteria 12788
42 Ga0070670_100016855 3300005331 Bacteria 6270
43 Ga0070670_100131885 3300005331 Bacteria 2158
44 Ga0070666_10000063 3300005335 Bacteria 80378
45 Ga0070666_10081160 3300005335 Bacteria 2217
46 Ga0070680_100053064 3300005336 Bacteria 3309
47 Ga0070660_100011920 3300005339 Bacteria 6201
48 Ga0070661_100001811 3300005344 Bacteria 14829
49 Ga0070661_100052797 3300005344 Bacteria 2975
50 Ga0070661_100069085 3300005344 Bacteria 2597
51 Ga0070668_100032130 3300005347 Bacteria 3995
52 Ga0070668_100183610 3300005347 Bacteria 1710
53 Ga0070669_100000001 3300005353 Bacteria 537589
54 Ga0070669_100000077 3300005353 Bacteria 95577
55 Ga0070669_100000423 3300005353 Bacteria 32372
56 Ga0070669_100000726 3300005353 Bacteria 24090
57 Ga0070671_100000002 3300005355 Bacteria 292733
58 Ga0070671_100000005 3300005355 Bacteria 256547
59 Ga0070671_100003536 3300005355 Bacteria 12218
60 Ga0070671_100035026 3300005355 Bacteria 4158
61 Ga0070674_100013512 3300005356 Bacteria 5050
62 Ga0070659_100038005 3300005366 Bacteria 3753
63 Ga0070659_100053298 3300005366 Bacteria 3183
64 Ga0070667_100000238 3300005367 Bacteria 62518
65 Ga0070667_100063882 3300005367 Bacteria 3122
66 Ga0070667_100080939 3300005367 Bacteria 2779
67 Ga0070708_100226767 3300005445 Bacteria 1753
68 Ga0070663_100009643 3300005455 Bacteria 5988
69 Ga0070663_100054491 3300005455 Bacteria 2858
70 Ga0070678_100007083 3300005456 Bacteria 6630
71 Ga0070678_100025533 3300005456 Bacteria 3977
72 Ga0070678_100099922 3300005456 Bacteria 2246
73 Ga0070662_100003535 3300005457 Bacteria 9746
74 Ga0070662_100034943 3300005457 Bacteria 3546
75 Ga0068867_100077194 3300005459 Bacteria 2502
76 Ga0070685_10097002 3300005466 Bacteria 1794
77 Ga0070679_100000477 3300005530 Bacteria 34238
78 Ga0070679_100042935 3300005530 Bacteria 4504
79 Ga0068853_100063786 3300005539 Bacteria 3192
80 Ga0068853_100081038 3300005539 Bacteria 2841
81 Ga0070686_100008649 3300005544 Bacteria 5704
82 Ga0070665_100000023 3300005548 Bacteria 375278
83 Ga0070665_100000370 3300005548 Bacteria 66870
84 Ga0070665_100001932 3300005548 Bacteria 23351
85 Ga0070665_100011384 3300005548 Bacteria 8994
86 Ga0070665_100015283 3300005548 Bacteria 7707
87 Ga0070665_100050344 3300005548 Bacteria 4180
88 Ga0068855_100007186 3300005563 Bacteria 13515
89 Ga0068855_100029104 3300005563 Bacteria 6605
90 Ga0068855_100037943 3300005563 Bacteria 5726
91 Ga0068855_100092884 3300005563 Bacteria 3480
92 Ga0068855_100108910 3300005563 Bacteria 3182
93 Ga0068855_100126307 3300005563 Bacteria 2924
94 Ga0068857_100037369 3300005577 Bacteria 4301
95 Ga0068854_100050156 3300005578 Bacteria 2985
96 Ga0068852_100000113 3300005616 Bacteria 54686
97 Ga0068852_100044666 3300005616 Bacteria 3765
98 Ga0068852_100085589 3300005616 Bacteria 2809
99 Ga0068852_100158573 3300005616 Bacteria 2110
100 Ga0068859_100001555 3300005617 Bacteria 23417
101 Ga0068859_100006288 3300005617 Bacteria 12042
102 Ga0068864_100001523 3300005618 Bacteria 19059
103 Ga0068864_100005624 3300005618 Bacteria 10274
104 Ga0068864_100007078 3300005618 Bacteria 9211
105 Ga0068864_100247791 3300005618 Bacteria 1653
106 Ga0068861_100001689 3300005719 Bacteria 14165
107 Ga0068861_100192920 3300005719 Bacteria 1704
108 Ga0068861_100238438 3300005719 Bacteria 1546
109 Ga0068851_10026884 3300005834 Bacteria 2831
110 Ga0068863_100000138 3300005841 Bacteria 77596
111 Ga0068863_100035599 3300005841 Bacteria 4741
112 Ga0068863_100068810 3300005841 Bacteria 3349
113 Ga0068863_100082589 3300005841 Bacteria 3045
114 Ga0068863_100207587 3300005841 Bacteria 1886
115 Ga0068858_100000112 3300005842 Bacteria 86034
116 Ga0068858_100000548 3300005842 Bacteria 39141
117 Ga0068858_100003643 3300005842 Bacteria 15236
118 Ga0068858_100007448 3300005842 Bacteria 10580
119 Ga0068858_100017464 3300005842 Bacteria 6730
120 Ga0068858_100043946 3300005842 Bacteria 4142
121 Ga0068860_100000028 3300005843 Bacteria 266461
122 Ga0068860_100001423 3300005843 Bacteria 25915
123 Ga0068860_100049202 3300005843 Bacteria 4016
124 Ga0068860_100067930 3300005843 Bacteria 3386
125 Ga0068860_100228458 3300005843 Bacteria 1808
126 Ga0068862_100000961 3300005844 Bacteria 27762
127 Ga0068862_100002849 3300005844 Bacteria 15163
128 Ga0068862_100055446 3300005844 Bacteria 3395
129 Ga0081540_1000026 3300005983 Bacteria 155402
130 Ga0075365_10001984 3300006038 Bacteria 9680
131 Ga0075368_10003690 3300006042 Bacteria 5141
132 Ga0075368_10018571 3300006042 Bacteria 2613
133 Ga0075363_100001965 3300006048 Bacteria 8167
134 Ga0075363_100004524 3300006048 Bacteria 6095
135 Ga0075363_100008368 3300006048 Bacteria 4813
136 Ga0075364_10002350 3300006051 Bacteria 10619
137 Ga0075364_10010179 3300006051 Bacteria 5672
138 Ga0075432_10011905 3300006058 Bacteria 2956
139 Ga0075362_10000097 3300006177 Bacteria 24704
140 Ga0075362_10000263 3300006177 Bacteria 14705
141 Ga0075367_10000067 3300006178 Bacteria 26232
142 Ga0075367_10004271 3300006178 Bacteria 6947
143 Ga0075366_10000086 3300006195 Bacteria 36542
144 Ga0075366_10079273 3300006195 Bacteria 1960
145 Ga0097621_100006920 3300006237 Bacteria 8074
146 Ga0075370_10000026 3300006353 Bacteria 51806
147 Ga0075370_10178916 3300006353 Bacteria 1248
148 Ga0097620_100001555 3300006931 Bacteria 23417
149 Ga0097620_100006288 3300006931 Bacteria 12042
150 Ga0105251_10007900 3300009011 Bacteria 6467
151 Ga0105240_10005105 3300009093 Bacteria 19655
152 Ga0105245_10002027 3300009098 Bacteria 18376
153 Ga0105247_10004847 3300009101 Bacteria 8557
154 Ga0105243_10000221 3300009148 Bacteria 66335
155 Ga0105243_10123527 3300009148 Bacteria 2186
156 Ga0105243_10253334 3300009148 Bacteria 1573
157 Ga0105241_10024346 3300009174 Bacteria 4495
158 Ga0105242_10227042 3300009176 Bacteria 1671
159 Ga0105248_10010649 3300009177 Bacteria 10143
160 Ga0105248_10023982 3300009177 Bacteria 6782
161 Ga0105248_10037905 3300009177 Bacteria 5393
162 Ga0105237_10017692 3300009545 Bacteria 7388
163 Ga0105237_10097605 3300009545 Bacteria 2929
164 Ga0105238_10018856 3300009551 Bacteria 7023
165 Ga0105238_10049742 3300009551 Bacteria 4221
166 Ga0105249_10002466 3300009553 Bacteria 16038
167 Ga0105249_10531642 3300009553 Bacteria 1224
168 Ga0105148_100321 3300009978 Bacteria 6136
169 Ga0105239_10106211 3300010375 Bacteria 3110
170 Ga0105246_10000017 3300011119 Bacteria 65095
171 Ga0157373_10097451 3300013100 Bacteria 2070
172 Ga0157373_10113096 3300013100 Bacteria 1908
173 Ga0157373_10121426 3300013100 Bacteria 1836
174 Ga0157371_10000256 3300013102 Bacteria 73768
175 Ga0157370_10078014 3300013104 Bacteria 3119
176 Ga0157369_10101664 3300013105 Bacteria 3063
177 Ga0157369_10493612 3300013105 Bacteria 1267
178 Ga0157374_10154933 3300013296 Bacteria 2229
179 Ga0157378_10148944 3300013297 Bacteria 2179
180 Ga0163162_10004312 3300013306 Bacteria 13698
181 Ga0163162_10198392 3300013306 Bacteria 2135
182 Ga0163162_10248643 3300013306 Bacteria 1910
183 Ga0163162_10312879 3300013306 Bacteria 1703
184 Ga0163163_10130559 3300014325 Bacteria 2552
185 Ga0157380_10101493 3300014326 Bacteria 2397
186 Ga0163161_10024052 3300017792 Bacteria 4300
187 Ga0163161_10038097 3300017792 Bacteria 3447
188 Ga0163161_10046224 3300017792 Bacteria 3140
189 Ga0163161_10060565 3300017792 Bacteria 2755
190 Ga0209147_102334 3300025229 Bacteria 4884
191 Ga0209563_100066 3300025230 Bacteria 257382
192 Ga0209677_109817 3300025253 Bacteria 1669
193 Ga0209148_1000011 3300025254 Bacteria 1196503
194 Ga0209233_1000026 3300025261 Bacteria 678466
195 Ga0209233_1017965 3300025261 Bacteria 1915
196 Ga0209565_1000107 3300025263 Bacteria 120938
197 Ga0209455_1000006 3300025272 Bacteria 1196503
198 Ga0209673_1022176 3300025273 Bacteria 2198
199 Ga0209676_1008112 3300025292 Bacteria 4761
200 Ga0209564_1000204 3300025295 Bacteria 136175
201 Ga0209758_1000017 3300025297 Bacteria 754393
202 Ga0209050_1000014 3300025298 Bacteria 774327
203 Ga0209050_1000426 3300025298 Bacteria 77545
204 Ga0209050_1013474 3300025298 Bacteria 3624
205 Ga0209257_1000019 3300025304 Bacteria 774261
206 Ga0207697_10049823 3300025315 Bacteria 1729
207 Ga0207696_1008420 3300025711 Bacteria 3947
208 Ga0207713_1006187 3300025735 Bacteria 7342
209 Ga0207713_1036975 3300025735 Bacteria 2088
210 Ga0207680_10000033 3300025903 Bacteria 77177
211 Ga0207680_10021991 3300025903 Bacteria 3462
212 Ga0207680_10056932 3300025903 Bacteria 2363
213 Ga0207647_10007386 3300025904 Bacteria 7945
214 Ga0207647_10028997 3300025904 Bacteria 3587
215 Ga0207647_10055392 3300025904 Bacteria 2437
216 Ga0207647_10063402 3300025904 Bacteria 2248
217 Ga0207699_10040931 3300025906 Bacteria 2673
218 Ga0207645_10024318 3300025907 Bacteria 3929
219 Ga0207705_10000007 3300025909 Bacteria 597387
220 Ga0207705_10001400 3300025909 Bacteria 19231
221 Ga0207654_10002236 3300025911 Bacteria 9928
222 Ga0207654_10042898 3300025911 Bacteria 2562
223 Ga0207695_10030301 3300025913 Bacteria 5958
224 Ga0207695_10077338 3300025913 Bacteria 3380
225 Ga0207671_10006254 3300025914 Bacteria 10666
226 Ga0207671_10036212 3300025914 Bacteria 3659
227 Ga0207660_10081861 3300025917 Bacteria 2374
