F475063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 684 | 339 | 641 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10138102|Ga0307414_101381022 |
| Length | 375 |
| Sequence | MSGRRRILIVFGTRPEAIKLFPLVHALAADARLESRVCVTGQHRELLDQVLTLTGIAPDYDLDIMRAGQSLDSLTSGLLSGLEGVLDEVRPDWVVVQGDTTTAMAAALSAYYRRIPVCHVEAGLRSGDIHQPWPEEVNRKIVGAIATLHCAPTETAARALRAENVDPATIHVTGNTVVDALRWMVARLESQPCLAAGLAELETRFAGKRIVGVTCHRRESFGDGMEAIAAAVRRLAAREDVALILPAHLNPNVRGVMEQLDYPNFVRLLAVSSLILTDSGGVQEEAPALGTPVLVMRETTERYEGVAAGTAKLIGTDPHRIVAEAERLLNDGAAHAVXXXXHNPFGDGRSAARIVELLALSRHERMPDQSRPMLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 7 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 8 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 9 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 10 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 11 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 12 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 13 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 14 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 15 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 16 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 17 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 18 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 19 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 20 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 21 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 22 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 23 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 24 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 25 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 26 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 27 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 28 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 29 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 30 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 31 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 32 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 33 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 34 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 35 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 36 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 37 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 38 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 39 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 40 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 41 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 42 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 43 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 44 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 45 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 49 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 50 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 51 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 54 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 55 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 56 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 215 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 226 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 227 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 281 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 282 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 283 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 284 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 285 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 286 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 287 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 288 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 289 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 320 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 325 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 333 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 334 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 335 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 337 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.27 |
| Metatranscriptomes | 0.44 |
| Isolates | 6.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.06 |
| Nodule | 1.32 |
| Rhizoplane | 4.97 |
| Rhizosphere | 63.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1296284 | 2162886007 | Bacteria | 3281 |
| 2 | SwRhRL2b_contig_2472434 | 2162886007 | Bacteria | 15512 |
| 3 | SwRhRL2b_contig_564562 | 2162886007 | Bacteria | 15552 |
| 4 | JGI24736J21556_1000271 | 3300001904 | Bacteria | 9558 |
| 5 | JGI24741J21665_1000044 | 3300001915 | Bacteria | 30118 |
| 6 | JGI24740J21852_10000438 | 3300001979 | Bacteria | 17777 |
| 7 | JGI24740J21852_10001049 | 3300001979 | Bacteria | 12423 |
| 8 | JGI24739J22299_10003034 | 3300001989 | Bacteria | 6418 |
| 9 | JGI24739J22299_10005696 | 3300001989 | Bacteria | 4720 |
| 10 | JGI24737J22298_10001592 | 3300001990 | Bacteria | 8069 |
| 11 | JGI24737J22298_10032163 | 3300001990 | Bacteria | 1635 |
| 12 | JGI24735J21928_10017734 | 3300002067 | Bacteria | 2200 |
| 13 | JGI24735J21928_10020922 | 3300002067 | Bacteria | 2001 |
| 14 | JGI24751J29686_10000427 | 3300002459 | Bacteria | 13121 |
| 15 | JGI24751J29686_10003145 | 3300002459 | Bacteria | 3325 |
| 16 | JGI25165J46597_1000007 | 3300003214 | Bacteria | 518996 |
| 17 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 18 | rootH2_10140464 | 3300003320 | Bacteria | 1423 |
| 19 | rootL2_10188478 | 3300003322 | Bacteria | 2435 |
| 20 | rootH1_10012774 | 3300003323 | Bacteria | 9119 |
| 21 | rootH1_10066050 | 3300003323 | Bacteria | 1864 |
| 22 | rootH1_10085742 | 3300003323 | Unclassified | 2041 |
| 23 | Ga0055532_1005765 | 3300003758 | Bacteria | 1708 |
| 24 | Ga0055525_1000063 | 3300003759 | Bacteria | 198877 |
| 25 | Ga0055525_1000064 | 3300003759 | Bacteria | 198750 |
| 26 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 27 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 28 | Ga0055530_10000142 | 3300003791 | Bacteria | 64055 |
| 29 | Ga0055531_10000013 | 3300003794 | Bacteria | 187583 |
| 30 | Ga0058863_11813500 | 3300004799 | Bacteria | 1922 |
| 31 | Ga0058862_10285799 | 3300004803 | Bacteria | 1814 |
| 32 | Ga0058862_12261043 | 3300004803 | Bacteria | 1384 |
| 33 | Ga0065165_1002027 | 3300005262 | Bacteria | 18861 |
| 34 | Ga0065165_1010792 | 3300005262 | Bacteria | 3895 |
| 35 | Ga0065704_10070288 | 3300005289 | Bacteria | 39072 |
| 36 | Ga0065704_10070386 | 3300005289 | Bacteria | 27813 |
| 37 | Ga0065704_10125720 | 3300005289 | Bacteria | 1699 |
| 38 | Ga0070658_10000458 | 3300005327 | Bacteria | 35479 |
| 39 | Ga0070658_10001263 | 3300005327 | Bacteria | 21651 |
| 40 | Ga0070683_100028024 | 3300005329 | Bacteria | 5087 |
| 41 | Ga0070670_100003675 | 3300005331 | Bacteria | 12788 |
| 42 | Ga0070670_100016855 | 3300005331 | Bacteria | 6270 |
| 43 | Ga0070670_100131885 | 3300005331 | Bacteria | 2158 |
| 44 | Ga0070666_10000063 | 3300005335 | Bacteria | 80378 |
| 45 | Ga0070666_10081160 | 3300005335 | Bacteria | 2217 |
| 46 | Ga0070680_100053064 | 3300005336 | Bacteria | 3309 |
| 47 | Ga0070660_100011920 | 3300005339 | Bacteria | 6201 |
| 48 | Ga0070661_100001811 | 3300005344 | Bacteria | 14829 |
| 49 | Ga0070661_100052797 | 3300005344 | Bacteria | 2975 |
| 50 | Ga0070661_100069085 | 3300005344 | Bacteria | 2597 |
| 51 | Ga0070668_100032130 | 3300005347 | Bacteria | 3995 |
| 52 | Ga0070668_100183610 | 3300005347 | Bacteria | 1710 |
| 53 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 54 | Ga0070669_100000077 | 3300005353 | Bacteria | 95577 |
| 55 | Ga0070669_100000423 | 3300005353 | Bacteria | 32372 |
| 56 | Ga0070669_100000726 | 3300005353 | Bacteria | 24090 |
| 57 | Ga0070671_100000002 | 3300005355 | Bacteria | 292733 |
| 58 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 59 | Ga0070671_100003536 | 3300005355 | Bacteria | 12218 |
| 60 | Ga0070671_100035026 | 3300005355 | Bacteria | 4158 |
| 61 | Ga0070674_100013512 | 3300005356 | Bacteria | 5050 |
| 62 | Ga0070659_100038005 | 3300005366 | Bacteria | 3753 |