228 Ga0207657_10001703 3300025919 Bacteria 23699
229 Ga0207657_10002424 3300025919 Bacteria 20139
230 Ga0207657_10003493 3300025919 Bacteria 16779
231 Ga0207649_10001206 3300025920 Bacteria 15590
232 Ga0207652_10000338 3300025921 Bacteria 48779
233 Ga0207652_10064532 3300025921 Bacteria 3169
234 Ga0207652_10302417 3300025921 Bacteria 1444
235 Ga0207681_10000002 3300025923 Bacteria 985597
236 Ga0207681_10000081 3300025923 Bacteria 85588
237 Ga0207681_10000686 3300025923 Bacteria 22255
238 Ga0207681_10001532 3300025923 Bacteria 14888
239 Ga0207694_10002822 3300025924 Bacteria 14021
240 Ga0207694_10022950 3300025924 Bacteria 4734
241 Ga0207650_10013827 3300025925 Bacteria 5597
242 Ga0207650_10052526 3300025925 Bacteria 3019
243 Ga0207650_10082461 3300025925 Bacteria 2441
244 Ga0207659_10045406 3300025926 Bacteria 3098
245 Ga0207687_10002295 3300025927 Bacteria 13027
246 Ga0207644_10000002 3300025931 Bacteria 942221
247 Ga0207644_10000008 3300025931 Bacteria 354219
248 Ga0207644_10001054 3300025931 Bacteria 17637
249 Ga0207644_10007222 3300025931 Bacteria 7228
250 Ga0207690_10000416 3300025932 Bacteria 27810
251 Ga0207706_10000873 3300025933 Bacteria 31009
252 Ga0207706_10024086 3300025933 Bacteria 5460
253 Ga0207706_10025187 3300025933 Bacteria 5333
254 Ga0207706_10048202 3300025933 Bacteria 3768
255 Ga0207709_10000078 3300025935 Bacteria 169141
256 Ga0207709_10013047 3300025935 Bacteria 4581
257 Ga0207669_10000105 3300025937 Bacteria 42248
258 Ga0207711_10018707 3300025941 Bacteria 5759
259 Ga0207711_10027277 3300025941 Bacteria 4797
260 Ga0207711_10046928 3300025941 Bacteria 3691
261 Ga0207661_10074809 3300025944 Bacteria 2777
262 Ga0207679_10022412 3300025945 Bacteria 4300
263 Ga0207667_10000002 3300025949 Bacteria 895662
264 Ga0207667_10005620 3300025949 Bacteria 15300
265 Ga0207667_10020860 3300025949 Bacteria 7274
266 Ga0207667_10023071 3300025949 Bacteria 6857
267 Ga0207667_10025895 3300025949 Bacteria 6417
268 Ga0207667_10093904 3300025949 Bacteria 3098
269 Ga0207667_10286434 3300025949 Bacteria 1683
270 Ga0207712_10323349 3300025961 Bacteria 1273
271 Ga0207668_10001925 3300025972 Bacteria 12151
272 Ga0207668_10018228 3300025972 Bacteria 4412
273 Ga0207668_10073193 3300025972 Bacteria 2455
274 Ga0207668_10075184 3300025972 Bacteria 2428
275 Ga0207640_10001151 3300025981 Bacteria 14526
276 Ga0207658_10000625 3300025986 Bacteria 31264
277 Ga0207658_10000927 3300025986 Bacteria 24275
278 Ga0207658_10001337 3300025986 Bacteria 19310
279 Ga0207658_10001396 3300025986 Bacteria 18830
280 Ga0207658_10029544 3300025986 Bacteria 3872
281 Ga0207703_10001705 3300026035 Bacteria 19734
282 Ga0207703_10001786 3300026035 Bacteria 19182
283 Ga0207703_10002992 3300026035 Bacteria 14332
284 Ga0207703_10012751 3300026035 Bacteria 6554
285 Ga0207703_10183690 3300026035 Bacteria 1847
286 Ga0207639_10000665 3300026041 Bacteria 23726
287 Ga0207639_10002958 3300026041 Bacteria 11421
288 Ga0207639_10166119 3300026041 Bacteria 1865
289 Ga0207678_10001311 3300026067 Bacteria 23031
290 Ga0207678_10002144 3300026067 Bacteria 17875
291 Ga0207678_10054487 3300026067 Bacteria 3444
292 Ga0207702_10003566 3300026078 Bacteria 14153
293 Ga0207641_10000195 3300026088 Bacteria 82043
294 Ga0207641_10003062 3300026088 Bacteria 15071
295 Ga0207641_10014892 3300026088 Bacteria 6376
296 Ga0207641_10035452 3300026088 Bacteria 4156
297 Ga0207676_10003572 3300026095 Bacteria 10988
298 Ga0207676_10025481 3300026095 Bacteria 4388
299 Ga0207676_10026705 3300026095 Bacteria 4294
300 Ga0207674_10006869 3300026116 Bacteria 13342
301 Ga0207674_10050630 3300026116 Bacteria 4242
302 Ga0207674_10054413 3300026116 Bacteria 4074
303 Ga0207674_10057678 3300026116 Bacteria 3936
304 Ga0207674_10117778 3300026116 Bacteria 2626
305 Ga0207675_100003247 3300026118 Bacteria 15934
306 Ga0207675_100100319 3300026118 Bacteria 2727
307 Ga0207683_10000156 3300026121 Bacteria 57349
308 Ga0207683_10040858 3300026121 Bacteria 4049
309 Ga0207683_10158838 3300026121 Bacteria 2043
310 Ga0207698_10000036 3300026142 Bacteria 105391
311 Ga0207698_10003251 3300026142 Bacteria 9763
312 Ga0207698_10022290 3300026142 Bacteria 4397
313 Ga0209281_1015308 3300027111 Bacteria 1602
314 Ga0209813_10000041 3300027866 Bacteria 53753
315 Ga0209813_10000561 3300027866 Bacteria 8710
316 Ga0268266_10000002 3300028379 Bacteria 3059047
317 Ga0268266_10000694 3300028379 Bacteria 45342
318 Ga0268266_10004341 3300028379 Bacteria 13625
319 Ga0268266_10009905 3300028379 Bacteria 8375
320 Ga0268265_10000116 3300028380 Bacteria 100689
321 Ga0268265_10019442 3300028380 Bacteria 4721
322 Ga0268265_10131709 3300028380 Bacteria 2079
323 Ga0268264_10000066 3300028381 Bacteria 285125
324 Ga0268264_10000116 3300028381 Bacteria 198591
325 Ga0268264_10012271 3300028381 Bacteria 7050
326 Ga0268264_10016598 3300028381 Bacteria 6029
327 Ga0268264_10048396 3300028381 Bacteria 3537
328 Ga0268264_10189681 3300028381 Bacteria 1873
329 Ga0307517_10010772 3300028786 Bacteria 12748
330 Ga0307517_10036027 3300028786 Bacteria 5579
331 Ga0307513_10027931 3300031456 Bacteria 6466
332 Ga0307513_10076986 3300031456 Bacteria 3457
333 Ga0307408_100100625 3300031548 Bacteria 2201
334 Ga0307408_100261493 3300031548 Bacteria 1432
335 Ga0307508_10000760 3300031616 Bacteria 38152
336 Ga0307508_10004576 3300031616 Bacteria 13462
337 Ga0307405_10036048 3300031731 Bacteria 2961
338 Ga0307413_10003252 3300031824 Bacteria 6807
339 Ga0307410_10026102 3300031852 Bacteria 3673
340 Ga0307410_10053535 3300031852 Bacteria 2731
341 Ga0307410_10227732 3300031852 Bacteria 1437
342 Ga0307406_10303404 3300031901 Bacteria 1228
343 Ga0307407_10047125 3300031903 Bacteria 2444
344 Ga0307412_10032106 3300031911 Bacteria 3323
345 Ga0307412_10033332 3300031911 Bacteria 3273
346 Ga0307412_10075331 3300031911 Bacteria 2314
347 Ga0307412_10114465 3300031911 Bacteria 1931
348 Ga0307412_10184482 3300031911 Bacteria 1572
349 Ga0307409_100278623 3300031995 Bacteria 1544
350 Ga0307416_100071782 3300032002 Bacteria 2878
351 Ga0307416_100419063 3300032002 Bacteria 1382
352 Ga0307414_10000790 3300032004 Bacteria 16166
353 Ga0307414_10054547 3300032004 Bacteria 2794
354 Ga0307414_10086771 3300032004 Bacteria 2310
355 Ga0307414_10138102 3300032004 Bacteria 1904
356 Ga0307411_10068934 3300032005 Bacteria 2386
357 Ga0307411_10233185 3300032005 Bacteria 1436
358 Ga0307411_10244623 3300032005 Bacteria 1407
359 Ga0316583_10000363 3300032133 Bacteria 13005
360 Ga0307510_10001089 3300033180 Bacteria 28935
361 Ga0316582_0013913 3300036647 Bacteria 4547
362 Ga0316584_0069938 3300036712 Bacteria 2632
363 Ga0395905_0284562 3300037471 Bacteria 1540
364 Ga0237819_01392 3300038705 Bacteria 6322
365 Ga0439436_0030435 3300041404 Bacteria 1568
366 Ga0439461_0000031 3300041410 Bacteria 17424
367 Ga0439465_0007320 3300041413 Bacteria 3504
368 Ga0439431_0001137 3300041997 Bacteria 5792
369 Ga0439442_004151 3300042002 Bacteria 2873
370 Ga0439445_0017859 3300042004 Bacteria 1756
371 Ga0439432_007499 3300042006 Bacteria 3864
372 Ga0439457_012139 3300042014 Bacteria 1946
373 Ga0439462_0000502 3300042015 Bacteria 7701
374 Ga0439462_0003732 3300042015 Bacteria 3673
375 Ga0450909_003736 3300042185 Bacteria 2161
376 Ga0439434_0000478 3300042435 Bacteria 11374
377 Ga0466960_0036153 3300044901 Bacteria 2312
378 Ga0495617_037259 3300046452 Bacteria 1629
379 Ga0495627_000332 3300046453 Bacteria 45347
380 Ga0495627_000912 3300046453 Bacteria 20485
381 Ga0495627_001246 3300046453 Bacteria 15798
382 Ga0495638_0000016 3300046460 Bacteria 396505
383 Ga0495638_0001684 3300046460 Bacteria 19543
384 Ga0495650_0000172 3300046471 Bacteria 142776
385 Ga0495650_0003342 3300046471 Bacteria 11810
386 Ga0495584_0029998 3300046491 Bacteria 2756
387 Ga0495585_0076161 3300046492 Bacteria 1823
388 Ga0495596_0000081 3300046500 Bacteria 65577
389 Ga0495596_0000736 3300046500 Bacteria 20185
390 Ga0495596_0044070 3300046500 Bacteria 1757
391 Ga0495607_0007283 3300046501 Bacteria 7675
392 Ga0495607_0035520 3300046501 Bacteria 3014
393 Ga0495583_0000094 3300046506 Bacteria 153549
394 Ga0495583_0004093 3300046506 Bacteria 10699
395 Ga0495583_0005984 3300046506 Bacteria 8072
396 Ga0495583_0011180 3300046506 Bacteria 5171
397 Ga0495583_0015588 3300046506 Bacteria 4126
398 Ga0495606_0000365 3300046507 Bacteria 77476
399 Ga0495606_0023468 3300046507 Bacteria 4468
400 Ga0495610_0000015 3300046512 Bacteria 391489
401 Ga0495610_0000206 3300046512 Bacteria 65469
402 Ga0495610_0000972 3300046512 Bacteria 26489
403 Ga0495616_0000452 3300046513 Bacteria 31314
404 Ga0495632_0001802 3300046519 Bacteria 17286
405 Ga0495632_0002004 3300046519 Bacteria 16084
406 Ga0495632_0005315 3300046519 Bacteria 8552
407 Ga0495632_0042462 3300046519 Bacteria 2278
408 Ga0495637_0003849 3300046520 Bacteria 7874
409 Ga0495637_0006825 3300046520 Bacteria 5709
410 Ga0495643_0000014 3300046522 Bacteria 314632
411 Ga0495643_0000023 3300046522 Bacteria 288590
412 Ga0495643_0001836 3300046522 Bacteria 18055
413 Ga0495643_0009066 3300046522 Bacteria 6236
414 Ga0495643_0011300 3300046522 Bacteria 5446
415 Ga0495643_0022498 3300046522 Bacteria 3596
416 Ga0495643_0036974 3300046522 Bacteria 2680
417 Ga0495648_0000013 3300046524 Bacteria 289090
418 Ga0495648_0000501 3300046524 Bacteria 42180
419 Ga0495648_0045238 3300046524 Bacteria 2740
420 Ga0495648_0067753 3300046524 Bacteria 2086
421 Ga0495648_0154526 3300046524 Bacteria 1193
422 Ga0495663_0000007 3300046525 Bacteria 262438
423 Ga0495598_0003152 3300046537 Bacteria 3475
424 Ga0495609_0020344 3300046538 Bacteria 3067
425 Ga0495597_0018172 3300046542 Bacteria 3302
426 Ga0495633_0000776 3300046558 Bacteria 28552
427 Ga0495633_0001991 3300046558 Bacteria 14788
428 Ga0495633_0003613 3300046558 Bacteria 10229
429 Ga0495668_0000080 3300046616 Bacteria 157259
430 Ga0495611_0006680 3300046648 Bacteria 4908
431 Ga0495611_0069745 3300046648 Bacteria 1606
432 Ga0495625_0000541 3300046660 Bacteria 55446
433 Ga0495625_0003065 3300046660 Bacteria 17111
434 Ga0495625_0009642 3300046660 Bacteria 8051
435 Ga0495625_0012318 3300046660 Bacteria 6935
436 Ga0495625_0050256 3300046660 Bacteria 2992
437 Ga0495625_0135383 3300046660 Bacteria 1666
438 Ga0495625_0167962 3300046660 Bacteria 1466
439 Ga0495669_0000011 3300046684 Bacteria 158720
440 Ga0495670_0000002 3300046691 Bacteria 601814
441 Ga0495670_0096517 3300046691 Bacteria 1518
442 Ga0495671_0000018 3300046692 Bacteria 291470
443 Ga0495671_0000058 3300046692 Bacteria 113487
444 Ga0495649_0005497 3300046694 Bacteria 8040
445 Ga0495649_0048988 3300046694 Bacteria 2295
446 Ga0495683_0001912 3300047323 Bacteria 13009
447 Ga0495683_0058445 3300047323 Bacteria 1915
448 Ga0495687_000077 3300047443 Bacteria 148889
449 Ga0495687_000082 3300047443 Bacteria 147137
450 Ga0495677_0002800 3300047445 Bacteria 6804
451 Ga0495673_0000029 3300047469 Bacteria 471019
452 Ga0495681_0000106 3300047470 Bacteria 72369
453 Ga0495681_0001939 3300047470 Bacteria 15140
454 Ga0495681_0005700 3300047470 Bacteria 8288
455 Ga0495681_0007579 3300047470 Bacteria 6904
456 Ga0495686_0027514 3300047472 Bacteria 3711
457 Ga0495686_0177568 3300047472 Bacteria 1236
458 Ga0495615_0000174 3300048090 Bacteria 15921
459 Ga0495626_0001664 3300048091 Bacteria 17158
460 Ga0496100_0301426 3300048903 Bacteria 1199
461 Ga0496101_0186842 3300048904 Bacteria 1598
462 Ga0496102_0000316 3300048905 Bacteria 60628
463 Ga0496102_0001730 3300048905 Bacteria 19110
464 Ga0496102_0110074 3300048905 Bacteria 2567
465 Ga0496102_0199866 3300048905 Bacteria 1884
466 Ga0496103_0000166 3300048906 Bacteria 69117
467 Ga0496103_0000866 3300048906 Bacteria 22006
468 Ga0496103_0035392 3300048906 Bacteria 3057
469 Ga0496103_0223087 3300048906 Bacteria 1212
470 Ga0496104_0000165 3300048907 Bacteria 58816
471 Ga0496104_0018518 3300048907 Bacteria 6353
472 Ga0496104_0028227 3300048907 Bacteria 5201
473 Ga0496104_0031801 3300048907 Bacteria 4909
474 Ga0496105_0000299 3300048908 Bacteria 32663
475 Ga0496105_0000436 3300048908 Bacteria 27341
476 Ga0496105_0003952 3300048908 Bacteria 11089
477 Ga0496105_0034760 3300048908 Bacteria 4146
478 Ga0496106_0001005 3300048909 Bacteria 20634
479 Ga0496107_0001434 3300048910 Bacteria 14739
480 Ga0496109_0112862 3300048912 Bacteria 2527
481 Ga0496109_0143626 3300048912 Bacteria 2232
482 Ga0496110_0082643 3300048913 Bacteria 2865
483 Ga0496110_0150920 3300048913 Bacteria 2104
484 Ga0496111_0055275 3300048914 Bacteria 2871
485 Ga0496111_0086946 3300048914 Bacteria 2288
486 Ga0496113_0000970 3300048916 Bacteria 15271
487 Ga0496113_0001739 3300048916 Bacteria 12335
488 Ga0496114_0004908 3300048917 Bacteria 10419
489 Ga0496114_0013204 3300048917 Bacteria 6621
490 Ga0496115_0000030 3300048918 Bacteria 138328
491 Ga0496115_0002160 3300048918 Bacteria 14063
492 Ga0496115_0023817 3300048918 Bacteria 4753
493 Ga0496116_0000062 3300048919 Bacteria 271104
494 Ga0496116_0001039 3300048919 Bacteria 33915
495 Ga0496116_0017140 3300048919 Bacteria 5638
496 Ga0496116_0058621 3300048919 Bacteria 2509
497 Ga0496116_0071188 3300048919 Bacteria 2203
498 Ga0496117_0000123 3300048920 Bacteria 169805
499 Ga0496117_0000142 3300048920 Bacteria 157953
500 Ga0496117_0025824 3300048920 Bacteria 4607
501 Ga0496117_0042297 3300048920 Bacteria 3326
502 Ga0496117_0088922 3300048920 Bacteria 1996
503 Ga0496117_0154240 3300048920 Bacteria 1355
504 Ga0496118_0000115 3300048921 Bacteria 146533
505 Ga0496118_0006969 3300048921 Bacteria 12201
506 Ga0496118_0029188 3300048921 Bacteria 4630
507 Ga0496118_0047239 3300048921 Bacteria 3339
508 Ga0496119_0000121 3300048922 Bacteria 109164
509 Ga0496119_0012947 3300048922 Bacteria 6708
510 Ga0496119_0109473 3300048922 Bacteria 1536
511 Ga0496120_0003407 3300048923 Bacteria 14541
512 Ga0496120_0004132 3300048923 Bacteria 12496
513 Ga0496120_0008554 3300048923 Bacteria 7409
514 Ga0496121_0000024 3300048924 Bacteria 462959
515 Ga0496121_0000104 3300048924 Bacteria 192186
516 Ga0496121_0000175 3300048924 Bacteria 142910
517 Ga0496121_0000193 3300048924 Bacteria 136526
518 Ga0496121_0002119 3300048924 Bacteria 31184
519 Ga0496121_0003456 3300048924 Bacteria 22526
520 Ga0496121_0022659 3300048924 Bacteria 6081
521 Ga0496121_0032260 3300048924 Bacteria 4766
522 Ga0496121_0034736 3300048924 Bacteria 4534
523 Ga0496121_0234814 3300048924 Bacteria 1282
524 Ga0496122_0000507 3300048925 Bacteria 80433
525 Ga0496122_0002041 3300048925 Bacteria 29971
526 Ga0496122_0005084 3300048925 Bacteria 15874
527 Ga0496122_0007531 3300048925 Bacteria 12066
528 Ga0496122_0011400 3300048925 Bacteria 9007
529 Ga0496122_0037275 3300048925 Bacteria 3916
530 Ga0496122_0044305 3300048925 Bacteria 3474
531 Ga0496123_0000428 3300048926 Bacteria 75893
532 Ga0496123_0000484 3300048926 Bacteria 69108
533 Ga0496123_0002142 3300048926 Bacteria 25232
534 Ga0496123_0003949 3300048926 Bacteria 16072
535 Ga0496123_0007171 3300048926 Bacteria 10578
536 Ga0496123_0008421 3300048926 Bacteria 9477
537 Ga0496123_0015533 3300048926 Bacteria 6238
538 Ga0496124_0000071 3300048927 Bacteria 220642
539 Ga0496124_0000146 3300048927 Bacteria 146468
540 Ga0496124_0000674 3300048927 Bacteria 56134
541 Ga0496124_0001631 3300048927 Bacteria 32175
542 Ga0496124_0002309 3300048927 Bacteria 25181
543 Ga0496124_0003581 3300048927 Bacteria 18878
544 Ga0496124_0005460 3300048927 Bacteria 14289
545 Ga0496124_0012621 3300048927 Bacteria 8316
546 Ga0496124_0027468 3300048927 Bacteria 5107
547 Ga0496124_0069768 3300048927 Bacteria 2917
548 Ga0496124_0161244 3300048927 Bacteria 1747
549 Ga0496125_0000445 3300048928 Bacteria 75404
550 Ga0496125_0000463 3300048928 Bacteria 72745
551 Ga0496125_0000663 3300048928 Bacteria 57400
552 Ga0496125_0006562 3300048928 Bacteria 12536
553 Ga0496125_0009305 3300048928 Bacteria 10134
554 Ga0496125_0079822 3300048928 Bacteria 2507
555 Ga0496125_0104516 3300048928 Bacteria 2074
556 Ga0496126_0000045 3300048929 Bacteria 331225
557 Ga0496126_0000174 3300048929 Bacteria 146468
558 Ga0496126_0005924 3300048929 Bacteria 13779
559 Ga0496126_0006947 3300048929 Bacteria 12530
560 Ga0496126_0017263 3300048929 Bacteria 7191
561 Ga0496126_0052633 3300048929 Bacteria 3699
562 Ga0496126_0066853 3300048929 Bacteria 3213
563 Ga0496126_0075796 3300048929 Bacteria 2985
564 Ga0496126_0093778 3300048929 Bacteria 2635
565 Ga0496126_0108152 3300048929 Bacteria 2425
566 Ga0501037_0044933 3300049573 Bacteria 3243
567 Ga0501038_0206188 3300049574 Bacteria 1575
568 Ga0501047_0066017 3300049581 Bacteria 3488
569 Ga0501047_0131251 3300049581 Bacteria 2386
570 Ga0501047_0399277 3300049581 Bacteria 1208
571 Ga0501070_0029720 3300049586 Bacteria 4580
572 Ga0501073_0246931 3300049589 Bacteria 1232
573 Ga0501074_0074885 3300049590 Bacteria 2431
574 Ga0501223_000084 3300049663 Bacteria 28507
575 Ga0501225_0004209 3300049705 Bacteria 4300
576 Ga0501282_001577 3300049778 Bacteria 2523
577 Ga0501035_0059527 3300049822 Bacteria 3402
578 Ga0501035_0188745 3300049822 Bacteria 1773
579 Ga0501044_0000424 3300049823 Bacteria 52233
580 Ga0501044_0144897 3300049823 Bacteria 2362
581 Ga0501044_0186674 3300049823 Bacteria 2038
582 Ga0501044_0270278 3300049823 Bacteria 1636
583 nmdc:mga03683_53_c1 3300050489 Bacteria 47904
584 nmdc:mga03683_7266_c1 3300050489 Bacteria 3837
585 nmdc:mga03683_854_c1 3300050489 Bacteria 8790
586 nmdc:mga03n38_38987_c1 3300050490 Bacteria 2058
587 nmdc:mga03n38_43810_c1 3300050490 Bacteria 1963
588 nmdc:mga03n38_47651_c1 3300050490 Bacteria 1898
589 nmdc:mga00v17_22427_c1 3300050491 Bacteria 3642
590 nmdc:mga0yw44_69754_c1 3300050492 Bacteria 2178
591 nmdc:mga0k408_5_c2 3300050493 Bacteria 142245
592 nmdc:mga06z11_339_c1 3300050494 Bacteria 17739
593 nmdc:mga06z11_9_c1 3300050494 Bacteria 109982
594 nmdc:mga04h51_128_c1 3300050495 Bacteria 22007
595 nmdc:mga04h51_345_c1 3300050495 Bacteria 11540
596 nmdc:mga07m45_30_c1 3300050496 Bacteria 85279
597 nmdc:mga07m45_37521_c1 3300050496 Bacteria 2702
598 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
599 Ga0500610_0000028 3300053079 Bacteria 52793
600 Ga0500643_000005 3300053087 Bacteria 539775
601 Ga0500643_000199 3300053087 Bacteria 57141
602 Ga0500643_000964 3300053087 Bacteria 17873