| 63 | Ga0070659_100053298 | 3300005366 | Bacteria | 3183 |
| 64 | Ga0070667_100000238 | 3300005367 | Bacteria | 62518 |
| 65 | Ga0070667_100063882 | 3300005367 | Bacteria | 3122 |
| 66 | Ga0070667_100080939 | 3300005367 | Bacteria | 2779 |
| 67 | Ga0070708_100226767 | 3300005445 | Bacteria | 1753 |
| 68 | Ga0070663_100009643 | 3300005455 | Bacteria | 5988 |
| 69 | Ga0070663_100054491 | 3300005455 | Bacteria | 2858 |
| 70 | Ga0070678_100007083 | 3300005456 | Bacteria | 6630 |
| 71 | Ga0070678_100025533 | 3300005456 | Bacteria | 3977 |
| 72 | Ga0070678_100099922 | 3300005456 | Bacteria | 2246 |
| 73 | Ga0070662_100003535 | 3300005457 | Bacteria | 9746 |
| 74 | Ga0070662_100034943 | 3300005457 | Bacteria | 3546 |
| 75 | Ga0068867_100077194 | 3300005459 | Bacteria | 2502 |
| 76 | Ga0070685_10097002 | 3300005466 | Bacteria | 1794 |
| 77 | Ga0070679_100000477 | 3300005530 | Bacteria | 34238 |
| 78 | Ga0070679_100042935 | 3300005530 | Bacteria | 4504 |
| 79 | Ga0068853_100063786 | 3300005539 | Bacteria | 3192 |
| 80 | Ga0068853_100081038 | 3300005539 | Bacteria | 2841 |
| 81 | Ga0070686_100008649 | 3300005544 | Bacteria | 5704 |
| 82 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 83 | Ga0070665_100000370 | 3300005548 | Bacteria | 66870 |
| 84 | Ga0070665_100001932 | 3300005548 | Bacteria | 23351 |
| 85 | Ga0070665_100011384 | 3300005548 | Bacteria | 8994 |
| 86 | Ga0070665_100015283 | 3300005548 | Bacteria | 7707 |
| 87 | Ga0070665_100050344 | 3300005548 | Bacteria | 4180 |
| 88 | Ga0068855_100007186 | 3300005563 | Bacteria | 13515 |
| 89 | Ga0068855_100029104 | 3300005563 | Bacteria | 6605 |
| 90 | Ga0068855_100037943 | 3300005563 | Bacteria | 5726 |
| 91 | Ga0068855_100092884 | 3300005563 | Bacteria | 3480 |
| 92 | Ga0068855_100108910 | 3300005563 | Bacteria | 3182 |
| 93 | Ga0068855_100126307 | 3300005563 | Bacteria | 2924 |
| 94 | Ga0068857_100037369 | 3300005577 | Bacteria | 4301 |
| 95 | Ga0068854_100050156 | 3300005578 | Bacteria | 2985 |
| 96 | Ga0068852_100000113 | 3300005616 | Bacteria | 54686 |
| 97 | Ga0068852_100044666 | 3300005616 | Bacteria | 3765 |
| 98 | Ga0068852_100085589 | 3300005616 | Bacteria | 2809 |
| 99 | Ga0068852_100158573 | 3300005616 | Bacteria | 2110 |
| 100 | Ga0068859_100001555 | 3300005617 | Bacteria | 23417 |
| 101 | Ga0068859_100006288 | 3300005617 | Bacteria | 12042 |
| 102 | Ga0068864_100001523 | 3300005618 | Bacteria | 19059 |
| 103 | Ga0068864_100005624 | 3300005618 | Bacteria | 10274 |
| 104 | Ga0068864_100007078 | 3300005618 | Bacteria | 9211 |
| 105 | Ga0068864_100247791 | 3300005618 | Bacteria | 1653 |
| 106 | Ga0068861_100001689 | 3300005719 | Bacteria | 14165 |
| 107 | Ga0068861_100192920 | 3300005719 | Bacteria | 1704 |
| 108 | Ga0068861_100238438 | 3300005719 | Bacteria | 1546 |
| 109 | Ga0068851_10026884 | 3300005834 | Bacteria | 2831 |
| 110 | Ga0068863_100000138 | 3300005841 | Bacteria | 77596 |
| 111 | Ga0068863_100035599 | 3300005841 | Bacteria | 4741 |
| 112 | Ga0068863_100068810 | 3300005841 | Bacteria | 3349 |
| 113 | Ga0068863_100082589 | 3300005841 | Bacteria | 3045 |
| 114 | Ga0068863_100207587 | 3300005841 | Bacteria | 1886 |
| 115 | Ga0068858_100000112 | 3300005842 | Bacteria | 86034 |
| 116 | Ga0068858_100000548 | 3300005842 | Bacteria | 39141 |
| 117 | Ga0068858_100003643 | 3300005842 | Bacteria | 15236 |
| 118 | Ga0068858_100007448 | 3300005842 | Bacteria | 10580 |
| 119 | Ga0068858_100017464 | 3300005842 | Bacteria | 6730 |
| 120 | Ga0068858_100043946 | 3300005842 | Bacteria | 4142 |
| 121 | Ga0068860_100000028 | 3300005843 | Bacteria | 266461 |
| 122 | Ga0068860_100001423 | 3300005843 | Bacteria | 25915 |
| 123 | Ga0068860_100049202 | 3300005843 | Bacteria | 4016 |
| 124 | Ga0068860_100067930 | 3300005843 | Bacteria | 3386 |
| 125 | Ga0068860_100228458 | 3300005843 | Bacteria | 1808 |
| 126 | Ga0068862_100000961 | 3300005844 | Bacteria | 27762 |
| 127 | Ga0068862_100002849 | 3300005844 | Bacteria | 15163 |
| 128 | Ga0068862_100055446 | 3300005844 | Bacteria | 3395 |
| 129 | Ga0081540_1000026 | 3300005983 | Bacteria | 155402 |
| 130 | Ga0075365_10001984 | 3300006038 | Bacteria | 9680 |
| 131 | Ga0075368_10003690 | 3300006042 | Bacteria | 5141 |
| 132 | Ga0075368_10018571 | 3300006042 | Bacteria | 2613 |
| 133 | Ga0075363_100001965 | 3300006048 | Bacteria | 8167 |
| 134 | Ga0075363_100004524 | 3300006048 | Bacteria | 6095 |
| 135 | Ga0075363_100008368 | 3300006048 | Bacteria | 4813 |
| 136 | Ga0075364_10002350 | 3300006051 | Bacteria | 10619 |
| 137 | Ga0075364_10010179 | 3300006051 | Bacteria | 5672 |
| 138 | Ga0075432_10011905 | 3300006058 | Bacteria | 2956 |
| 139 | Ga0075362_10000097 | 3300006177 | Bacteria | 24704 |
| 140 | Ga0075362_10000263 | 3300006177 | Bacteria | 14705 |
| 141 | Ga0075367_10000067 | 3300006178 | Bacteria | 26232 |
| 142 | Ga0075367_10004271 | 3300006178 | Bacteria | 6947 |
| 143 | Ga0075366_10000086 | 3300006195 | Bacteria | 36542 |
| 144 | Ga0075366_10079273 | 3300006195 | Bacteria | 1960 |
| 145 | Ga0097621_100006920 | 3300006237 | Bacteria | 8074 |
| 146 | Ga0075370_10000026 | 3300006353 | Bacteria | 51806 |
| 147 | Ga0075370_10178916 | 3300006353 | Bacteria | 1248 |
| 148 | Ga0097620_100001555 | 3300006931 | Bacteria | 23417 |
| 149 | Ga0097620_100006288 | 3300006931 | Bacteria | 12042 |
| 150 | Ga0105251_10007900 | 3300009011 | Bacteria | 6467 |
| 151 | Ga0105240_10005105 | 3300009093 | Bacteria | 19655 |
| 152 | Ga0105245_10002027 | 3300009098 | Bacteria | 18376 |
| 153 | Ga0105247_10004847 | 3300009101 | Bacteria | 8557 |
| 154 | Ga0105243_10000221 | 3300009148 | Bacteria | 66335 |
| 155 | Ga0105243_10123527 | 3300009148 | Bacteria | 2186 |
| 156 | Ga0105243_10253334 | 3300009148 | Bacteria | 1573 |
| 157 | Ga0105241_10024346 | 3300009174 | Bacteria | 4495 |
| 158 | Ga0105242_10227042 | 3300009176 | Bacteria | 1671 |
| 159 | Ga0105248_10010649 | 3300009177 | Bacteria | 10143 |
| 160 | Ga0105248_10023982 | 3300009177 | Bacteria | 6782 |
| 161 | Ga0105248_10037905 | 3300009177 | Bacteria | 5393 |
| 162 | Ga0105237_10017692 | 3300009545 | Bacteria | 7388 |
| 163 | Ga0105237_10097605 | 3300009545 | Bacteria | 2929 |
| 164 | Ga0105238_10018856 | 3300009551 | Bacteria | 7023 |
| 165 | Ga0105238_10049742 | 3300009551 | Bacteria | 4221 |
| 166 | Ga0105249_10002466 | 3300009553 | Bacteria | 16038 |
| 167 | Ga0105249_10531642 | 3300009553 | Bacteria | 1224 |
| 168 | Ga0105148_100321 | 3300009978 | Bacteria | 6136 |
| 169 | Ga0105239_10106211 | 3300010375 | Bacteria | 3110 |
| 170 | Ga0105246_10000017 | 3300011119 | Bacteria | 65095 |
| 171 | Ga0157373_10097451 | 3300013100 | Bacteria | 2070 |
| 172 | Ga0157373_10113096 | 3300013100 | Bacteria | 1908 |
| 173 | Ga0157373_10121426 | 3300013100 | Bacteria | 1836 |
| 174 | Ga0157371_10000256 | 3300013102 | Bacteria | 73768 |
| 175 | Ga0157370_10078014 | 3300013104 | Bacteria | 3119 |
| 176 | Ga0157369_10101664 | 3300013105 | Bacteria | 3063 |
| 177 | Ga0157369_10493612 | 3300013105 | Bacteria | 1267 |
| 178 | Ga0157374_10154933 | 3300013296 | Bacteria | 2229 |
| 179 | Ga0157378_10148944 | 3300013297 | Bacteria | 2179 |
| 180 | Ga0163162_10004312 | 3300013306 | Bacteria | 13698 |
| 181 | Ga0163162_10198392 | 3300013306 | Bacteria | 2135 |
| 182 | Ga0163162_10248643 | 3300013306 | Bacteria | 1910 |
| 183 | Ga0163162_10312879 | 3300013306 | Bacteria | 1703 |
| 184 | Ga0163163_10130559 | 3300014325 | Bacteria | 2552 |
| 185 | Ga0157380_10101493 | 3300014326 | Bacteria | 2397 |
| 186 | Ga0163161_10024052 | 3300017792 | Bacteria | 4300 |
| 187 | Ga0163161_10038097 | 3300017792 | Bacteria | 3447 |
| 188 | Ga0163161_10046224 | 3300017792 | Bacteria | 3140 |
| 189 | Ga0163161_10060565 | 3300017792 | Bacteria | 2755 |
| 190 | Ga0209147_102334 | 3300025229 | Bacteria | 4884 |
| 191 | Ga0209563_100066 | 3300025230 | Bacteria | 257382 |
| 192 | Ga0209677_109817 | 3300025253 | Bacteria | 1669 |
| 193 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 194 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 195 | Ga0209233_1017965 | 3300025261 | Bacteria | 1915 |
| 196 | Ga0209565_1000107 | 3300025263 | Bacteria | 120938 |
| 197 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 198 | Ga0209673_1022176 | 3300025273 | Bacteria | 2198 |