603 Ga0500643_001644 3300053087 Bacteria 12495
604 Ga0500643_016267 3300053087 Bacteria 2524
605 Ga0500643_038005 3300053087 Bacteria 1429
606 Ga0500647_0056531 3300053091 Bacteria 1887
607 Ga0500566_0004563 3300053094 Bacteria 8265
608 Ga0500555_026164 3300053103 Bacteria 1668
609 Ga0500556_0013142 3300053104 Bacteria 2496
610 Ga0500592_000009 3300053116 Bacteria 87878
611 Ga0500595_000340 3300053119 Bacteria 30575
612 Ga0500595_000725 3300053119 Bacteria 19606
613 Ga0500607_000009 3300053121 Bacteria 125590
614 Ga0500607_000162 3300053121 Bacteria 57883
615 Ga0500608_000190 3300053122 Bacteria 24701
616 Ga0500618_004968 3300053125 Bacteria 4120
617 Ga0500642_0001123 3300053130 Bacteria 7659
618 Ga0500658_0006537 3300053134 Bacteria 4323
619 Ga0500658_0009079 3300053134 Bacteria 3670
620 Ga0500559_0000353 3300053136 Bacteria 34519
621 Ga0500559_0000540 3300053136 Bacteria 26157
622 Ga0500559_0000551 3300053136 Bacteria 25981
623 Ga0500559_0040283 3300053136 Bacteria 2034
624 Ga0500573_0000029 3300053140 Bacteria 135595
625 Ga0500590_015582 3300053148 Bacteria 3924
626 Ga0500604_0018624 3300053151 Bacteria 1936
627 Ga0500616_0001604 3300053153 Bacteria 21081
628 Ga0500622_0000924 3300053156 Bacteria 24943
629 Ga0500624_000049 3300053157 Bacteria 81103
630 Ga0500624_000076 3300053157 Bacteria 55457
631 Ga0500627_0000051 3300053158 Bacteria 56260
632 Ga0500636_0000441 3300053177 Bacteria 22947
633 Ga0500637_0002218 3300053178 Bacteria 8573
634 Ga0500567_001195 3300053723 Bacteria 10228
635 Ga0500625_000005 3300053729 Bacteria 209509
636 Ga0500645_000001 3300053730 Bacteria 455558
637 Ga0500645_005022 3300053730 Bacteria 4955
638 Ga0500645_037364 3300053730 Bacteria 1442
639 Ga0500596_003080 3300053735 Bacteria 3204
640 Ga0500661_000720 3300055283 Bacteria 6182
641 Ga0501082_0018384 3300060353 Bacteria 6020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0143626 Ga0496109_0143626_1166_2167 333
2 3300049581 Ga0501047_0399277 Ga0501047_0399277_149_1150 333
3 3300048906 Ga0496103_0035392 Ga0496103_0035392_23_1027 334
4 3300048907 Ga0496104_0028227 Ga0496104_0028227_4166_5170 334
5 3300005329 Ga0070683_100028024 Ga0070683_1000280246 344
6 3300025944 Ga0207661_10074809 Ga0207661_100748093 344
7 3300025921 Ga0207652_10302417 Ga0207652_103024171 352
8 3300013306 Ga0163162_10248643 Ga0163162_102486432 356
9 3300046522 Ga0495643_0001836 Ga0495643_0001836_16480_17550 356
10 2162886007 SwRhRL2b_contig_564562 SwRhRL2b_0441.00008690 359
11 3300005289 Ga0065704_10070386 Ga0065704_100703861 359
12 3300005353 Ga0070669_100000077 Ga0070669_1000000776 359
13 3300005843 Ga0068860_100001423 Ga0068860_1000014234 359
14 3300025903 Ga0207680_10021991 Ga0207680_100219912 359
15 3300025923 Ga0207681_10000081 Ga0207681_1000008160 359
16 3300025986 Ga0207658_10000927 Ga0207658_100009277 359
17 3300028381 Ga0268264_10016598 Ga0268264_100165984 359
18 3300046524 Ga0495648_0154526 Ga0495648_0154526_96_1175 359
19 3300048903 Ga0496100_0301426 Ga0496100_0301426_54_1181 359
20 3300048907 Ga0496104_0000165 Ga0496104_0000165_29306_30433 359
21 3300048908 Ga0496105_0003952 Ga0496105_0003952_5854_6981 359
22 3300048916 Ga0496113_0001739 Ga0496113_0001739_240_1367 359
23 3300048922 Ga0496119_0000121 Ga0496119_0000121_85628_86755 359
24 3300048923 Ga0496120_0003407 Ga0496120_0003407_6232_7359 359
25 3300048925 Ga0496122_0011400 Ga0496122_0011400_644_1771 359
26 3300048926 Ga0496123_0015533 Ga0496123_0015533_2002_3129 359
27 3300048928 Ga0496125_0006562 Ga0496125_0006562_5445_6572 359
28 3300048929 Ga0496126_0000045 Ga0496126_0000045_166608_167735 359
29 3300003323 rootH1_10066050 rootH1_100660502 360
30 3300032005 Ga0307411_10233185 Ga0307411_102331852 360
31 iso_pu_bacteria 2946787523 2946789389 362
32 3300053104 Ga0500556_0013142 Ga0500556_0013142_1000_2127 363
33 3300001989 JGI24739J22299_10003034 JGI24739J22299_100030347 366
34 3300032002 Ga0307416_100071782 Ga0307416_1000717822 366
35 3300046520 Ga0495637_0003849 Ga0495637_0003849_6473_7573 366
36 3300046522 Ga0495643_0000014 Ga0495643_0000014_302_1402 366
37 3300046692 Ga0495671_0000058 Ga0495671_0000058_302_1402 366
38 3300047470 Ga0495681_0007579 Ga0495681_0007579_5518_6618 366
39 iso_pu_bacteria 2512564014 2512641915 366
40 iso_pu_bacteria 2808606401 2809064703 366
41 iso_pu_bacteria 2808606404 2809080628 366
42 iso_pu_bacteria 2808606405 2809084993 366
43 iso_pu_bacteria 2880518877 2880519596 366
44 3300032004 Ga0307414_10138102 Ga0307414_101381022 367
45 3300046492 Ga0495585_0076161 Ga0495585_0076161_20_1123 367
46 3300047323 Ga0495683_0001912 Ga0495683_0001912_10487_11590 367
47 3300053091 Ga0500647_0056531 Ga0500647_0056531_760_1863 367
48 iso_pu_bacteria 2919709256 2919711593 367
49 3300048928 Ga0496125_0079822 Ga0496125_0079822_181_1320 368
50 3300048929 Ga0496126_0066853 Ga0496126_0066853_1495_2601 368
51 iso_pu_bacteria 2513237139 2513878965 368
52 iso_pu_bacteria 2802429603 2805918177 368
53 iso_pu_bacteria 2824671348 2824672165 368
54 iso_pu_bacteria 2824687955 2824688764 368
55 iso_pu_bacteria 2824696289 2824697511 368
56 iso_pu_bacteria 2838122688 2838123163 368
57 iso_pu_bacteria 2841949485 2841954320 368
58 iso_pu_bacteria 2841966195 2841969692 368
59 iso_pu_bacteria 2841983080 2841984012 368
60 iso_pu_bacteria 2842038055 2842038782 368
61 iso_pu_bacteria 2842045827 2842048273 368
62 iso_pu_bacteria 2895880812 2895881427 368
63 3300003320 rootH2_10140464 rootH2_101404641 369
64 3300003322 rootL2_10188478 rootL2_101884783 369
65 3300003323 rootH1_10012774 rootH1_100127743 369
66 3300005344 Ga0070661_100052797 Ga0070661_1000527972 369
67 3300005344 Ga0070661_100069085 Ga0070661_1000690852 369
68 3300005347 Ga0070668_100032130 Ga0070668_1000321303 369
69 3300005355 Ga0070671_100003536 Ga0070671_1000035367 369
70 3300005455 Ga0070663_100009643 Ga0070663_1000096436 369
71 3300005456 Ga0070678_100025533 Ga0070678_1000255335 369
72 3300005457 Ga0070662_100003535 Ga0070662_1000035353 369
73 3300005457 Ga0070662_100034943 Ga0070662_1000349432 369
74 3300005530 Ga0070679_100000477 Ga0070679_10000047725 369
75 3300005539 Ga0068853_100063786 Ga0068853_1000637862 369
76 3300005548 Ga0070665_100015283 Ga0070665_1000152837 369
77 3300005577 Ga0068857_100037369 Ga0068857_1000373692 369
78 3300005616 Ga0068852_100044666 Ga0068852_1000446663 369
79 3300011119 Ga0105246_10000017 Ga0105246_100000171 369
80 3300013306 Ga0163162_10312879 Ga0163162_103128791 369
81 3300014326 Ga0157380_10101493 Ga0157380_101014932 369
82 3300025711 Ga0207696_1008420 Ga0207696_10084204 369
83 3300025735 Ga0207713_1036975 Ga0207713_10369752 369
84 3300025919 Ga0207657_10003493 Ga0207657_100034932 369
85 3300025921 Ga0207652_10000338 Ga0207652_1000033830 369
86 3300025926 Ga0207659_10045406 Ga0207659_100454063 369
87 3300025931 Ga0207644_10001054 Ga0207644_100010547 369
88 3300025933 Ga0207706_10000873 Ga0207706_1000087311 369
89 3300025933 Ga0207706_10024086 Ga0207706_100240865 369
90 3300025933 Ga0207706_10025187 Ga0207706_100251873 369
91 3300025949 Ga0207667_10005620 Ga0207667_1000562014 369
92 3300025972 Ga0207668_10018228 Ga0207668_100182283 369
93 3300026041 Ga0207639_10002958 Ga0207639_1000295813 369
94 3300026067 Ga0207678_10054487 Ga0207678_100544872 369
95 3300026116 Ga0207674_10050630 Ga0207674_100506303 369
96 3300026116 Ga0207674_10117778 Ga0207674_101177782 369
97 3300026121 Ga0207683_10040858 Ga0207683_100408585 369
98 3300028379 Ga0268266_10004341 Ga0268266_100043417 369
99 3300031901 Ga0307406_10303404 Ga0307406_103034041 369
100 3300031911 Ga0307412_10032106 Ga0307412_100321062 369
101 3300032004 Ga0307414_10000790 Ga0307414_100007906 369
102 3300032004 Ga0307414_10054547 Ga0307414_100545473 369
103 3300032004 Ga0307414_10086771 Ga0307414_100867712 369
104 3300046522 Ga0495643_0036974 Ga0495643_0036974_789_1910 369
105 3300048905 Ga0496102_0001730 Ga0496102_0001730_7314_8441 369
106 3300048906 Ga0496103_0000866 Ga0496103_0000866_12083_13210 369
107 3300048914 Ga0496111_0086946 Ga0496111_0086946_943_2070 369
108 3300048918 Ga0496115_0002160 Ga0496115_0002160_6798_7916 369
109 3300048919 Ga0496116_0017140 Ga0496116_0017140_590_1717 369
110 3300048920 Ga0496117_0000123 Ga0496117_0000123_159749_160876 369
111 3300048924 Ga0496121_0032260 Ga0496121_0032260_3108_4226 369
112 3300048927 Ga0496124_0002309 Ga0496124_0002309_22621_23748 369
113 3300048929 Ga0496126_0017263 Ga0496126_0017263_2194_3312 369
114 3300049778 Ga0501282_001577 Ga0501282_001577_801_1928 369
115 3300049822 Ga0501035_0188745 Ga0501035_0188745_589_1710 369
116 3300053087 Ga0500643_000005 Ga0500643_000005_385201_386322 369
117 3300053116 Ga0500592_000009 Ga0500592_000009_53393_54520 369
118 3300053158 Ga0500627_0000051 Ga0500627_0000051_50625_51752 369
119 iso_pu_bacteria 2738541275 2738711997 369
120 iso_pu_bacteria 2738541301 2738850422 369
121 iso_pu_bacteria 2738541304 2738866151 369
122 iso_pu_bacteria 2738543022 2739298669 369
123 iso_pu_bacteria 2738543033 2739360347 369
124 iso_pu_bacteria 2928100450 2928103518 369
125 iso_pu_bacteria 2928959182 2928962940 369
126 3300003323 rootH1_10085742 rootH1_100857421 370
127 3300004799 Ga0058863_11813500 Ga0058863_118135002 370
128 3300004803 Ga0058862_10285799 Ga0058862_102857991 370
129 3300004803 Ga0058862_12261043 Ga0058862_122610432 370
130 3300005336 Ga0070680_100053064 Ga0070680_1000530641 370
131 3300005339 Ga0070660_100011920 Ga0070660_1000119202 370
132 3300005366 Ga0070659_100038005 Ga0070659_1000380052 370
133 3300005366 Ga0070659_100053298 Ga0070659_1000532985 370
134 3300005530 Ga0070679_100042935 Ga0070679_1000429354 370
135 3300005563 Ga0068855_100092884 Ga0068855_1000928842 370
136 3300005983 Ga0081540_1000026 Ga0081540_1000026101 370
137 3300006195 Ga0075366_10079273 Ga0075366_100792731 370
138 3300013100 Ga0157373_10097451 Ga0157373_100974512 370
139 3300013104 Ga0157370_10078014 Ga0157370_100780144 370
140 3300013105 Ga0157369_10493612 Ga0157369_104936121 370
141 3300025295 Ga0209564_1000204 Ga0209564_100020439 370
142 3300025906 Ga0207699_10040931 Ga0207699_100409312 370
143 3300025917 Ga0207660_10081861 Ga0207660_100818612 370
144 3300025921 Ga0207652_10064532 Ga0207652_100645323 370
145 3300025949 Ga0207667_10023071 Ga0207667_100230712 370
146 3300026041 Ga0207639_10166119 Ga0207639_101661192 370
147 3300031548 Ga0307408_100261493 Ga0307408_1002614931 370
148 3300031852 Ga0307410_10053535 Ga0307410_100535352 370
149 3300031903 Ga0307407_10047125 Ga0307407_100471252 370
150 3300031911 Ga0307412_10114465 Ga0307412_101144652 370
151 3300031911 Ga0307412_10184482 Ga0307412_101844822 370
152 3300032002 Ga0307416_100419063 Ga0307416_1004190631 370
153 3300042015 Ga0439462_0000502 Ga0439462_0000502_3496_4614 370
154 3300044901 Ga0466960_0036153 Ga0466960_0036153_293_1417 370
155 3300046519 Ga0495632_0005315 Ga0495632_0005315_6308_7429 370
156 3300046525 Ga0495663_0000007 Ga0495663_0000007_514_1635 370
157 3300046537 Ga0495598_0003152 Ga0495598_0003152_1518_2636 370
158 3300046558 Ga0495633_0001991 Ga0495633_0001991_13154_14275 370
159 3300046558 Ga0495633_0003613 Ga0495633_0003613_8828_9940 370
160 3300046660 Ga0495625_0135383 Ga0495625_0135383_513_1634 370
161 3300048090 Ga0495615_0000174 Ga0495615_0000174_1647_2768 370
162 3300048920 Ga0496117_0025824 Ga0496117_0025824_2144_3256 370
163 3300048921 Ga0496118_0047239 Ga0496118_0047239_1827_2939 370
164 3300048925 Ga0496122_0000507 Ga0496122_0000507_38265_39404 370
165 3300048925 Ga0496122_0037275 Ga0496122_0037275_2731_3852 370
166 3300048926 Ga0496123_0000484 Ga0496123_0000484_41002_42141 370
167 3300048926 Ga0496123_0002142 Ga0496123_0002142_116_1237 370
168 3300048927 Ga0496124_0012621 Ga0496124_0012621_2648_3760 370
169 3300048929 Ga0496126_0075796 Ga0496126_0075796_358_1497 370
170 3300049581 Ga0501047_0066017 Ga0501047_0066017_2022_3140 370
171 3300049581 Ga0501047_0131251 Ga0501047_0131251_467_1588 370
172 3300049586 Ga0501070_0029720 Ga0501070_0029720_2119_3240 370
173 3300049589 Ga0501073_0246931 Ga0501073_0246931_86_1204 370
174 3300049590 Ga0501074_0074885 Ga0501074_0074885_1153_2271 370
175 3300049822 Ga0501035_0059527 Ga0501035_0059527_181_1302 370
176 3300049823 Ga0501044_0186674 Ga0501044_0186674_669_1787 370
177 3300049823 Ga0501044_0270278 Ga0501044_0270278_458_1582 370
178 3300053157 Ga0500624_000049 Ga0500624_000049_20668_21780 370
179 3300060353 Ga0501082_0018384 Ga0501082_0018384_3731_4852 370
180 iso_pu_bacteria 2643221588 2643951043 370
181 iso_pu_bacteria 2848297114 2848297810 370
182 3300001979 JGI24740J21852_10001049 JGI24740J21852_100010499 371
183 3300001989 JGI24739J22299_10005696 JGI24739J22299_100056964 371
184 3300001990 JGI24737J22298_10001592 JGI24737J22298_100015922 371
185 3300001990 JGI24737J22298_10032163 JGI24737J22298_100321631 371
186 3300002067 JGI24735J21928_10017734 JGI24735J21928_100177341 371
187 3300002067 JGI24735J21928_10020922 JGI24735J21928_100209222 371
188 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007430 371
189 3300003215 JGI25153J46596_10000008 JGI25153J46596_10000008237 371
190 3300003759 Ga0055525_1000063 Ga0055525_10000632 371
191 3300003759 Ga0055525_1000064 Ga0055525_10000642 371
192 3300003762 Ga0055542_1000040 Ga0055542_100004032 371
193 3300003763 Ga0055529_1000037 Ga0055529_1000037189 371
194 3300005327 Ga0070658_10001263 Ga0070658_1000126313 371
195 3300005331 Ga0070670_100131885 Ga0070670_1001318852 371
196 3300005344 Ga0070661_100001811 Ga0070661_1000018117 371
197 3300005356 Ga0070674_100013512 Ga0070674_1000135124 371
198 3300005367 Ga0070667_100063882 Ga0070667_1000638822 371
199 3300005455 Ga0070663_100054491 Ga0070663_1000544912 371
200 3300005456 Ga0070678_100007083 Ga0070678_1000070833 371
201 3300005456 Ga0070678_100099922 Ga0070678_1000999223 371
202 3300005459 Ga0068867_100077194 Ga0068867_1000771942 371
203 3300005539 Ga0068853_100081038 Ga0068853_1000810382 371
204 3300005548 Ga0070665_100000023 Ga0070665_100000023171 371
205 3300005548 Ga0070665_100050344 Ga0070665_1000503442 371
206 3300005563 Ga0068855_100126307 Ga0068855_1001263073 371
207 3300005616 Ga0068852_100158573 Ga0068852_1001585733 371
208 3300005618 Ga0068864_100001523 Ga0068864_10000152312 371
209 3300005719 Ga0068861_100192920 Ga0068861_1001929201 371
210 3300005719 Ga0068861_100238438 Ga0068861_1002384381 371
211 3300005834 Ga0068851_10026884 Ga0068851_100268842 371
212 3300005842 Ga0068858_100000548 Ga0068858_10000054833 371
213 3300006237 Ga0097621_100006920 Ga0097621_1000069206 371
214 3300009148 Ga0105243_10000221 Ga0105243_100002212 371
215 3300009174 Ga0105241_10024346 Ga0105241_100243463 371
216 3300009177 Ga0105248_10023982 Ga0105248_100239827 371
217 3300009545 Ga0105237_10097605 Ga0105237_100976052 371
218 3300009551 Ga0105238_10049742 Ga0105238_100497424 371
219 3300013100 Ga0157373_10121426 Ga0157373_101214261 371
220 3300013102 Ga0157371_10000256 Ga0157371_1000025663 371
221 3300013105 Ga0157369_10101664 Ga0157369_101016642 371
222 3300013296 Ga0157374_10154933 Ga0157374_101549332 371
223 3300013306 Ga0163162_10004312 Ga0163162_1000431210 371
224 3300017792 Ga0163161_10024052 Ga0163161_100240522 371
225 3300025230 Ga0209563_100066 Ga0209563_10006667 371
226 3300025253 Ga0209677_109817 Ga0209677_1098172 371
227 3300025254 Ga0209148_1000011 Ga0209148_1000011929 371
228 3300025261 Ga0209233_1000026 Ga0209233_1000026428 371
229 3300025261 Ga0209233_1017965 Ga0209233_10179651 371
230 3300025272 Ga0209455_1000006 Ga0209455_1000006263 371
231 3300025297 Ga0209758_1000017 Ga0209758_1000017595 371
232 3300025315 Ga0207697_10049823 Ga0207697_100498232 371
233 3300025904 Ga0207647_10055392 Ga0207647_100553922 371
234 3300025904 Ga0207647_10063402 Ga0207647_100634021 371
235 3300025907 Ga0207645_10024318 Ga0207645_100243184 371
236 3300025909 Ga0207705_10001400 Ga0207705_1000140013 371
237 3300025911 Ga0207654_10002236 Ga0207654_100022366 371
238 3300025914 Ga0207671_10006254 Ga0207671_100062542 371
239 3300025919 Ga0207657_10001703 Ga0207657_1000170318 371
240 3300025920 Ga0207649_10001206 Ga0207649_1000120612 371
241 3300025924 Ga0207694_10002822 Ga0207694_100028227 371
242 3300025925 Ga0207650_10052526 Ga0207650_100525263 371
243 3300025932 Ga0207690_10000416 Ga0207690_1000041610 371
244 3300025933 Ga0207706_10048202 Ga0207706_100482023 371
245 3300025935 Ga0207709_10000078 Ga0207709_1000007877 371
246 3300025937 Ga0207669_10000105 Ga0207669_1000010546 371
247 3300025941 Ga0207711_10027277 Ga0207711_100272774 371
248 3300025945 Ga0207679_10022412 Ga0207679_100224123 371
249 3300025949 Ga0207667_10000002 Ga0207667_10000002646 371
250 3300025981 Ga0207640_10001151 Ga0207640_100011514 371
251 3300025986 Ga0207658_10029544 Ga0207658_100295443 371
252 3300026035 Ga0207703_10002992 Ga0207703_100029926 371
253 3300026035 Ga0207703_10183690 Ga0207703_101836902 371
254 3300026041 Ga0207639_10000665 Ga0207639_1000066510 371
255 3300026067 Ga0207678_10002144 Ga0207678_100021446 371
256 3300026078 Ga0207702_10003566 Ga0207702_100035666 371
257 3300026095 Ga0207676_10003572 Ga0207676_100035727 371
258 3300026116 Ga0207674_10006869 Ga0207674_1000686910 371
259 3300026118 Ga0207675_100100319 Ga0207675_1001003191 371
260 3300026121 Ga0207683_10000156 Ga0207683_100001562 371
261 3300026121 Ga0207683_10158838 Ga0207683_101588382 371
262 3300026142 Ga0207698_10003251 Ga0207698_100032514 371
263 3300028379 Ga0268266_10000002 Ga0268266_100000021308 371
264 3300028786 Ga0307517_10010772 Ga0307517_100107728 371
265 3300028786 Ga0307517_10036027 Ga0307517_100360272 371
266 3300031456 Ga0307513_10027931 Ga0307513_100279313 371
267 3300031456 Ga0307513_10076986 Ga0307513_100769863 371
268 3300031616 Ga0307508_10000760 Ga0307508_1000076013 371
269 3300033180 Ga0307510_10001089 Ga0307510_1000108910 371
270 3300037471 Ga0395905_0284562 Ga0395905_0284562_133_1263 371
271 3300046453 Ga0495627_000332 Ga0495627_000332_9069_10184 371
272 3300046460 Ga0495638_0000016 Ga0495638_0000016_394810_395925 371
273 3300046471 Ga0495650_0000172 Ga0495650_0000172_132527_133660 371
274 3300046491 Ga0495584_0029998 Ga0495584_0029998_1427_2560 371
275 3300046500 Ga0495596_0000081 Ga0495596_0000081_47079_48206 371