| 199 | Ga0209676_1008112 | 3300025292 | Bacteria | 4761 |
| 200 | Ga0209564_1000204 | 3300025295 | Bacteria | 136175 |
| 201 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 202 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 203 | Ga0209050_1000426 | 3300025298 | Bacteria | 77545 |
| 204 | Ga0209050_1013474 | 3300025298 | Bacteria | 3624 |
| 205 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 206 | Ga0207697_10049823 | 3300025315 | Bacteria | 1729 |
| 207 | Ga0207696_1008420 | 3300025711 | Bacteria | 3947 |
| 208 | Ga0207713_1006187 | 3300025735 | Bacteria | 7342 |
| 209 | Ga0207713_1036975 | 3300025735 | Bacteria | 2088 |
| 210 | Ga0207680_10000033 | 3300025903 | Bacteria | 77177 |
| 211 | Ga0207680_10021991 | 3300025903 | Bacteria | 3462 |
| 212 | Ga0207680_10056932 | 3300025903 | Bacteria | 2363 |
| 213 | Ga0207647_10007386 | 3300025904 | Bacteria | 7945 |
| 214 | Ga0207647_10028997 | 3300025904 | Bacteria | 3587 |
| 215 | Ga0207647_10055392 | 3300025904 | Bacteria | 2437 |
| 216 | Ga0207647_10063402 | 3300025904 | Bacteria | 2248 |
| 217 | Ga0207699_10040931 | 3300025906 | Bacteria | 2673 |
| 218 | Ga0207645_10024318 | 3300025907 | Bacteria | 3929 |
| 219 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 220 | Ga0207705_10001400 | 3300025909 | Bacteria | 19231 |
| 221 | Ga0207654_10002236 | 3300025911 | Bacteria | 9928 |
| 222 | Ga0207654_10042898 | 3300025911 | Bacteria | 2562 |
| 223 | Ga0207695_10030301 | 3300025913 | Bacteria | 5958 |
| 224 | Ga0207695_10077338 | 3300025913 | Bacteria | 3380 |
| 225 | Ga0207671_10006254 | 3300025914 | Bacteria | 10666 |
| 226 | Ga0207671_10036212 | 3300025914 | Bacteria | 3659 |
| 227 | Ga0207660_10081861 | 3300025917 | Bacteria | 2374 |
| 228 | Ga0207657_10001703 | 3300025919 | Bacteria | 23699 |
| 229 | Ga0207657_10002424 | 3300025919 | Bacteria | 20139 |
| 230 | Ga0207657_10003493 | 3300025919 | Bacteria | 16779 |
| 231 | Ga0207649_10001206 | 3300025920 | Bacteria | 15590 |
| 232 | Ga0207652_10000338 | 3300025921 | Bacteria | 48779 |
| 233 | Ga0207652_10064532 | 3300025921 | Bacteria | 3169 |
| 234 | Ga0207652_10302417 | 3300025921 | Bacteria | 1444 |
| 235 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 236 | Ga0207681_10000081 | 3300025923 | Bacteria | 85588 |
| 237 | Ga0207681_10000686 | 3300025923 | Bacteria | 22255 |
| 238 | Ga0207681_10001532 | 3300025923 | Bacteria | 14888 |
| 239 | Ga0207694_10002822 | 3300025924 | Bacteria | 14021 |
| 240 | Ga0207694_10022950 | 3300025924 | Bacteria | 4734 |
| 241 | Ga0207650_10013827 | 3300025925 | Bacteria | 5597 |
| 242 | Ga0207650_10052526 | 3300025925 | Bacteria | 3019 |
| 243 | Ga0207650_10082461 | 3300025925 | Bacteria | 2441 |
| 244 | Ga0207659_10045406 | 3300025926 | Bacteria | 3098 |
| 245 | Ga0207687_10002295 | 3300025927 | Bacteria | 13027 |
| 246 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 247 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 248 | Ga0207644_10001054 | 3300025931 | Bacteria | 17637 |
| 249 | Ga0207644_10007222 | 3300025931 | Bacteria | 7228 |
| 250 | Ga0207690_10000416 | 3300025932 | Bacteria | 27810 |
| 251 | Ga0207706_10000873 | 3300025933 | Bacteria | 31009 |
| 252 | Ga0207706_10024086 | 3300025933 | Bacteria | 5460 |
| 253 | Ga0207706_10025187 | 3300025933 | Bacteria | 5333 |
| 254 | Ga0207706_10048202 | 3300025933 | Bacteria | 3768 |
| 255 | Ga0207709_10000078 | 3300025935 | Bacteria | 169141 |
| 256 | Ga0207709_10013047 | 3300025935 | Bacteria | 4581 |
| 257 | Ga0207669_10000105 | 3300025937 | Bacteria | 42248 |
| 258 | Ga0207711_10018707 | 3300025941 | Bacteria | 5759 |
| 259 | Ga0207711_10027277 | 3300025941 | Bacteria | 4797 |
| 260 | Ga0207711_10046928 | 3300025941 | Bacteria | 3691 |
| 261 | Ga0207661_10074809 | 3300025944 | Bacteria | 2777 |
| 262 | Ga0207679_10022412 | 3300025945 | Bacteria | 4300 |
| 263 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 264 | Ga0207667_10005620 | 3300025949 | Bacteria | 15300 |
| 265 | Ga0207667_10020860 | 3300025949 | Bacteria | 7274 |
| 266 | Ga0207667_10023071 | 3300025949 | Bacteria | 6857 |
| 267 | Ga0207667_10025895 | 3300025949 | Bacteria | 6417 |
| 268 | Ga0207667_10093904 | 3300025949 | Bacteria | 3098 |
| 269 | Ga0207667_10286434 | 3300025949 | Bacteria | 1683 |
| 270 | Ga0207712_10323349 | 3300025961 | Bacteria | 1273 |
| 271 | Ga0207668_10001925 | 3300025972 | Bacteria | 12151 |
| 272 | Ga0207668_10018228 | 3300025972 | Bacteria | 4412 |
| 273 | Ga0207668_10073193 | 3300025972 | Bacteria | 2455 |
| 274 | Ga0207668_10075184 | 3300025972 | Bacteria | 2428 |
| 275 | Ga0207640_10001151 | 3300025981 | Bacteria | 14526 |
| 276 | Ga0207658_10000625 | 3300025986 | Bacteria | 31264 |
| 277 | Ga0207658_10000927 | 3300025986 | Bacteria | 24275 |
| 278 | Ga0207658_10001337 | 3300025986 | Bacteria | 19310 |
| 279 | Ga0207658_10001396 | 3300025986 | Bacteria | 18830 |
| 280 | Ga0207658_10029544 | 3300025986 | Bacteria | 3872 |
| 281 | Ga0207703_10001705 | 3300026035 | Bacteria | 19734 |
| 282 | Ga0207703_10001786 | 3300026035 | Bacteria | 19182 |
| 283 | Ga0207703_10002992 | 3300026035 | Bacteria | 14332 |
| 284 | Ga0207703_10012751 | 3300026035 | Bacteria | 6554 |
| 285 | Ga0207703_10183690 | 3300026035 | Bacteria | 1847 |
| 286 | Ga0207639_10000665 | 3300026041 | Bacteria | 23726 |
| 287 | Ga0207639_10002958 | 3300026041 | Bacteria | 11421 |
| 288 | Ga0207639_10166119 | 3300026041 | Bacteria | 1865 |
| 289 | Ga0207678_10001311 | 3300026067 | Bacteria | 23031 |
| 290 | Ga0207678_10002144 | 3300026067 | Bacteria | 17875 |
| 291 | Ga0207678_10054487 | 3300026067 | Bacteria | 3444 |
| 292 | Ga0207702_10003566 | 3300026078 | Bacteria | 14153 |
| 293 | Ga0207641_10000195 | 3300026088 | Bacteria | 82043 |
| 294 | Ga0207641_10003062 | 3300026088 | Bacteria | 15071 |
| 295 | Ga0207641_10014892 | 3300026088 | Bacteria | 6376 |
| 296 | Ga0207641_10035452 | 3300026088 | Bacteria | 4156 |
| 297 | Ga0207676_10003572 | 3300026095 | Bacteria | 10988 |
| 298 | Ga0207676_10025481 | 3300026095 | Bacteria | 4388 |
| 299 | Ga0207676_10026705 | 3300026095 | Bacteria | 4294 |
| 300 | Ga0207674_10006869 | 3300026116 | Bacteria | 13342 |
| 301 | Ga0207674_10050630 | 3300026116 | Bacteria | 4242 |
| 302 | Ga0207674_10054413 | 3300026116 | Bacteria | 4074 |
| 303 | Ga0207674_10057678 | 3300026116 | Bacteria | 3936 |
| 304 | Ga0207674_10117778 | 3300026116 | Bacteria | 2626 |
| 305 | Ga0207675_100003247 | 3300026118 | Bacteria | 15934 |
| 306 | Ga0207675_100100319 | 3300026118 | Bacteria | 2727 |
| 307 | Ga0207683_10000156 | 3300026121 | Bacteria | 57349 |
| 308 | Ga0207683_10040858 | 3300026121 | Bacteria | 4049 |
| 309 | Ga0207683_10158838 | 3300026121 | Bacteria | 2043 |
| 310 | Ga0207698_10000036 | 3300026142 | Bacteria | 105391 |
| 311 | Ga0207698_10003251 | 3300026142 | Bacteria | 9763 |
| 312 | Ga0207698_10022290 | 3300026142 | Bacteria | 4397 |
| 313 | Ga0209281_1015308 | 3300027111 | Bacteria | 1602 |
| 314 | Ga0209813_10000041 | 3300027866 | Bacteria | 53753 |
| 315 | Ga0209813_10000561 | 3300027866 | Bacteria | 8710 |
| 316 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 317 | Ga0268266_10000694 | 3300028379 | Bacteria | 45342 |
| 318 | Ga0268266_10004341 | 3300028379 | Bacteria | 13625 |
| 319 | Ga0268266_10009905 | 3300028379 | Bacteria | 8375 |
| 320 | Ga0268265_10000116 | 3300028380 | Bacteria | 100689 |
| 321 | Ga0268265_10019442 | 3300028380 | Bacteria | 4721 |
| 322 | Ga0268265_10131709 | 3300028380 | Bacteria | 2079 |
| 323 | Ga0268264_10000066 | 3300028381 | Bacteria | 285125 |
| 324 | Ga0268264_10000116 | 3300028381 | Bacteria | 198591 |
| 325 | Ga0268264_10012271 | 3300028381 | Bacteria | 7050 |
| 326 | Ga0268264_10016598 | 3300028381 | Bacteria | 6029 |
| 327 | Ga0268264_10048396 | 3300028381 | Bacteria | 3537 |
| 328 | Ga0268264_10189681 | 3300028381 | Bacteria | 1873 |
| 329 | Ga0307517_10010772 | 3300028786 | Bacteria | 12748 |
| 330 | Ga0307517_10036027 | 3300028786 | Bacteria | 5579 |
| 331 | Ga0307513_10027931 | 3300031456 | Bacteria | 6466 |
| 332 | Ga0307513_10076986 | 3300031456 | Bacteria | 3457 |
| 333 | Ga0307408_100100625 | 3300031548 | Bacteria | 2201 |
| 334 | Ga0307408_100261493 | 3300031548 | Bacteria | 1432 |