276 3300046500 Ga0495596_0044070 Ga0495596_0044070_26_1159 371
277 3300046501 Ga0495607_0007283 Ga0495607_0007283_1328_2443 371
278 3300046501 Ga0495607_0035520 Ga0495607_0035520_1129_2256 371
279 3300046506 Ga0495583_0000094 Ga0495583_0000094_150360_151475 371
280 3300046506 Ga0495583_0004093 Ga0495583_0004093_9117_10250 371
281 3300046506 Ga0495583_0005984 Ga0495583_0005984_6428_7561 371
282 3300046506 Ga0495583_0011180 Ga0495583_0011180_4008_5141 371
283 3300046506 Ga0495583_0015588 Ga0495583_0015588_342_1469 371
284 3300046507 Ga0495606_0000365 Ga0495606_0000365_25342_26475 371
285 3300046507 Ga0495606_0023468 Ga0495606_0023468_431_1564 371
286 3300046512 Ga0495610_0000972 Ga0495610_0000972_124_1248 371
287 3300046513 Ga0495616_0000452 Ga0495616_0000452_26694_27809 371
288 3300046519 Ga0495632_0001802 Ga0495632_0001802_14340_15455 371
289 3300046519 Ga0495632_0042462 Ga0495632_0042462_1098_2225 371
290 3300046522 Ga0495643_0000023 Ga0495643_0000023_19495_20619 371
291 3300046522 Ga0495643_0009066 Ga0495643_0009066_3797_4930 371
292 3300046522 Ga0495643_0011300 Ga0495643_0011300_2198_3331 371
293 3300046522 Ga0495643_0022498 Ga0495643_0022498_692_1825 371
294 3300046524 Ga0495648_0000013 Ga0495648_0000013_581_1696 371
295 3300046524 Ga0495648_0000501 Ga0495648_0000501_9486_10619 371
296 3300046524 Ga0495648_0045238 Ga0495648_0045238_1113_2228 371
297 3300046524 Ga0495648_0067753 Ga0495648_0067753_581_1714 371
298 3300046538 Ga0495609_0020344 Ga0495609_0020344_292_1419 371
299 3300046542 Ga0495597_0018172 Ga0495597_0018172_101_1234 371
300 3300046558 Ga0495633_0000776 Ga0495633_0000776_21526_22659 371
301 3300046616 Ga0495668_0000080 Ga0495668_0000080_2604_3737 371
302 3300046648 Ga0495611_0006680 Ga0495611_0006680_203_1336 371
303 3300046648 Ga0495611_0069745 Ga0495611_0069745_11_1144 371
304 3300046660 Ga0495625_0000541 Ga0495625_0000541_5462_6595 371
305 3300046660 Ga0495625_0003065 Ga0495625_0003065_11037_12170 371
306 3300046660 Ga0495625_0009642 Ga0495625_0009642_717_1844 371
307 3300046660 Ga0495625_0012318 Ga0495625_0012318_2756_3883 371
308 3300046660 Ga0495625_0050256 Ga0495625_0050256_1427_2560 371
309 3300046660 Ga0495625_0167962 Ga0495625_0167962_321_1454 371
310 3300046684 Ga0495669_0000011 Ga0495669_0000011_70912_72045 371
311 3300046692 Ga0495671_0000018 Ga0495671_0000018_2071_3186 371
312 3300046694 Ga0495649_0005497 Ga0495649_0005497_2059_3192 371
313 3300046694 Ga0495649_0048988 Ga0495649_0048988_645_1778 371
314 3300047323 Ga0495683_0058445 Ga0495683_0058445_623_1756 371
315 3300047443 Ga0495687_000077 Ga0495687_000077_107437_108570 371
316 3300047443 Ga0495687_000082 Ga0495687_000082_73187_74320 371
317 3300047445 Ga0495677_0002800 Ga0495677_0002800_437_1564 371
318 3300047469 Ga0495673_0000029 Ga0495673_0000029_366351_367466 371
319 3300047470 Ga0495681_0005700 Ga0495681_0005700_3561_4694 371
320 3300048905 Ga0496102_0000316 Ga0496102_0000316_3600_4733 371
321 3300048906 Ga0496103_0000166 Ga0496103_0000166_59248_60381 371
322 3300048907 Ga0496104_0018518 Ga0496104_0018518_1916_3049 371
323 3300048908 Ga0496105_0000299 Ga0496105_0000299_9473_10606 371
324 3300048917 Ga0496114_0013204 Ga0496114_0013204_3059_4192 371
325 3300048918 Ga0496115_0000030 Ga0496115_0000030_34472_35605 371
326 3300048919 Ga0496116_0001039 Ga0496116_0001039_19577_20710 371
327 3300048920 Ga0496117_0000142 Ga0496117_0000142_85545_86678 371
328 3300048921 Ga0496118_0000115 Ga0496118_0000115_86113_87246 371
329 3300048921 Ga0496118_0029188 Ga0496118_0029188_3369_4496 371
330 3300048922 Ga0496119_0012947 Ga0496119_0012947_2197_3330 371
331 3300048923 Ga0496120_0004132 Ga0496120_0004132_1800_2933 371
332 3300048924 Ga0496121_0000193 Ga0496121_0000193_86786_87919 371
333 3300048925 Ga0496122_0005084 Ga0496122_0005084_12450_13583 371
334 3300048926 Ga0496123_0007171 Ga0496123_0007171_2660_3793 371
335 3300048927 Ga0496124_0000146 Ga0496124_0000146_59223_60356 371
336 3300048928 Ga0496125_0000463 Ga0496125_0000463_43512_44645 371
337 3300048929 Ga0496126_0000174 Ga0496126_0000174_86113_87246 371
338 3300049823 Ga0501044_0144897 Ga0501044_0144897_238_1365 371
339 3300053079 Ga0500610_0000028 Ga0500610_0000028_15650_16783 371
340 3300053087 Ga0500643_000199 Ga0500643_000199_4577_5692 371
341 3300053087 Ga0500643_000964 Ga0500643_000964_1732_2868 371
342 3300053087 Ga0500643_001644 Ga0500643_001644_6730_7857 371
343 3300053119 Ga0500595_000340 Ga0500595_000340_15048_16181 371
344 3300053130 Ga0500642_0001123 Ga0500642_0001123_3533_4666 371
345 3300053136 Ga0500559_0000551 Ga0500559_0000551_3465_4580 371
346 3300053136 Ga0500559_0040283 Ga0500559_0040283_487_1614 371
347 3300053151 Ga0500604_0018624 Ga0500604_0018624_367_1482 371
348 3300053177 Ga0500636_0000441 Ga0500636_0000441_19990_21123 371
349 3300053730 Ga0500645_000001 Ga0500645_000001_150526_151659 371
350 3300053735 Ga0500596_003080 Ga0500596_003080_1546_2679 371
351 3300055283 Ga0500661_000720 Ga0500661_000720_1049_2164 371
352 iso_pu_bacteria 2510917021 2511130563 371
353 iso_pu_bacteria 2885429604 2885431674 371
354 iso_pu_bacteria 8054302542 8054303713 371
355 3300005843 Ga0068860_100228458 Ga0068860_1002284582 372
356 3300028381 Ga0268264_10189681 Ga0268264_101896812 372
357 3300046460 Ga0495638_0001684 Ga0495638_0001684_10221_11354 372
358 3300053087 Ga0500643_038005 Ga0500643_038005_297_1415 372
359 3300053119 Ga0500595_000725 Ga0500595_000725_9716_10846 372
360 3300053134 Ga0500658_0006537 Ga0500658_0006537_1837_2970 372
361 iso_pu_bacteria 2643221622 2644126168 372
362 2162886007 SwRhRL2b_contig_2472434 SwRhRL2b_0170.00002210 373
363 3300002459 JGI24751J29686_10003145 JGI24751J29686_100031455 373
364 3300003791 Ga0055530_10000142 Ga0055530_1000014256 373
365 3300003794 Ga0055531_10000013 Ga0055531_100000136 373
366 3300005262 Ga0065165_1002027 Ga0065165_100202719 373
367 3300005262 Ga0065165_1010792 Ga0065165_10107921 373
368 3300005289 Ga0065704_10070288 Ga0065704_1007028831 373
369 3300005331 Ga0070670_100016855 Ga0070670_1000168555 373
370 3300005335 Ga0070666_10000063 Ga0070666_1000006313 373
371 3300005353 Ga0070669_100000001 Ga0070669_100000001550 373
372 3300005355 Ga0070671_100000002 Ga0070671_10000000265 373
373 3300005617 Ga0068859_100001555 Ga0068859_10000155513 373
374 3300005618 Ga0068864_100005624 Ga0068864_1000056246 373
375 3300005719 Ga0068861_100001689 Ga0068861_1000016897 373
376 3300005842 Ga0068858_100000112 Ga0068858_10000011266 373
377 3300005842 Ga0068858_100007448 Ga0068858_10000744810 373
378 3300005844 Ga0068862_100000961 Ga0068862_1000009618 373
379 3300005844 Ga0068862_100002849 Ga0068862_10000284912 373
380 3300006038 Ga0075365_10001984 Ga0075365_100019846 373
381 3300006042 Ga0075368_10003690 Ga0075368_100036903 373
382 3300006048 Ga0075363_100004524 Ga0075363_1000045244 373
383 3300006051 Ga0075364_10010179 Ga0075364_100101793 373
384 3300006058 Ga0075432_10011905 Ga0075432_100119054 373
385 3300006177 Ga0075362_10000263 Ga0075362_1000026310 373
386 3300006178 Ga0075367_10004271 Ga0075367_100042714 373
387 3300006931 Ga0097620_100001555 Ga0097620_10000155513 373
388 3300009098 Ga0105245_10002027 Ga0105245_1000202712 373
389 3300009101 Ga0105247_10004847 Ga0105247_100048475 373
390 3300009148 Ga0105243_10123527 Ga0105243_101235272 373
391 3300009176 Ga0105242_10227042 Ga0105242_102270421 373
392 3300009551 Ga0105238_10018856 Ga0105238_100188565 373
393 3300009553 Ga0105249_10002466 Ga0105249_100024666 373
394 3300013297 Ga0157378_10148944 Ga0157378_101489442 373
395 3300014325 Ga0163163_10130559 Ga0163163_101305592 373
396 3300025263 Ga0209565_1000107 Ga0209565_100010773 373
397 3300025273 Ga0209673_1022176 Ga0209673_10221762 373
398 3300025292 Ga0209676_1008112 Ga0209676_10081123 373
399 3300025298 Ga0209050_1000014 Ga0209050_1000014158 373
400 3300025298 Ga0209050_1013474 Ga0209050_10134742 373
401 3300025304 Ga0209257_1000019 Ga0209257_1000019534 373
402 3300025903 Ga0207680_10000033 Ga0207680_1000003338 373
403 3300025923 Ga0207681_10000002 Ga0207681_10000002452 373
404 3300025924 Ga0207694_10022950 Ga0207694_100229502 373
405 3300025925 Ga0207650_10013827 Ga0207650_100138272 373
406 3300025927 Ga0207687_10002295 Ga0207687_100022952 373
407 3300025931 Ga0207644_10000002 Ga0207644_10000002456 373
408 3300025935 Ga0207709_10013047 Ga0207709_100130474 373
409 3300025949 Ga0207667_10286434 Ga0207667_102864342 373
410 3300025986 Ga0207658_10001337 Ga0207658_1000133716 373
411 3300026035 Ga0207703_10001786 Ga0207703_100017868 373
412 3300026035 Ga0207703_10012751 Ga0207703_100127514 373
413 3300026088 Ga0207641_10003062 Ga0207641_1000306213 373
414 3300026095 Ga0207676_10025481 Ga0207676_100254812 373
415 3300026118 Ga0207675_100003247 Ga0207675_1000032479 373
416 3300027866 Ga0209813_10000561 Ga0209813_100005615 373
417 3300028380 Ga0268265_10000116 Ga0268265_1000011619 373
418 3300028380 Ga0268265_10019442 Ga0268265_100194422 373
419 3300028381 Ga0268264_10000116 Ga0268264_1000011668 373
420 3300031824 Ga0307413_10003252 Ga0307413_100032522 373