| 335 | Ga0307508_10000760 | 3300031616 | Bacteria | 38152 |
| 336 | Ga0307508_10004576 | 3300031616 | Bacteria | 13462 |
| 337 | Ga0307405_10036048 | 3300031731 | Bacteria | 2961 |
| 338 | Ga0307413_10003252 | 3300031824 | Bacteria | 6807 |
| 339 | Ga0307410_10026102 | 3300031852 | Bacteria | 3673 |
| 340 | Ga0307410_10053535 | 3300031852 | Bacteria | 2731 |
| 341 | Ga0307410_10227732 | 3300031852 | Bacteria | 1437 |
| 342 | Ga0307406_10303404 | 3300031901 | Bacteria | 1228 |
| 343 | Ga0307407_10047125 | 3300031903 | Bacteria | 2444 |
| 344 | Ga0307412_10032106 | 3300031911 | Bacteria | 3323 |
| 345 | Ga0307412_10033332 | 3300031911 | Bacteria | 3273 |
| 346 | Ga0307412_10075331 | 3300031911 | Bacteria | 2314 |
| 347 | Ga0307412_10114465 | 3300031911 | Bacteria | 1931 |
| 348 | Ga0307412_10184482 | 3300031911 | Bacteria | 1572 |
| 349 | Ga0307409_100278623 | 3300031995 | Bacteria | 1544 |
| 350 | Ga0307416_100071782 | 3300032002 | Bacteria | 2878 |
| 351 | Ga0307416_100419063 | 3300032002 | Bacteria | 1382 |
| 352 | Ga0307414_10000790 | 3300032004 | Bacteria | 16166 |
| 353 | Ga0307414_10054547 | 3300032004 | Bacteria | 2794 |
| 354 | Ga0307414_10086771 | 3300032004 | Bacteria | 2310 |
| 355 | Ga0307414_10138102 | 3300032004 | Bacteria | 1904 |
| 356 | Ga0307411_10068934 | 3300032005 | Bacteria | 2386 |
| 357 | Ga0307411_10233185 | 3300032005 | Bacteria | 1436 |
| 358 | Ga0307411_10244623 | 3300032005 | Bacteria | 1407 |
| 359 | Ga0316583_10000363 | 3300032133 | Bacteria | 13005 |
| 360 | Ga0307510_10001089 | 3300033180 | Bacteria | 28935 |
| 361 | Ga0316582_0013913 | 3300036647 | Bacteria | 4547 |
| 362 | Ga0316584_0069938 | 3300036712 | Bacteria | 2632 |
| 363 | Ga0395905_0284562 | 3300037471 | Bacteria | 1540 |
| 364 | Ga0237819_01392 | 3300038705 | Bacteria | 6322 |
| 365 | Ga0439436_0030435 | 3300041404 | Bacteria | 1568 |
| 366 | Ga0439461_0000031 | 3300041410 | Bacteria | 17424 |
| 367 | Ga0439465_0007320 | 3300041413 | Bacteria | 3504 |
| 368 | Ga0439431_0001137 | 3300041997 | Bacteria | 5792 |
| 369 | Ga0439442_004151 | 3300042002 | Bacteria | 2873 |
| 370 | Ga0439445_0017859 | 3300042004 | Bacteria | 1756 |
| 371 | Ga0439432_007499 | 3300042006 | Bacteria | 3864 |
| 372 | Ga0439457_012139 | 3300042014 | Bacteria | 1946 |
| 373 | Ga0439462_0000502 | 3300042015 | Bacteria | 7701 |
| 374 | Ga0439462_0003732 | 3300042015 | Bacteria | 3673 |
| 375 | Ga0450909_003736 | 3300042185 | Bacteria | 2161 |
| 376 | Ga0439434_0000478 | 3300042435 | Bacteria | 11374 |
| 377 | Ga0466960_0036153 | 3300044901 | Bacteria | 2312 |
| 378 | Ga0495617_037259 | 3300046452 | Bacteria | 1629 |
| 379 | Ga0495627_000332 | 3300046453 | Bacteria | 45347 |
| 380 | Ga0495627_000912 | 3300046453 | Bacteria | 20485 |
| 381 | Ga0495627_001246 | 3300046453 | Bacteria | 15798 |
| 382 | Ga0495638_0000016 | 3300046460 | Bacteria | 396505 |
| 383 | Ga0495638_0001684 | 3300046460 | Bacteria | 19543 |
| 384 | Ga0495650_0000172 | 3300046471 | Bacteria | 142776 |
| 385 | Ga0495650_0003342 | 3300046471 | Bacteria | 11810 |
| 386 | Ga0495584_0029998 | 3300046491 | Bacteria | 2756 |
| 387 | Ga0495585_0076161 | 3300046492 | Bacteria | 1823 |
| 388 | Ga0495596_0000081 | 3300046500 | Bacteria | 65577 |
| 389 | Ga0495596_0000736 | 3300046500 | Bacteria | 20185 |
| 390 | Ga0495596_0044070 | 3300046500 | Bacteria | 1757 |
| 391 | Ga0495607_0007283 | 3300046501 | Bacteria | 7675 |
| 392 | Ga0495607_0035520 | 3300046501 | Bacteria | 3014 |
| 393 | Ga0495583_0000094 | 3300046506 | Bacteria | 153549 |
| 394 | Ga0495583_0004093 | 3300046506 | Bacteria | 10699 |
| 395 | Ga0495583_0005984 | 3300046506 | Bacteria | 8072 |
| 396 | Ga0495583_0011180 | 3300046506 | Bacteria | 5171 |
| 397 | Ga0495583_0015588 | 3300046506 | Bacteria | 4126 |
| 398 | Ga0495606_0000365 | 3300046507 | Bacteria | 77476 |
| 399 | Ga0495606_0023468 | 3300046507 | Bacteria | 4468 |
| 400 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 401 | Ga0495610_0000206 | 3300046512 | Bacteria | 65469 |
| 402 | Ga0495610_0000972 | 3300046512 | Bacteria | 26489 |
| 403 | Ga0495616_0000452 | 3300046513 | Bacteria | 31314 |
| 404 | Ga0495632_0001802 | 3300046519 | Bacteria | 17286 |
| 405 | Ga0495632_0002004 | 3300046519 | Bacteria | 16084 |
| 406 | Ga0495632_0005315 | 3300046519 | Bacteria | 8552 |
| 407 | Ga0495632_0042462 | 3300046519 | Bacteria | 2278 |
| 408 | Ga0495637_0003849 | 3300046520 | Bacteria | 7874 |
| 409 | Ga0495637_0006825 | 3300046520 | Bacteria | 5709 |
| 410 | Ga0495643_0000014 | 3300046522 | Bacteria | 314632 |
| 411 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 412 | Ga0495643_0001836 | 3300046522 | Bacteria | 18055 |
| 413 | Ga0495643_0009066 | 3300046522 | Bacteria | 6236 |
| 414 | Ga0495643_0011300 | 3300046522 | Bacteria | 5446 |
| 415 | Ga0495643_0022498 | 3300046522 | Bacteria | 3596 |
| 416 | Ga0495643_0036974 | 3300046522 | Bacteria | 2680 |
| 417 | Ga0495648_0000013 | 3300046524 | Bacteria | 289090 |
| 418 | Ga0495648_0000501 | 3300046524 | Bacteria | 42180 |
| 419 | Ga0495648_0045238 | 3300046524 | Bacteria | 2740 |
| 420 | Ga0495648_0067753 | 3300046524 | Bacteria | 2086 |
| 421 | Ga0495648_0154526 | 3300046524 | Bacteria | 1193 |
| 422 | Ga0495663_0000007 | 3300046525 | Bacteria | 262438 |
| 423 | Ga0495598_0003152 | 3300046537 | Bacteria | 3475 |
| 424 | Ga0495609_0020344 | 3300046538 | Bacteria | 3067 |
| 425 | Ga0495597_0018172 | 3300046542 | Bacteria | 3302 |
| 426 | Ga0495633_0000776 | 3300046558 | Bacteria | 28552 |
| 427 | Ga0495633_0001991 | 3300046558 | Bacteria | 14788 |
| 428 | Ga0495633_0003613 | 3300046558 | Bacteria | 10229 |
| 429 | Ga0495668_0000080 | 3300046616 | Bacteria | 157259 |
| 430 | Ga0495611_0006680 | 3300046648 | Bacteria | 4908 |
| 431 | Ga0495611_0069745 | 3300046648 | Bacteria | 1606 |
| 432 | Ga0495625_0000541 | 3300046660 | Bacteria | 55446 |
| 433 | Ga0495625_0003065 | 3300046660 | Bacteria | 17111 |
| 434 | Ga0495625_0009642 | 3300046660 | Bacteria | 8051 |
| 435 | Ga0495625_0012318 | 3300046660 | Bacteria | 6935 |
| 436 | Ga0495625_0050256 | 3300046660 | Bacteria | 2992 |
| 437 | Ga0495625_0135383 | 3300046660 | Bacteria | 1666 |
| 438 | Ga0495625_0167962 | 3300046660 | Bacteria | 1466 |
| 439 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 440 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 441 | Ga0495670_0096517 | 3300046691 | Bacteria | 1518 |
| 442 | Ga0495671_0000018 | 3300046692 | Bacteria | 291470 |
| 443 | Ga0495671_0000058 | 3300046692 | Bacteria | 113487 |
| 444 | Ga0495649_0005497 | 3300046694 | Bacteria | 8040 |
| 445 | Ga0495649_0048988 | 3300046694 | Bacteria | 2295 |
| 446 | Ga0495683_0001912 | 3300047323 | Bacteria | 13009 |
| 447 | Ga0495683_0058445 | 3300047323 | Bacteria | 1915 |
| 448 | Ga0495687_000077 | 3300047443 | Bacteria | 148889 |
| 449 | Ga0495687_000082 | 3300047443 | Bacteria | 147137 |
| 450 | Ga0495677_0002800 | 3300047445 | Bacteria | 6804 |
| 451 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 452 | Ga0495681_0000106 | 3300047470 | Bacteria | 72369 |
| 453 | Ga0495681_0001939 | 3300047470 | Bacteria | 15140 |
| 454 | Ga0495681_0005700 | 3300047470 | Bacteria | 8288 |
| 455 | Ga0495681_0007579 | 3300047470 | Bacteria | 6904 |
| 456 | Ga0495686_0027514 | 3300047472 | Bacteria | 3711 |
| 457 | Ga0495686_0177568 | 3300047472 | Bacteria | 1236 |
| 458 | Ga0495615_0000174 | 3300048090 | Bacteria | 15921 |
| 459 | Ga0495626_0001664 | 3300048091 | Bacteria | 17158 |
| 460 | Ga0496100_0301426 | 3300048903 | Bacteria | 1199 |
| 461 | Ga0496101_0186842 | 3300048904 | Bacteria | 1598 |
| 462 | Ga0496102_0000316 | 3300048905 | Bacteria | 60628 |
| 463 | Ga0496102_0001730 | 3300048905 | Bacteria | 19110 |
| 464 | Ga0496102_0110074 | 3300048905 | Bacteria | 2567 |
| 465 | Ga0496102_0199866 | 3300048905 | Bacteria | 1884 |
| 466 | Ga0496103_0000166 | 3300048906 | Bacteria | 69117 |
| 467 | Ga0496103_0000866 | 3300048906 | Bacteria | 22006 |
| 468 | Ga0496103_0035392 | 3300048906 | Bacteria | 3057 |
| 469 | Ga0496103_0223087 | 3300048906 | Bacteria | 1212 |
| 470 | Ga0496104_0000165 | 3300048907 | Bacteria | 58816 |
| 471 | Ga0496104_0018518 | 3300048907 | Bacteria | 6353 |
| 472 | Ga0496104_0028227 | 3300048907 | Bacteria | 5201 |
| 473 | Ga0496104_0031801 | 3300048907 | Bacteria | 4909 |
| 474 | Ga0496105_0000299 | 3300048908 | Bacteria | 32663 |
| 475 | Ga0496105_0000436 | 3300048908 | Bacteria | 27341 |
| 476 | Ga0496105_0003952 | 3300048908 | Bacteria | 11089 |
| 477 | Ga0496105_0034760 | 3300048908 | Bacteria | 4146 |
| 478 | Ga0496106_0001005 | 3300048909 | Bacteria | 20634 |
| 479 | Ga0496107_0001434 | 3300048910 | Bacteria | 14739 |
| 480 | Ga0496109_0112862 | 3300048912 | Bacteria | 2527 |
| 481 | Ga0496109_0143626 | 3300048912 | Bacteria | 2232 |
| 482 | Ga0496110_0082643 | 3300048913 | Bacteria | 2865 |
| 483 | Ga0496110_0150920 | 3300048913 | Bacteria | 2104 |
| 484 | Ga0496111_0055275 | 3300048914 | Bacteria | 2871 |
| 485 | Ga0496111_0086946 | 3300048914 | Bacteria | 2288 |
| 486 | Ga0496113_0000970 | 3300048916 | Bacteria | 15271 |
| 487 | Ga0496113_0001739 | 3300048916 | Bacteria | 12335 |
| 488 | Ga0496114_0004908 | 3300048917 | Bacteria | 10419 |
| 489 | Ga0496114_0013204 | 3300048917 | Bacteria | 6621 |
| 490 | Ga0496115_0000030 | 3300048918 | Bacteria | 138328 |
| 491 | Ga0496115_0002160 | 3300048918 | Bacteria | 14063 |
| 492 | Ga0496115_0023817 | 3300048918 | Bacteria | 4753 |
| 493 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 494 | Ga0496116_0001039 | 3300048919 | Bacteria | 33915 |
| 495 | Ga0496116_0017140 | 3300048919 | Bacteria | 5638 |
| 496 | Ga0496116_0058621 | 3300048919 | Bacteria | 2509 |
| 497 | Ga0496116_0071188 | 3300048919 | Bacteria | 2203 |
| 498 | Ga0496117_0000123 | 3300048920 | Bacteria | 169805 |
| 499 | Ga0496117_0000142 | 3300048920 | Bacteria | 157953 |
| 500 | Ga0496117_0025824 | 3300048920 | Bacteria | 4607 |
| 501 | Ga0496117_0042297 | 3300048920 | Bacteria | 3326 |
| 502 | Ga0496117_0088922 | 3300048920 | Bacteria | 1996 |
| 503 | Ga0496117_0154240 | 3300048920 | Bacteria | 1355 |
| 504 | Ga0496118_0000115 | 3300048921 | Bacteria | 146533 |
| 505 | Ga0496118_0006969 | 3300048921 | Bacteria | 12201 |
| 506 | Ga0496118_0029188 | 3300048921 | Bacteria | 4630 |
| 507 | Ga0496118_0047239 | 3300048921 | Bacteria | 3339 |
| 508 | Ga0496119_0000121 | 3300048922 | Bacteria | 109164 |
| 509 | Ga0496119_0012947 | 3300048922 | Bacteria | 6708 |
| 510 | Ga0496119_0109473 | 3300048922 | Bacteria | 1536 |
| 511 | Ga0496120_0003407 | 3300048923 | Bacteria | 14541 |
| 512 | Ga0496120_0004132 | 3300048923 | Bacteria | 12496 |
| 513 | Ga0496120_0008554 | 3300048923 | Bacteria | 7409 |
| 514 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 515 | Ga0496121_0000104 | 3300048924 | Bacteria | 192186 |
| 516 | Ga0496121_0000175 | 3300048924 | Bacteria | 142910 |
| 517 | Ga0496121_0000193 | 3300048924 | Bacteria | 136526 |
| 518 | Ga0496121_0002119 | 3300048924 | Bacteria | 31184 |
| 519 | Ga0496121_0003456 | 3300048924 | Bacteria | 22526 |
| 520 | Ga0496121_0022659 | 3300048924 | Bacteria | 6081 |
| 521 | Ga0496121_0032260 | 3300048924 | Bacteria | 4766 |
| 522 | Ga0496121_0034736 | 3300048924 | Bacteria | 4534 |
| 523 | Ga0496121_0234814 | 3300048924 | Bacteria | 1282 |
| 524 | Ga0496122_0000507 | 3300048925 | Bacteria | 80433 |
| 525 | Ga0496122_0002041 | 3300048925 | Bacteria | 29971 |
| 526 | Ga0496122_0005084 | 3300048925 | Bacteria | 15874 |
| 527 | Ga0496122_0007531 | 3300048925 | Bacteria | 12066 |
| 528 | Ga0496122_0011400 | 3300048925 | Bacteria | 9007 |
| 529 | Ga0496122_0037275 | 3300048925 | Bacteria | 3916 |
| 530 | Ga0496122_0044305 | 3300048925 | Bacteria | 3474 |
| 531 | Ga0496123_0000428 | 3300048926 | Bacteria | 75893 |
| 532 | Ga0496123_0000484 | 3300048926 | Bacteria | 69108 |
| 533 | Ga0496123_0002142 | 3300048926 | Bacteria | 25232 |
| 534 | Ga0496123_0003949 | 3300048926 | Bacteria | 16072 |
| 535 | Ga0496123_0007171 | 3300048926 | Bacteria | 10578 |
| 536 | Ga0496123_0008421 | 3300048926 | Bacteria | 9477 |
| 537 | Ga0496123_0015533 | 3300048926 | Bacteria | 6238 |
| 538 | Ga0496124_0000071 | 3300048927 | Bacteria | 220642 |
| 539 | Ga0496124_0000146 | 3300048927 | Bacteria | 146468 |
| 540 | Ga0496124_0000674 | 3300048927 | Bacteria | 56134 |
| 541 | Ga0496124_0001631 | 3300048927 | Bacteria | 32175 |
| 542 | Ga0496124_0002309 | 3300048927 | Bacteria | 25181 |
| 543 | Ga0496124_0003581 | 3300048927 | Bacteria | 18878 |
| 544 | Ga0496124_0005460 | 3300048927 | Bacteria | 14289 |
| 545 | Ga0496124_0012621 | 3300048927 | Bacteria | 8316 |
| 546 | Ga0496124_0027468 | 3300048927 | Bacteria | 5107 |
| 547 | Ga0496124_0069768 | 3300048927 | Bacteria | 2917 |
| 548 | Ga0496124_0161244 | 3300048927 | Bacteria | 1747 |
| 549 | Ga0496125_0000445 | 3300048928 | Bacteria | 75404 |
| 550 | Ga0496125_0000463 | 3300048928 | Bacteria | 72745 |
| 551 | Ga0496125_0000663 | 3300048928 | Bacteria | 57400 |
| 552 | Ga0496125_0006562 | 3300048928 | Bacteria | 12536 |
| 553 | Ga0496125_0009305 | 3300048928 | Bacteria | 10134 |
| 554 | Ga0496125_0079822 | 3300048928 | Bacteria | 2507 |
| 555 | Ga0496125_0104516 | 3300048928 | Bacteria | 2074 |
| 556 | Ga0496126_0000045 | 3300048929 | Bacteria | 331225 |
| 557 | Ga0496126_0000174 | 3300048929 | Bacteria | 146468 |
| 558 | Ga0496126_0005924 | 3300048929 | Bacteria | 13779 |
| 559 | Ga0496126_0006947 | 3300048929 | Bacteria | 12530 |
| 560 | Ga0496126_0017263 | 3300048929 | Bacteria | 7191 |
| 561 | Ga0496126_0052633 | 3300048929 | Bacteria | 3699 |
| 562 | Ga0496126_0066853 | 3300048929 | Bacteria | 3213 |
| 563 | Ga0496126_0075796 | 3300048929 | Bacteria | 2985 |
| 564 | Ga0496126_0093778 | 3300048929 | Bacteria | 2635 |
| 565 | Ga0496126_0108152 | 3300048929 | Bacteria | 2425 |
| 566 | Ga0501037_0044933 | 3300049573 | Bacteria | 3243 |
| 567 | Ga0501038_0206188 | 3300049574 | Bacteria | 1575 |
| 568 | Ga0501047_0066017 | 3300049581 | Bacteria | 3488 |
| 569 | Ga0501047_0131251 | 3300049581 | Bacteria | 2386 |
| 570 | Ga0501047_0399277 | 3300049581 | Bacteria | 1208 |
| 571 | Ga0501070_0029720 | 3300049586 | Bacteria | 4580 |
| 572 | Ga0501073_0246931 | 3300049589 | Bacteria | 1232 |
| 573 | Ga0501074_0074885 | 3300049590 | Bacteria | 2431 |
| 574 | Ga0501223_000084 | 3300049663 | Bacteria | 28507 |
| 575 | Ga0501225_0004209 | 3300049705 | Bacteria | 4300 |
| 576 | Ga0501282_001577 | 3300049778 | Bacteria | 2523 |
| 577 | Ga0501035_0059527 | 3300049822 | Bacteria | 3402 |
| 578 | Ga0501035_0188745 | 3300049822 | Bacteria | 1773 |
| 579 | Ga0501044_0000424 | 3300049823 | Bacteria | 52233 |
| 580 | Ga0501044_0144897 | 3300049823 | Bacteria | 2362 |
| 581 | Ga0501044_0186674 | 3300049823 | Bacteria | 2038 |
| 582 | Ga0501044_0270278 | 3300049823 | Bacteria | 1636 |
| 583 | nmdc:mga03683_53_c1 | 3300050489 | Bacteria | 47904 |
| 584 | nmdc:mga03683_7266_c1 | 3300050489 | Bacteria | 3837 |
| 585 | nmdc:mga03683_854_c1 | 3300050489 | Bacteria | 8790 |
| 586 | nmdc:mga03n38_38987_c1 | 3300050490 | Bacteria | 2058 |
| 587 | nmdc:mga03n38_43810_c1 | 3300050490 | Bacteria | 1963 |
| 588 | nmdc:mga03n38_47651_c1 | 3300050490 | Bacteria | 1898 |
| 589 | nmdc:mga00v17_22427_c1 | 3300050491 | Bacteria | 3642 |
| 590 | nmdc:mga0yw44_69754_c1 | 3300050492 | Bacteria | 2178 |
| 591 | nmdc:mga0k408_5_c2 | 3300050493 | Bacteria | 142245 |
| 592 | nmdc:mga06z11_339_c1 | 3300050494 | Bacteria | 17739 |
| 593 | nmdc:mga06z11_9_c1 | 3300050494 | Bacteria | 109982 |
| 594 | nmdc:mga04h51_128_c1 | 3300050495 | Bacteria | 22007 |
| 595 | nmdc:mga04h51_345_c1 | 3300050495 | Bacteria | 11540 |
| 596 | nmdc:mga07m45_30_c1 | 3300050496 | Bacteria | 85279 |
| 597 | nmdc:mga07m45_37521_c1 | 3300050496 | Bacteria | 2702 |
| 598 | nmdc:mga07m45_5_c2 | 3300050496 | Bacteria | 297012 |
| 599 | Ga0500610_0000028 | 3300053079 | Bacteria | 52793 |
| 600 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 601 | Ga0500643_000199 | 3300053087 | Bacteria | 57141 |
| 602 | Ga0500643_000964 | 3300053087 | Bacteria | 17873 |
| 603 | Ga0500643_001644 | 3300053087 | Bacteria | 12495 |
| 604 | Ga0500643_016267 | 3300053087 | Bacteria | 2524 |
| 605 | Ga0500643_038005 | 3300053087 | Bacteria | 1429 |
| 606 | Ga0500647_0056531 | 3300053091 | Bacteria | 1887 |
| 607 | Ga0500566_0004563 | 3300053094 | Bacteria | 8265 |
| 608 | Ga0500555_026164 | 3300053103 | Bacteria | 1668 |
| 609 | Ga0500556_0013142 | 3300053104 | Bacteria | 2496 |