421 3300031852 Ga0307410_10026102 Ga0307410_100261022 373
422 3300031911 Ga0307412_10033332 Ga0307412_100333325 373
423 3300032133 Ga0316583_10000363 Ga0316583_100003639 373
424 3300036647 Ga0316582_0013913 Ga0316582_0013913_1091_2224 373
425 3300036712 Ga0316584_0069938 Ga0316584_0069938_224_1357 373
426 3300041404 Ga0439436_0030435 Ga0439436_0030435_362_1492 373
427 3300041410 Ga0439461_0000031 Ga0439461_0000031_854_1984 373
428 3300041413 Ga0439465_0007320 Ga0439465_0007320_1165_2295 373
429 3300041997 Ga0439431_0001137 Ga0439431_0001137_2349_3479 373
430 3300042002 Ga0439442_004151 Ga0439442_004151_981_2111 373
431 3300042004 Ga0439445_0017859 Ga0439445_0017859_463_1593 373
432 3300042006 Ga0439432_007499 Ga0439432_007499_2005_3135 373
433 3300042014 Ga0439457_012139 Ga0439457_012139_323_1453 373
434 3300042015 Ga0439462_0003732 Ga0439462_0003732_494_1624 373
435 3300042185 Ga0450909_003736 Ga0450909_003736_829_1959 373
436 3300042435 Ga0439434_0000478 Ga0439434_0000478_9485_10615 373
437 3300046453 Ga0495627_001246 Ga0495627_001246_9271_10404 373
438 3300046471 Ga0495650_0003342 Ga0495650_0003342_1445_2578 373
439 3300046512 Ga0495610_0000015 Ga0495610_0000015_327292_328425 373
440 3300046519 Ga0495632_0002004 Ga0495632_0002004_5313_6446 373
441 3300046691 Ga0495670_0000002 Ga0495670_0000002_260783_261919 373
442 3300047470 Ga0495681_0001939 Ga0495681_0001939_4735_5868 373
443 3300048918 Ga0496115_0023817 Ga0496115_0023817_597_1733 373
444 3300048924 Ga0496121_0000104 Ga0496121_0000104_37618_38751 373
445 3300048924 Ga0496121_0034736 Ga0496121_0034736_1478_2614 373
446 3300050489 nmdc:mga03683_854_c1 nmdc:mga03683_854_c1_5480_6613 373
447 3300050490 nmdc:mga03n38_43810_c1 nmdc:mga03n38_43810_c1_545_1678 373
448 3300050492 nmdc:mga0yw44_69754_c1 nmdc:mga0yw44_69754_c1_760_1893 373
449 3300050494 nmdc:mga06z11_339_c1 nmdc:mga06z11_339_c1_6682_7815 373
450 3300050495 nmdc:mga04h51_345_c1 nmdc:mga04h51_345_c1_5489_6622 373
451 3300050496 nmdc:mga07m45_37521_c1 nmdc:mga07m45_37521_c1_1353_2492 373
452 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_56571_57704 373
453 3300053087 Ga0500643_016267 Ga0500643_016267_1183_2313 373
454 3300053094 Ga0500566_0004563 Ga0500566_0004563_2381_3511 373
455 3300053103 Ga0500555_026164 Ga0500555_026164_406_1536 373
456 3300053122 Ga0500608_000190 Ga0500608_000190_17454_18596 373
457 3300053134 Ga0500658_0009079 Ga0500658_0009079_250_1380 373
458 3300053153 Ga0500616_0001604 Ga0500616_0001604_7816_8949 373
459 3300053157 Ga0500624_000076 Ga0500624_000076_45083_46213 373
460 3300053723 Ga0500567_001195 Ga0500567_001195_6882_8024 373
461 3300053729 Ga0500625_000005 Ga0500625_000005_157036_158178 373
462 iso_pu_bacteria 2739367664 2739651288 373
463 iso_pu_bacteria 2739367865 2740029761 373
464 iso_pu_bacteria 2751185897 2753767911 373
465 3300002459 JGI24751J29686_10000427 JGI24751J29686_100004275 374
466 3300003758 Ga0055532_1005765 Ga0055532_10057652 374
467 3300005347 Ga0070668_100183610 Ga0070668_1001836102 374
468 3300005353 Ga0070669_100000423 Ga0070669_1000004235 374
469 3300005355 Ga0070671_100000005 Ga0070671_10000000517 374
470 3300005367 Ga0070667_100080939 Ga0070667_1000809392 374
471 3300005544 Ga0070686_100008649 Ga0070686_1000086494 374
472 3300005548 Ga0070665_100011384 Ga0070665_1000113843 374
473 3300005563 Ga0068855_100007186 Ga0068855_1000071866 374
474 3300005563 Ga0068855_100029104 Ga0068855_1000291046 374
475 3300005617 Ga0068859_100006288 Ga0068859_1000062882 374
476 3300005618 Ga0068864_100247791 Ga0068864_1002477912 374
477 3300005841 Ga0068863_100207587 Ga0068863_1002075872 374
478 3300005842 Ga0068858_100003643 Ga0068858_10000364314 374
479 3300005842 Ga0068858_100043946 Ga0068858_1000439463 374
480 3300005843 Ga0068860_100049202 Ga0068860_1000492025 374
481 3300006931 Ga0097620_100006288 Ga0097620_10000628813 374
482 3300009177 Ga0105248_10010649 Ga0105248_100106498 374
483 3300013306 Ga0163162_10198392 Ga0163162_101983922 374
484 3300025229 Ga0209147_102334 Ga0209147_1023343 374
485 3300025914 Ga0207671_10036212 Ga0207671_100362122 374
486 3300025923 Ga0207681_10000686 Ga0207681_1000068617 374
487 3300025925 Ga0207650_10082461 Ga0207650_100824612 374
488 3300025931 Ga0207644_10000008 Ga0207644_10000008306 374
489 3300025941 Ga0207711_10046928 Ga0207711_100469283 374
490 3300025949 Ga0207667_10020860 Ga0207667_100208606 374
491 3300025949 Ga0207667_10025895 Ga0207667_100258954 374
492 3300025972 Ga0207668_10073193 Ga0207668_100731932 374
493 3300025972 Ga0207668_10075184 Ga0207668_100751842 374
494 3300026035 Ga0207703_10001705 Ga0207703_100017055 374
495 3300028381 Ga0268264_10048396 Ga0268264_100483962 374
496 3300048905 Ga0496102_0110074 Ga0496102_0110074_572_1711 374
497 3300048905 Ga0496102_0199866 Ga0496102_0199866_450_1589 374
498 3300048906 Ga0496103_0223087 Ga0496103_0223087_25_1164 374
499 3300048907 Ga0496104_0031801 Ga0496104_0031801_3198_4337 374
500 3300048908 Ga0496105_0034760 Ga0496105_0034760_1065_2204 374
501 3300048909 Ga0496106_0001005 Ga0496106_0001005_10899_12038 374
502 3300048910 Ga0496107_0001434 Ga0496107_0001434_2487_3626 374
503 3300048912 Ga0496109_0112862 Ga0496109_0112862_1304_2443 374
504 3300048913 Ga0496110_0150920 Ga0496110_0150920_367_1506 374
505 3300048914 Ga0496111_0055275 Ga0496111_0055275_235_1374 374
506 3300048916 Ga0496113_0000970 Ga0496113_0000970_7784_8923 374
507 3300048917 Ga0496114_0004908 Ga0496114_0004908_5749_6888 374
508 3300048924 Ga0496121_0000024 Ga0496121_0000024_359698_360840 374
509 3300048924 Ga0496121_0022659 Ga0496121_0022659_542_1693 374
510 3300048925 Ga0496122_0044305 Ga0496122_0044305_508_1647 374
511 3300048926 Ga0496123_0008421 Ga0496123_0008421_2362_3501 374
512 3300048927 Ga0496124_0000674 Ga0496124_0000674_10132_11271 374
513 3300048927 Ga0496124_0003581 Ga0496124_0003581_12902_14053 374
514 3300048929 Ga0496126_0005924 Ga0496126_0005924_5179_6318 374
515 3300053125 Ga0500618_004968 Ga0500618_004968_1475_2605 374
516 iso_pu_bacteria 2599185359 2600225326 374
517 iso_pu_bacteria 2818991438 2819554058 374
518 iso_pu_bacteria 2818991466 2819713595 374
519 iso_pu_bacteria 2919138771 2919139178 374
520 iso_pu_bacteria 2928526807 2928530103 374
521 iso_pu_bacteria 2928968154 2928969710 374
522 3300005327 Ga0070658_10000458 Ga0070658_100004587 375
523 3300005331 Ga0070670_100003675 Ga0070670_1000036752 375
524 3300005335 Ga0070666_10081160 Ga0070666_100811602 375
525 3300005353 Ga0070669_100000726 Ga0070669_10000072613 375
526 3300005367 Ga0070667_100000238 Ga0070667_10000023828 375
527 3300005548 Ga0070665_100000370 Ga0070665_10000037012 375
528 3300005548 Ga0070665_100001932 Ga0070665_1000019324 375
529 3300005563 Ga0068855_100108910 Ga0068855_1001089103 375
530 3300005616 Ga0068852_100000113 Ga0068852_10000011349 375
531 3300005618 Ga0068864_100007078 Ga0068864_1000070785 375
532 3300005841 Ga0068863_100000138 Ga0068863_10000013835 375
533 3300005841 Ga0068863_100035599 Ga0068863_1000355994 375
534 3300005841 Ga0068863_100082589 Ga0068863_1000825892 375
535 3300005842 Ga0068858_100017464 Ga0068858_1000174642 375
536 3300005843 Ga0068860_100000028 Ga0068860_10000002842 375
537 3300005843 Ga0068860_100067930 Ga0068860_1000679302 375
538 3300005844 Ga0068862_100055446 Ga0068862_1000554463 375
539 3300006048 Ga0075363_100001965 Ga0075363_1000019652 375
540 3300006051 Ga0075364_10002350 Ga0075364_100023505 375
541 3300006177 Ga0075362_10000097 Ga0075362_1000009715 375
542 3300006195 Ga0075366_10000086 Ga0075366_1000008610 375
543 3300006353 Ga0075370_10000026 Ga0075370_1000002625 375
544 3300009011 Ga0105251_10007900 Ga0105251_100079005 375
545 3300009093 Ga0105240_10005105 Ga0105240_100051055 375
546 3300009177 Ga0105248_10037905 Ga0105248_100379053 375
547 3300009553 Ga0105249_10531642 Ga0105249_105316421 375
548 3300017792 Ga0163161_10038097 Ga0163161_100380973 375
549 3300017792 Ga0163161_10060565 Ga0163161_100605652 375
550 3300025298 Ga0209050_1000426 Ga0209050_100042619 375
551 3300025735 Ga0207713_1006187 Ga0207713_10061873 375
552 3300025903 Ga0207680_10056932 Ga0207680_100569322 375
553 3300025904 Ga0207647_10007386 Ga0207647_100073864 375
554 3300025909 Ga0207705_10000007 Ga0207705_10000007186 375
555 3300025913 Ga0207695_10077338 Ga0207695_100773382 375
556 3300025923 Ga0207681_10001532 Ga0207681_1000153213 375
557 3300025931 Ga0207644_10007222 Ga0207644_100072223 375
558 3300025941 Ga0207711_10018707 Ga0207711_100187074 375
559 3300025949 Ga0207667_10093904 Ga0207667_100939043 375
560 3300025961 Ga0207712_10323349 Ga0207712_103233491 375
561 3300025972 Ga0207668_10001925 Ga0207668_100019257 375
562 3300025986 Ga0207658_10000625 Ga0207658_1000062517 375
563 3300025986 Ga0207658_10001396 Ga0207658_100013962 375
564 3300026088 Ga0207641_10000195 Ga0207641_1000019561 375
565 3300026088 Ga0207641_10014892 Ga0207641_100148921 375
566 3300026088 Ga0207641_10035452 Ga0207641_100354522 375
567 3300026095 Ga0207676_10026705 Ga0207676_100267053 375
568 3300026116 Ga0207674_10057678 Ga0207674_100576785 375