| 610 | Ga0500592_000009 | 3300053116 | Bacteria | 87878 |
| 611 | Ga0500595_000340 | 3300053119 | Bacteria | 30575 |
| 612 | Ga0500595_000725 | 3300053119 | Bacteria | 19606 |
| 613 | Ga0500607_000009 | 3300053121 | Bacteria | 125590 |
| 614 | Ga0500607_000162 | 3300053121 | Bacteria | 57883 |
| 615 | Ga0500608_000190 | 3300053122 | Bacteria | 24701 |
| 616 | Ga0500618_004968 | 3300053125 | Bacteria | 4120 |
| 617 | Ga0500642_0001123 | 3300053130 | Bacteria | 7659 |
| 618 | Ga0500658_0006537 | 3300053134 | Bacteria | 4323 |
| 619 | Ga0500658_0009079 | 3300053134 | Bacteria | 3670 |
| 620 | Ga0500559_0000353 | 3300053136 | Bacteria | 34519 |
| 621 | Ga0500559_0000540 | 3300053136 | Bacteria | 26157 |
| 622 | Ga0500559_0000551 | 3300053136 | Bacteria | 25981 |
| 623 | Ga0500559_0040283 | 3300053136 | Bacteria | 2034 |
| 624 | Ga0500573_0000029 | 3300053140 | Bacteria | 135595 |
| 625 | Ga0500590_015582 | 3300053148 | Bacteria | 3924 |
| 626 | Ga0500604_0018624 | 3300053151 | Bacteria | 1936 |
| 627 | Ga0500616_0001604 | 3300053153 | Bacteria | 21081 |
| 628 | Ga0500622_0000924 | 3300053156 | Bacteria | 24943 |
| 629 | Ga0500624_000049 | 3300053157 | Bacteria | 81103 |
| 630 | Ga0500624_000076 | 3300053157 | Bacteria | 55457 |
| 631 | Ga0500627_0000051 | 3300053158 | Bacteria | 56260 |
| 632 | Ga0500636_0000441 | 3300053177 | Bacteria | 22947 |
| 633 | Ga0500637_0002218 | 3300053178 | Bacteria | 8573 |
| 634 | Ga0500567_001195 | 3300053723 | Bacteria | 10228 |
| 635 | Ga0500625_000005 | 3300053729 | Bacteria | 209509 |
| 636 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 637 | Ga0500645_005022 | 3300053730 | Bacteria | 4955 |
| 638 | Ga0500645_037364 | 3300053730 | Bacteria | 1442 |
| 639 | Ga0500596_003080 | 3300053735 | Bacteria | 3204 |
| 640 | Ga0500661_000720 | 3300055283 | Bacteria | 6182 |
| 641 | Ga0501082_0018384 | 3300060353 | Bacteria | 6020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0143626 | Ga0496109_0143626_1166_2167 | 333 |
| 2 | 3300049581 | Ga0501047_0399277 | Ga0501047_0399277_149_1150 | 333 |
| 3 | 3300048906 | Ga0496103_0035392 | Ga0496103_0035392_23_1027 | 334 |
| 4 | 3300048907 | Ga0496104_0028227 | Ga0496104_0028227_4166_5170 | 334 |
| 5 | 3300005329 | Ga0070683_100028024 | Ga0070683_1000280246 | 344 |
| 6 | 3300025944 | Ga0207661_10074809 | Ga0207661_100748093 | 344 |
| 7 | 3300025921 | Ga0207652_10302417 | Ga0207652_103024171 | 352 |
| 8 | 3300013306 | Ga0163162_10248643 | Ga0163162_102486432 | 356 |
| 9 | 3300046522 | Ga0495643_0001836 | Ga0495643_0001836_16480_17550 | 356 |
| 10 | 2162886007 | SwRhRL2b_contig_564562 | SwRhRL2b_0441.00008690 | 359 |
| 11 | 3300005289 | Ga0065704_10070386 | Ga0065704_100703861 | 359 |
| 12 | 3300005353 | Ga0070669_100000077 | Ga0070669_1000000776 | 359 |
| 13 | 3300005843 | Ga0068860_100001423 | Ga0068860_1000014234 | 359 |
| 14 | 3300025903 | Ga0207680_10021991 | Ga0207680_100219912 | 359 |
| 15 | 3300025923 | Ga0207681_10000081 | Ga0207681_1000008160 | 359 |
| 16 | 3300025986 | Ga0207658_10000927 | Ga0207658_100009277 | 359 |
| 17 | 3300028381 | Ga0268264_10016598 | Ga0268264_100165984 | 359 |
| 18 | 3300046524 | Ga0495648_0154526 | Ga0495648_0154526_96_1175 | 359 |
| 19 | 3300048903 | Ga0496100_0301426 | Ga0496100_0301426_54_1181 | 359 |
| 20 | 3300048907 | Ga0496104_0000165 | Ga0496104_0000165_29306_30433 | 359 |
| 21 | 3300048908 | Ga0496105_0003952 | Ga0496105_0003952_5854_6981 | 359 |
| 22 | 3300048916 | Ga0496113_0001739 | Ga0496113_0001739_240_1367 | 359 |
| 23 | 3300048922 | Ga0496119_0000121 | Ga0496119_0000121_85628_86755 | 359 |
| 24 | 3300048923 | Ga0496120_0003407 | Ga0496120_0003407_6232_7359 | 359 |
| 25 | 3300048925 | Ga0496122_0011400 | Ga0496122_0011400_644_1771 | 359 |
| 26 | 3300048926 | Ga0496123_0015533 | Ga0496123_0015533_2002_3129 | 359 |
| 27 | 3300048928 | Ga0496125_0006562 | Ga0496125_0006562_5445_6572 | 359 |
| 28 | 3300048929 | Ga0496126_0000045 | Ga0496126_0000045_166608_167735 | 359 |
| 29 | 3300003323 | rootH1_10066050 | rootH1_100660502 | 360 |
| 30 | 3300032005 | Ga0307411_10233185 | Ga0307411_102331852 | 360 |
| 31 | iso_pu_bacteria | 2946787523 | 2946789389 | 362 |
| 32 | 3300053104 | Ga0500556_0013142 | Ga0500556_0013142_1000_2127 | 363 |
| 33 | 3300001989 | JGI24739J22299_10003034 | JGI24739J22299_100030347 | 366 |
| 34 | 3300032002 | Ga0307416_100071782 | Ga0307416_1000717822 | 366 |
| 35 | 3300046520 | Ga0495637_0003849 | Ga0495637_0003849_6473_7573 | 366 |
| 36 | 3300046522 | Ga0495643_0000014 | Ga0495643_0000014_302_1402 | 366 |
| 37 | 3300046692 | Ga0495671_0000058 | Ga0495671_0000058_302_1402 | 366 |
| 38 | 3300047470 | Ga0495681_0007579 | Ga0495681_0007579_5518_6618 | 366 |
| 39 | iso_pu_bacteria | 2512564014 | 2512641915 | 366 |
| 40 | iso_pu_bacteria | 2808606401 | 2809064703 | 366 |
| 41 | iso_pu_bacteria | 2808606404 | 2809080628 | 366 |
| 42 | iso_pu_bacteria | 2808606405 | 2809084993 | 366 |
| 43 | iso_pu_bacteria | 2880518877 | 2880519596 | 366 |
| 44 | 3300032004 | Ga0307414_10138102 | Ga0307414_101381022 | 367 |
| 45 | 3300046492 | Ga0495585_0076161 | Ga0495585_0076161_20_1123 | 367 |
| 46 | 3300047323 | Ga0495683_0001912 | Ga0495683_0001912_10487_11590 | 367 |
| 47 | 3300053091 | Ga0500647_0056531 | Ga0500647_0056531_760_1863 | 367 |
| 48 | iso_pu_bacteria | 2919709256 | 2919711593 | 367 |
| 49 | 3300048928 | Ga0496125_0079822 | Ga0496125_0079822_181_1320 | 368 |
| 50 | 3300048929 | Ga0496126_0066853 | Ga0496126_0066853_1495_2601 | 368 |
| 51 | iso_pu_bacteria | 2513237139 | 2513878965 | 368 |
| 52 | iso_pu_bacteria | 2802429603 | 2805918177 | 368 |
| 53 | iso_pu_bacteria | 2824671348 | 2824672165 | 368 |
| 54 | iso_pu_bacteria | 2824687955 | 2824688764 | 368 |
| 55 | iso_pu_bacteria | 2824696289 | 2824697511 | 368 |
| 56 | iso_pu_bacteria | 2838122688 | 2838123163 | 368 |
| 57 | iso_pu_bacteria | 2841949485 | 2841954320 | 368 |
| 58 | iso_pu_bacteria | 2841966195 | 2841969692 | 368 |
| 59 | iso_pu_bacteria | 2841983080 | 2841984012 | 368 |
| 60 | iso_pu_bacteria | 2842038055 | 2842038782 | 368 |
| 61 | iso_pu_bacteria | 2842045827 | 2842048273 | 368 |
| 62 | iso_pu_bacteria | 2895880812 | 2895881427 | 368 |
| 63 | 3300003320 | rootH2_10140464 | rootH2_101404641 | 369 |
| 64 | 3300003322 | rootL2_10188478 | rootL2_101884783 | 369 |
| 65 | 3300003323 | rootH1_10012774 | rootH1_100127743 | 369 |
| 66 | 3300005344 | Ga0070661_100052797 | Ga0070661_1000527972 | 369 |
| 67 | 3300005344 | Ga0070661_100069085 | Ga0070661_1000690852 | 369 |
| 68 | 3300005347 | Ga0070668_100032130 | Ga0070668_1000321303 | 369 |
| 69 | 3300005355 | Ga0070671_100003536 | Ga0070671_1000035367 | 369 |
| 70 | 3300005455 | Ga0070663_100009643 | Ga0070663_1000096436 | 369 |
| 71 | 3300005456 | Ga0070678_100025533 | Ga0070678_1000255335 | 369 |
| 72 | 3300005457 | Ga0070662_100003535 | Ga0070662_1000035353 | 369 |
| 73 | 3300005457 | Ga0070662_100034943 | Ga0070662_1000349432 | 369 |
| 74 | 3300005530 | Ga0070679_100000477 | Ga0070679_10000047725 | 369 |
| 75 | 3300005539 | Ga0068853_100063786 | Ga0068853_1000637862 | 369 |
| 76 | 3300005548 | Ga0070665_100015283 | Ga0070665_1000152837 | 369 |
| 77 | 3300005577 | Ga0068857_100037369 | Ga0068857_1000373692 | 369 |
| 78 | 3300005616 | Ga0068852_100044666 | Ga0068852_1000446663 | 369 |
| 79 | 3300011119 | Ga0105246_10000017 | Ga0105246_100000171 | 369 |
| 80 | 3300013306 | Ga0163162_10312879 | Ga0163162_103128791 | 369 |
| 81 | 3300014326 | Ga0157380_10101493 | Ga0157380_101014932 | 369 |
| 82 | 3300025711 | Ga0207696_1008420 | Ga0207696_10084204 | 369 |
| 83 | 3300025735 | Ga0207713_1036975 | Ga0207713_10369752 | 369 |
| 84 | 3300025919 | Ga0207657_10003493 | Ga0207657_100034932 | 369 |
| 85 | 3300025921 | Ga0207652_10000338 | Ga0207652_1000033830 | 369 |
| 86 | 3300025926 | Ga0207659_10045406 | Ga0207659_100454063 | 369 |
| 87 | 3300025931 | Ga0207644_10001054 | Ga0207644_100010547 | 369 |
| 88 | 3300025933 | Ga0207706_10000873 | Ga0207706_1000087311 | 369 |
| 89 | 3300025933 | Ga0207706_10024086 | Ga0207706_100240865 | 369 |
| 90 | 3300025933 | Ga0207706_10025187 | Ga0207706_100251873 | 369 |
| 91 | 3300025949 | Ga0207667_10005620 | Ga0207667_1000562014 | 369 |
| 92 | 3300025972 | Ga0207668_10018228 | Ga0207668_100182283 | 369 |
| 93 | 3300026041 | Ga0207639_10002958 | Ga0207639_1000295813 | 369 |
| 94 | 3300026067 | Ga0207678_10054487 | Ga0207678_100544872 | 369 |
| 95 | 3300026116 | Ga0207674_10050630 | Ga0207674_100506303 | 369 |
| 96 | 3300026116 | Ga0207674_10117778 | Ga0207674_101177782 | 369 |
| 97 | 3300026121 | Ga0207683_10040858 | Ga0207683_100408585 | 369 |
| 98 | 3300028379 | Ga0268266_10004341 | Ga0268266_100043417 | 369 |
| 99 | 3300031901 | Ga0307406_10303404 | Ga0307406_103034041 | 369 |
| 100 | 3300031911 | Ga0307412_10032106 | Ga0307412_100321062 | 369 |
| 101 | 3300032004 | Ga0307414_10000790 | Ga0307414_100007906 | 369 |
| 102 | 3300032004 | Ga0307414_10054547 | Ga0307414_100545473 | 369 |
| 103 | 3300032004 | Ga0307414_10086771 | Ga0307414_100867712 | 369 |
| 104 | 3300046522 | Ga0495643_0036974 | Ga0495643_0036974_789_1910 | 369 |
| 105 | 3300048905 | Ga0496102_0001730 | Ga0496102_0001730_7314_8441 | 369 |
| 106 | 3300048906 | Ga0496103_0000866 | Ga0496103_0000866_12083_13210 | 369 |
| 107 | 3300048914 | Ga0496111_0086946 | Ga0496111_0086946_943_2070 | 369 |
| 108 | 3300048918 | Ga0496115_0002160 | Ga0496115_0002160_6798_7916 | 369 |
| 109 | 3300048919 | Ga0496116_0017140 | Ga0496116_0017140_590_1717 | 369 |
| 110 | 3300048920 | Ga0496117_0000123 | Ga0496117_0000123_159749_160876 | 369 |
| 111 | 3300048924 | Ga0496121_0032260 | Ga0496121_0032260_3108_4226 | 369 |
| 112 | 3300048927 | Ga0496124_0002309 | Ga0496124_0002309_22621_23748 | 369 |
| 113 | 3300048929 | Ga0496126_0017263 | Ga0496126_0017263_2194_3312 | 369 |
| 114 | 3300049778 | Ga0501282_001577 | Ga0501282_001577_801_1928 | 369 |
| 115 | 3300049822 | Ga0501035_0188745 | Ga0501035_0188745_589_1710 | 369 |
| 116 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_385201_386322 | 369 |
| 117 | 3300053116 | Ga0500592_000009 | Ga0500592_000009_53393_54520 | 369 |
| 118 | 3300053158 | Ga0500627_0000051 | Ga0500627_0000051_50625_51752 | 369 |
| 119 | iso_pu_bacteria | 2738541275 | 2738711997 | 369 |
| 120 | iso_pu_bacteria | 2738541301 | 2738850422 | 369 |
| 121 | iso_pu_bacteria | 2738541304 | 2738866151 | 369 |
| 122 | iso_pu_bacteria | 2738543022 | 2739298669 | 369 |
| 123 | iso_pu_bacteria | 2738543033 | 2739360347 | 369 |
| 124 | iso_pu_bacteria | 2928100450 | 2928103518 | 369 |
| 125 | iso_pu_bacteria | 2928959182 | 2928962940 | 369 |
| 126 | 3300003323 | rootH1_10085742 | rootH1_100857421 | 370 |
| 127 | 3300004799 | Ga0058863_11813500 | Ga0058863_118135002 | 370 |
| 128 | 3300004803 | Ga0058862_10285799 | Ga0058862_102857991 | 370 |
| 129 | 3300004803 | Ga0058862_12261043 | Ga0058862_122610432 | 370 |
| 130 | 3300005336 | Ga0070680_100053064 | Ga0070680_1000530641 | 370 |
| 131 | 3300005339 | Ga0070660_100011920 | Ga0070660_1000119202 | 370 |
| 132 | 3300005366 | Ga0070659_100038005 | Ga0070659_1000380052 | 370 |
| 133 | 3300005366 | Ga0070659_100053298 | Ga0070659_1000532985 | 370 |
| 134 | 3300005530 | Ga0070679_100042935 | Ga0070679_1000429354 | 370 |
| 135 | 3300005563 | Ga0068855_100092884 | Ga0068855_1000928842 | 370 |
| 136 | 3300005983 | Ga0081540_1000026 | Ga0081540_1000026101 | 370 |
| 137 | 3300006195 | Ga0075366_10079273 | Ga0075366_100792731 | 370 |
| 138 | 3300013100 | Ga0157373_10097451 | Ga0157373_100974512 | 370 |
| 139 | 3300013104 | Ga0157370_10078014 | Ga0157370_100780144 | 370 |
| 140 | 3300013105 | Ga0157369_10493612 | Ga0157369_104936121 | 370 |
| 141 | 3300025295 | Ga0209564_1000204 | Ga0209564_100020439 | 370 |
| 142 | 3300025906 | Ga0207699_10040931 | Ga0207699_100409312 | 370 |
| 143 | 3300025917 | Ga0207660_10081861 | Ga0207660_100818612 | 370 |
| 144 | 3300025921 | Ga0207652_10064532 | Ga0207652_100645323 | 370 |
| 145 | 3300025949 | Ga0207667_10023071 | Ga0207667_100230712 | 370 |
| 146 | 3300026041 | Ga0207639_10166119 | Ga0207639_101661192 | 370 |
| 147 | 3300031548 | Ga0307408_100261493 | Ga0307408_1002614931 | 370 |
| 148 | 3300031852 | Ga0307410_10053535 | Ga0307410_100535352 | 370 |
| 149 | 3300031903 | Ga0307407_10047125 | Ga0307407_100471252 | 370 |
| 150 | 3300031911 | Ga0307412_10114465 | Ga0307412_101144652 | 370 |
| 151 | 3300031911 | Ga0307412_10184482 | Ga0307412_101844822 | 370 |
| 152 | 3300032002 | Ga0307416_100419063 | Ga0307416_1004190631 | 370 |
| 153 | 3300042015 | Ga0439462_0000502 | Ga0439462_0000502_3496_4614 | 370 |
| 154 | 3300044901 | Ga0466960_0036153 | Ga0466960_0036153_293_1417 | 370 |
| 155 | 3300046519 | Ga0495632_0005315 | Ga0495632_0005315_6308_7429 | 370 |
| 156 | 3300046525 | Ga0495663_0000007 | Ga0495663_0000007_514_1635 | 370 |
| 157 | 3300046537 | Ga0495598_0003152 | Ga0495598_0003152_1518_2636 | 370 |
| 158 | 3300046558 | Ga0495633_0001991 | Ga0495633_0001991_13154_14275 | 370 |
| 159 | 3300046558 | Ga0495633_0003613 | Ga0495633_0003613_8828_9940 | 370 |
| 160 | 3300046660 | Ga0495625_0135383 | Ga0495625_0135383_513_1634 | 370 |
| 161 | 3300048090 | Ga0495615_0000174 | Ga0495615_0000174_1647_2768 | 370 |
| 162 | 3300048920 | Ga0496117_0025824 | Ga0496117_0025824_2144_3256 | 370 |
| 163 | 3300048921 | Ga0496118_0047239 | Ga0496118_0047239_1827_2939 | 370 |
| 164 | 3300048925 | Ga0496122_0000507 | Ga0496122_0000507_38265_39404 | 370 |
| 165 | 3300048925 | Ga0496122_0037275 | Ga0496122_0037275_2731_3852 | 370 |
| 166 | 3300048926 | Ga0496123_0000484 | Ga0496123_0000484_41002_42141 | 370 |
| 167 | 3300048926 | Ga0496123_0002142 | Ga0496123_0002142_116_1237 | 370 |
| 168 | 3300048927 | Ga0496124_0012621 | Ga0496124_0012621_2648_3760 | 370 |
| 169 | 3300048929 | Ga0496126_0075796 | Ga0496126_0075796_358_1497 | 370 |
| 170 | 3300049581 | Ga0501047_0066017 | Ga0501047_0066017_2022_3140 | 370 |
| 171 | 3300049581 | Ga0501047_0131251 | Ga0501047_0131251_467_1588 | 370 |
| 172 | 3300049586 | Ga0501070_0029720 | Ga0501070_0029720_2119_3240 | 370 |
| 173 | 3300049589 | Ga0501073_0246931 | Ga0501073_0246931_86_1204 | 370 |
| 174 | 3300049590 | Ga0501074_0074885 | Ga0501074_0074885_1153_2271 | 370 |
| 175 | 3300049822 | Ga0501035_0059527 | Ga0501035_0059527_181_1302 | 370 |
| 176 | 3300049823 | Ga0501044_0186674 | Ga0501044_0186674_669_1787 | 370 |
| 177 | 3300049823 | Ga0501044_0270278 | Ga0501044_0270278_458_1582 | 370 |
| 178 | 3300053157 | Ga0500624_000049 | Ga0500624_000049_20668_21780 | 370 |
| 179 | 3300060353 | Ga0501082_0018384 | Ga0501082_0018384_3731_4852 | 370 |
| 180 | iso_pu_bacteria | 2643221588 | 2643951043 | 370 |
| 181 | iso_pu_bacteria | 2848297114 | 2848297810 | 370 |
| 182 | 3300001979 | JGI24740J21852_10001049 | JGI24740J21852_100010499 | 371 |
| 183 | 3300001989 | JGI24739J22299_10005696 | JGI24739J22299_100056964 | 371 |
| 184 | 3300001990 | JGI24737J22298_10001592 | JGI24737J22298_100015922 | 371 |
| 185 | 3300001990 | JGI24737J22298_10032163 | JGI24737J22298_100321631 | 371 |
| 186 | 3300002067 | JGI24735J21928_10017734 | JGI24735J21928_100177341 | 371 |
| 187 | 3300002067 | JGI24735J21928_10020922 | JGI24735J21928_100209222 | 371 |
| 188 | 3300003214 | JGI25165J46597_1000007 | JGI25165J46597_1000007430 | 371 |
| 189 | 3300003215 | JGI25153J46596_10000008 | JGI25153J46596_10000008237 | 371 |
| 190 | 3300003759 | Ga0055525_1000063 | Ga0055525_10000632 | 371 |
| 191 | 3300003759 | Ga0055525_1000064 | Ga0055525_10000642 | 371 |
| 192 | 3300003762 | Ga0055542_1000040 | Ga0055542_100004032 | 371 |
| 193 | 3300003763 | Ga0055529_1000037 | Ga0055529_1000037189 | 371 |
| 194 | 3300005327 | Ga0070658_10001263 | Ga0070658_1000126313 | 371 |
| 195 | 3300005331 | Ga0070670_100131885 | Ga0070670_1001318852 | 371 |
| 196 | 3300005344 | Ga0070661_100001811 | Ga0070661_1000018117 | 371 |
| 197 | 3300005356 | Ga0070674_100013512 | Ga0070674_1000135124 | 371 |
| 198 | 3300005367 | Ga0070667_100063882 | Ga0070667_1000638822 | 371 |
| 199 | 3300005455 | Ga0070663_100054491 | Ga0070663_1000544912 | 371 |
| 200 | 3300005456 | Ga0070678_100007083 | Ga0070678_1000070833 | 371 |
| 201 | 3300005456 | Ga0070678_100099922 | Ga0070678_1000999223 | 371 |
| 202 | 3300005459 | Ga0068867_100077194 | Ga0068867_1000771942 | 371 |
| 203 | 3300005539 | Ga0068853_100081038 | Ga0068853_1000810382 | 371 |
| 204 | 3300005548 | Ga0070665_100000023 | Ga0070665_100000023171 | 371 |