569 3300026142 Ga0207698_10000036 Ga0207698_1000003647 375
570 3300027111 Ga0209281_1015308 Ga0209281_10153082 375
571 3300028379 Ga0268266_10000694 Ga0268266_1000069434 375
572 3300028379 Ga0268266_10009905 Ga0268266_100099052 375
573 3300028380 Ga0268265_10131709 Ga0268265_101317092 375
574 3300028381 Ga0268264_10000066 Ga0268264_1000006653 375
575 3300028381 Ga0268264_10012271 Ga0268264_100122713 375
576 3300031616 Ga0307508_10004576 Ga0307508_100045765 375
577 3300032005 Ga0307411_10244623 Ga0307411_102446231 375
578 3300038705 Ga0237819_01392 Ga0237819_01392_120_1259 375
579 3300046452 Ga0495617_037259 Ga0495617_037259_111_1256 375
580 3300046453 Ga0495627_000912 Ga0495627_000912_16575_17720 375
581 3300046500 Ga0495596_0000736 Ga0495596_0000736_16811_17965 375
582 3300046512 Ga0495610_0000206 Ga0495610_0000206_35588_36733 375
583 3300046520 Ga0495637_0006825 Ga0495637_0006825_654_1787 375
584 3300046691 Ga0495670_0096517 Ga0495670_0096517_167_1324 375
585 3300047470 Ga0495681_0000106 Ga0495681_0000106_23234_24379 375
586 3300047472 Ga0495686_0027514 Ga0495686_0027514_2349_3494 375
587 3300047472 Ga0495686_0177568 Ga0495686_0177568_15_1142 375
588 3300048091 Ga0495626_0001664 Ga0495626_0001664_9619_10773 375
589 3300048904 Ga0496101_0186842 Ga0496101_0186842_11_1150 375
590 3300048908 Ga0496105_0000436 Ga0496105_0000436_18444_19619 375
591 3300048919 Ga0496116_0000062 Ga0496116_0000062_42634_43773 375
592 3300048919 Ga0496116_0058621 Ga0496116_0058621_496_1635 375
593 3300048920 Ga0496117_0042297 Ga0496117_0042297_814_1989 375
594 3300048920 Ga0496117_0088922 Ga0496117_0088922_695_1834 375
595 3300048921 Ga0496118_0006969 Ga0496118_0006969_2999_4174 375
596 3300048924 Ga0496121_0002119 Ga0496121_0002119_20216_21355 375
597 3300048924 Ga0496121_0003456 Ga0496121_0003456_6740_7915 375
598 3300048924 Ga0496121_0234814 Ga0496121_0234814_73_1257 375
599 3300048925 Ga0496122_0002041 Ga0496122_0002041_25552_26691 375
600 3300048926 Ga0496123_0000428 Ga0496123_0000428_4123_5262 375
601 3300048927 Ga0496124_0001631 Ga0496124_0001631_22550_23716 375
602 3300048927 Ga0496124_0161244 Ga0496124_0161244_89_1228 375
603 3300048928 Ga0496125_0000663 Ga0496125_0000663_888_2027 375
604 3300048928 Ga0496125_0009305 Ga0496125_0009305_509_1675 375
605 3300048929 Ga0496126_0006947 Ga0496126_0006947_2767_3933 375
606 3300048929 Ga0496126_0093778 Ga0496126_0093778_128_1267 375
607 3300049573 Ga0501037_0044933 Ga0501037_0044933_1439_2578 375
608 3300049823 Ga0501044_0000424 Ga0501044_0000424_36675_37814 375
609 3300050489 nmdc:mga03683_53_c1 nmdc:mga03683_53_c1_16160_17332 375
610 3300050489 nmdc:mga03683_7266_c1 nmdc:mga03683_7266_c1_2105_3244 375
611 3300050490 nmdc:mga03n38_47651_c1 nmdc:mga03n38_47651_c1_22_1194 375
612 3300050491 nmdc:mga00v17_22427_c1 nmdc:mga00v17_22427_c1_1175_2359 375
613 3300050493 nmdc:mga0k408_5_c2 nmdc:mga0k408_5_c2_95681_96853 375
614 3300050496 nmdc:mga07m45_30_c1 nmdc:mga07m45_30_c1_52688_53833 375
615 3300053121 Ga0500607_000009 Ga0500607_000009_52059_53210 375
616 3300053121 Ga0500607_000162 Ga0500607_000162_45418_46557 375
617 3300053136 Ga0500559_0000353 Ga0500559_0000353_32644_33795 375
618 3300053136 Ga0500559_0000540 Ga0500559_0000540_1245_2390 375
619 3300053148 Ga0500590_015582 Ga0500590_015582_1470_2657 375
620 3300053156 Ga0500622_0000924 Ga0500622_0000924_19319_20467 375
621 3300053178 Ga0500637_0002218 Ga0500637_0002218_3844_4989 375
622 3300053730 Ga0500645_037364 Ga0500645_037364_263_1414 375
623 3300048922 Ga0496119_0109473 Ga0496119_0109473_346_1491 376
624 3300048923 Ga0496120_0008554 Ga0496120_0008554_2325_3470 376
625 3300048927 Ga0496124_0000071 Ga0496124_0000071_11530_12675 376
626 3300048929 Ga0496126_0052633 Ga0496126_0052633_120_1265 376
627 iso_pu_bacteria 2775507255 2778124379 376
628 iso_pu_bacteria 3000865235 3000867470 376
629 3300005445 Ga0070708_100226767 Ga0070708_1002267672 377
630 3300005841 Ga0068863_100068810 Ga0068863_1000688103 377
631 3300006042 Ga0075368_10018571 Ga0075368_100185712 378
632 3300006048 Ga0075363_100008368 Ga0075363_1000083684 378
633 3300006178 Ga0075367_10000067 Ga0075367_1000006717 378
634 3300006353 Ga0075370_10178916 Ga0075370_101789161 378
635 3300027866 Ga0209813_10000041 Ga0209813_1000004140 378
636 3300050490 nmdc:mga03n38_38987_c1 nmdc:mga03n38_38987_c1_894_2030 378
637 3300050494 nmdc:mga06z11_9_c1 nmdc:mga06z11_9_c1_15709_16845 378
638 3300050495 nmdc:mga04h51_128_c1 nmdc:mga04h51_128_c1_15700_16836 378
639 3300053730 Ga0500645_005022 Ga0500645_005022_3682_4845 378
640 3300005578 Ga0068854_100050156 Ga0068854_1000501563 379
641 3300005616 Ga0068852_100085589 Ga0068852_1000855892 379
642 3300048919 Ga0496116_0071188 Ga0496116_0071188_596_1792 379
643 3300048920 Ga0496117_0154240 Ga0496117_0154240_203_1342 379
644 3300048924 Ga0496121_0000175 Ga0496121_0000175_70198_71394 379
645 3300048927 Ga0496124_0027468 Ga0496124_0027468_555_1751 379
646 3300053140 Ga0500573_0000029 Ga0500573_0000029_24151_25302 379
647 3300009148 Ga0105243_10253334 Ga0105243_102533342 380
648 3300049574 Ga0501038_0206188 Ga0501038_0206188_202_1353 380
649 2162886007 SwRhRL2b_contig_1296284 SwRhRL2b_0190.00000810 381
650 3300001904 JGI24736J21556_1000271 JGI24736J21556_10002717 381
651 3300001915 JGI24741J21665_1000044 JGI24741J21665_100004413 381
652 3300001979 JGI24740J21852_10000438 JGI24740J21852_1000043812 381
653 3300005289 Ga0065704_10125720 Ga0065704_101257202 381
654 3300005355 Ga0070671_100035026 Ga0070671_1000350263 381
655 3300005466 Ga0070685_10097002 Ga0070685_100970021 381
656 3300005563 Ga0068855_100037943 Ga0068855_1000379431 381
657 3300009545 Ga0105237_10017692 Ga0105237_100176926 381
658 3300009978 Ga0105148_100321 Ga0105148_1003213 381
659 3300010375 Ga0105239_10106211 Ga0105239_101062111 381
660 3300013100 Ga0157373_10113096 Ga0157373_101130961 381
661 3300017792 Ga0163161_10046224 Ga0163161_100462244 381
662 3300025904 Ga0207647_10028997 Ga0207647_100289972 381
663 3300025911 Ga0207654_10042898 Ga0207654_100428982 381
664 3300025913 Ga0207695_10030301 Ga0207695_100303013 381
665 3300025919 Ga0207657_10002424 Ga0207657_100024248 381
666 3300026067 Ga0207678_10001311 Ga0207678_1000131113 381
667 3300026116 Ga0207674_10054413 Ga0207674_100544133 381
668 3300026142 Ga0207698_10022290 Ga0207698_100222905 381
669 3300031548 Ga0307408_100100625 Ga0307408_1001006252 381
670 3300031731 Ga0307405_10036048 Ga0307405_100360482 381
671 3300031852 Ga0307410_10227732 Ga0307410_102277321 381
672 3300031911 Ga0307412_10075331 Ga0307412_100753312 381
673 3300031995 Ga0307409_100278623 Ga0307409_1002786231 381
674 3300032005 Ga0307411_10068934 Ga0307411_100689342 381
675 3300048913 Ga0496110_0082643 Ga0496110_0082643_1419_2564 381
676 3300048925 Ga0496122_0007531 Ga0496122_0007531_5633_6778 381
677 3300048926 Ga0496123_0003949 Ga0496123_0003949_5285_6430 381
678 3300048927 Ga0496124_0005460 Ga0496124_0005460_7764_8909 381
679 3300048927 Ga0496124_0069768 Ga0496124_0069768_1082_2227 381
680 3300048928 Ga0496125_0000445 Ga0496125_0000445_5335_6480 381
681 3300048928 Ga0496125_0104516 Ga0496125_0104516_791_1936 381
682 3300048929 Ga0496126_0108152 Ga0496126_0108152_865_2010 381
683 3300049663 Ga0501223_000084 Ga0501223_000084_2969_4114 381
684 3300049705 Ga0501225_0004209 Ga0501225_0004209_2771_3916 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02350

Epimerase_2

UDP-N-acetylglucosamine 2-epimerase

25

359

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vlc-assembly1.cif.gz_A crystal structure of udp-glcnac 2-epimerase from neisseria meningitidis bound to udp-glcnac 0.9727 1 367
7vz6-assembly1.cif.gz_B the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.9679 2 363
7vza-assembly1.cif.gz_D-3 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp 0.9663 2 363
7vza-assembly1.cif.gz_F-4 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp 0.966 2 363
7vza-assembly1.cif.gz_H-4 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp 0.9656 2 363
ID Description Score Start End Superfamily
5enzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9857 2 177 3.40.50.2000
af_P27828_2_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.982 3 184 3.40.50.2000
af_Q2G1J3_4_329_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9694 4 334 3.40.50.2000
af_P27828_3_337_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9648 4 334 3.90.180.10
af_P27828_2_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9612 3 184 3.40.50.2000
ID Description Score Start End GO Terms
AF-W1X5F7-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) 0.9935 277 356 GO:0008761
AF-A0A645ELD0-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) 0.9859 201 369 GO:0008761
AF-A0A377B7T1-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) 0.9854 47 157 GO:0008761
AF-A0A117LDD0-F1-model_v4 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) 0.9834 1 178 GO:0008761
AF-A0A6I3TBJ2-F1-model_v4 deleted 0.9829 70 150

Feature Viewer

pLDDT pTM Quality
92.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map