| 205 | 3300005548 | Ga0070665_100050344 | Ga0070665_1000503442 | 371 |
| 206 | 3300005563 | Ga0068855_100126307 | Ga0068855_1001263073 | 371 |
| 207 | 3300005616 | Ga0068852_100158573 | Ga0068852_1001585733 | 371 |
| 208 | 3300005618 | Ga0068864_100001523 | Ga0068864_10000152312 | 371 |
| 209 | 3300005719 | Ga0068861_100192920 | Ga0068861_1001929201 | 371 |
| 210 | 3300005719 | Ga0068861_100238438 | Ga0068861_1002384381 | 371 |
| 211 | 3300005834 | Ga0068851_10026884 | Ga0068851_100268842 | 371 |
| 212 | 3300005842 | Ga0068858_100000548 | Ga0068858_10000054833 | 371 |
| 213 | 3300006237 | Ga0097621_100006920 | Ga0097621_1000069206 | 371 |
| 214 | 3300009148 | Ga0105243_10000221 | Ga0105243_100002212 | 371 |
| 215 | 3300009174 | Ga0105241_10024346 | Ga0105241_100243463 | 371 |
| 216 | 3300009177 | Ga0105248_10023982 | Ga0105248_100239827 | 371 |
| 217 | 3300009545 | Ga0105237_10097605 | Ga0105237_100976052 | 371 |
| 218 | 3300009551 | Ga0105238_10049742 | Ga0105238_100497424 | 371 |
| 219 | 3300013100 | Ga0157373_10121426 | Ga0157373_101214261 | 371 |
| 220 | 3300013102 | Ga0157371_10000256 | Ga0157371_1000025663 | 371 |
| 221 | 3300013105 | Ga0157369_10101664 | Ga0157369_101016642 | 371 |
| 222 | 3300013296 | Ga0157374_10154933 | Ga0157374_101549332 | 371 |
| 223 | 3300013306 | Ga0163162_10004312 | Ga0163162_1000431210 | 371 |
| 224 | 3300017792 | Ga0163161_10024052 | Ga0163161_100240522 | 371 |
| 225 | 3300025230 | Ga0209563_100066 | Ga0209563_10006667 | 371 |
| 226 | 3300025253 | Ga0209677_109817 | Ga0209677_1098172 | 371 |
| 227 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011929 | 371 |
| 228 | 3300025261 | Ga0209233_1000026 | Ga0209233_1000026428 | 371 |
| 229 | 3300025261 | Ga0209233_1017965 | Ga0209233_10179651 | 371 |
| 230 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006263 | 371 |
| 231 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017595 | 371 |
| 232 | 3300025315 | Ga0207697_10049823 | Ga0207697_100498232 | 371 |
| 233 | 3300025904 | Ga0207647_10055392 | Ga0207647_100553922 | 371 |
| 234 | 3300025904 | Ga0207647_10063402 | Ga0207647_100634021 | 371 |
| 235 | 3300025907 | Ga0207645_10024318 | Ga0207645_100243184 | 371 |
| 236 | 3300025909 | Ga0207705_10001400 | Ga0207705_1000140013 | 371 |
| 237 | 3300025911 | Ga0207654_10002236 | Ga0207654_100022366 | 371 |
| 238 | 3300025914 | Ga0207671_10006254 | Ga0207671_100062542 | 371 |
| 239 | 3300025919 | Ga0207657_10001703 | Ga0207657_1000170318 | 371 |
| 240 | 3300025920 | Ga0207649_10001206 | Ga0207649_1000120612 | 371 |
| 241 | 3300025924 | Ga0207694_10002822 | Ga0207694_100028227 | 371 |
| 242 | 3300025925 | Ga0207650_10052526 | Ga0207650_100525263 | 371 |
| 243 | 3300025932 | Ga0207690_10000416 | Ga0207690_1000041610 | 371 |
| 244 | 3300025933 | Ga0207706_10048202 | Ga0207706_100482023 | 371 |
| 245 | 3300025935 | Ga0207709_10000078 | Ga0207709_1000007877 | 371 |
| 246 | 3300025937 | Ga0207669_10000105 | Ga0207669_1000010546 | 371 |
| 247 | 3300025941 | Ga0207711_10027277 | Ga0207711_100272774 | 371 |
| 248 | 3300025945 | Ga0207679_10022412 | Ga0207679_100224123 | 371 |
| 249 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002646 | 371 |
| 250 | 3300025981 | Ga0207640_10001151 | Ga0207640_100011514 | 371 |
| 251 | 3300025986 | Ga0207658_10029544 | Ga0207658_100295443 | 371 |
| 252 | 3300026035 | Ga0207703_10002992 | Ga0207703_100029926 | 371 |
| 253 | 3300026035 | Ga0207703_10183690 | Ga0207703_101836902 | 371 |
| 254 | 3300026041 | Ga0207639_10000665 | Ga0207639_1000066510 | 371 |
| 255 | 3300026067 | Ga0207678_10002144 | Ga0207678_100021446 | 371 |
| 256 | 3300026078 | Ga0207702_10003566 | Ga0207702_100035666 | 371 |
| 257 | 3300026095 | Ga0207676_10003572 | Ga0207676_100035727 | 371 |
| 258 | 3300026116 | Ga0207674_10006869 | Ga0207674_1000686910 | 371 |
| 259 | 3300026118 | Ga0207675_100100319 | Ga0207675_1001003191 | 371 |
| 260 | 3300026121 | Ga0207683_10000156 | Ga0207683_100001562 | 371 |
| 261 | 3300026121 | Ga0207683_10158838 | Ga0207683_101588382 | 371 |
| 262 | 3300026142 | Ga0207698_10003251 | Ga0207698_100032514 | 371 |
| 263 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021308 | 371 |
| 264 | 3300028786 | Ga0307517_10010772 | Ga0307517_100107728 | 371 |
| 265 | 3300028786 | Ga0307517_10036027 | Ga0307517_100360272 | 371 |
| 266 | 3300031456 | Ga0307513_10027931 | Ga0307513_100279313 | 371 |
| 267 | 3300031456 | Ga0307513_10076986 | Ga0307513_100769863 | 371 |
| 268 | 3300031616 | Ga0307508_10000760 | Ga0307508_1000076013 | 371 |
| 269 | 3300033180 | Ga0307510_10001089 | Ga0307510_1000108910 | 371 |
| 270 | 3300037471 | Ga0395905_0284562 | Ga0395905_0284562_133_1263 | 371 |
| 271 | 3300046453 | Ga0495627_000332 | Ga0495627_000332_9069_10184 | 371 |
| 272 | 3300046460 | Ga0495638_0000016 | Ga0495638_0000016_394810_395925 | 371 |
| 273 | 3300046471 | Ga0495650_0000172 | Ga0495650_0000172_132527_133660 | 371 |
| 274 | 3300046491 | Ga0495584_0029998 | Ga0495584_0029998_1427_2560 | 371 |
| 275 | 3300046500 | Ga0495596_0000081 | Ga0495596_0000081_47079_48206 | 371 |
| 276 | 3300046500 | Ga0495596_0044070 | Ga0495596_0044070_26_1159 | 371 |
| 277 | 3300046501 | Ga0495607_0007283 | Ga0495607_0007283_1328_2443 | 371 |
| 278 | 3300046501 | Ga0495607_0035520 | Ga0495607_0035520_1129_2256 | 371 |
| 279 | 3300046506 | Ga0495583_0000094 | Ga0495583_0000094_150360_151475 | 371 |
| 280 | 3300046506 | Ga0495583_0004093 | Ga0495583_0004093_9117_10250 | 371 |
| 281 | 3300046506 | Ga0495583_0005984 | Ga0495583_0005984_6428_7561 | 371 |
| 282 | 3300046506 | Ga0495583_0011180 | Ga0495583_0011180_4008_5141 | 371 |
| 283 | 3300046506 | Ga0495583_0015588 | Ga0495583_0015588_342_1469 | 371 |
| 284 | 3300046507 | Ga0495606_0000365 | Ga0495606_0000365_25342_26475 | 371 |
| 285 | 3300046507 | Ga0495606_0023468 | Ga0495606_0023468_431_1564 | 371 |
| 286 | 3300046512 | Ga0495610_0000972 | Ga0495610_0000972_124_1248 | 371 |
| 287 | 3300046513 | Ga0495616_0000452 | Ga0495616_0000452_26694_27809 | 371 |
| 288 | 3300046519 | Ga0495632_0001802 | Ga0495632_0001802_14340_15455 | 371 |
| 289 | 3300046519 | Ga0495632_0042462 | Ga0495632_0042462_1098_2225 | 371 |
| 290 | 3300046522 | Ga0495643_0000023 | Ga0495643_0000023_19495_20619 | 371 |
| 291 | 3300046522 | Ga0495643_0009066 | Ga0495643_0009066_3797_4930 | 371 |
| 292 | 3300046522 | Ga0495643_0011300 | Ga0495643_0011300_2198_3331 | 371 |
| 293 | 3300046522 | Ga0495643_0022498 | Ga0495643_0022498_692_1825 | 371 |
| 294 | 3300046524 | Ga0495648_0000013 | Ga0495648_0000013_581_1696 | 371 |
| 295 | 3300046524 | Ga0495648_0000501 | Ga0495648_0000501_9486_10619 | 371 |
| 296 | 3300046524 | Ga0495648_0045238 | Ga0495648_0045238_1113_2228 | 371 |
| 297 | 3300046524 | Ga0495648_0067753 | Ga0495648_0067753_581_1714 | 371 |
| 298 | 3300046538 | Ga0495609_0020344 | Ga0495609_0020344_292_1419 | 371 |
| 299 | 3300046542 | Ga0495597_0018172 | Ga0495597_0018172_101_1234 | 371 |
| 300 | 3300046558 | Ga0495633_0000776 | Ga0495633_0000776_21526_22659 | 371 |
| 301 | 3300046616 | Ga0495668_0000080 | Ga0495668_0000080_2604_3737 | 371 |
| 302 | 3300046648 | Ga0495611_0006680 | Ga0495611_0006680_203_1336 | 371 |
| 303 | 3300046648 | Ga0495611_0069745 | Ga0495611_0069745_11_1144 | 371 |
| 304 | 3300046660 | Ga0495625_0000541 | Ga0495625_0000541_5462_6595 | 371 |
| 305 | 3300046660 | Ga0495625_0003065 | Ga0495625_0003065_11037_12170 | 371 |
| 306 | 3300046660 | Ga0495625_0009642 | Ga0495625_0009642_717_1844 | 371 |
| 307 | 3300046660 | Ga0495625_0012318 | Ga0495625_0012318_2756_3883 | 371 |
| 308 | 3300046660 | Ga0495625_0050256 | Ga0495625_0050256_1427_2560 | 371 |
| 309 | 3300046660 | Ga0495625_0167962 | Ga0495625_0167962_321_1454 | 371 |
| 310 | 3300046684 | Ga0495669_0000011 | Ga0495669_0000011_70912_72045 | 371 |
| 311 | 3300046692 | Ga0495671_0000018 | Ga0495671_0000018_2071_3186 | 371 |
| 312 | 3300046694 | Ga0495649_0005497 | Ga0495649_0005497_2059_3192 | 371 |
| 313 | 3300046694 | Ga0495649_0048988 | Ga0495649_0048988_645_1778 | 371 |
| 314 | 3300047323 | Ga0495683_0058445 | Ga0495683_0058445_623_1756 | 371 |
| 315 | 3300047443 | Ga0495687_000077 | Ga0495687_000077_107437_108570 | 371 |
| 316 | 3300047443 | Ga0495687_000082 | Ga0495687_000082_73187_74320 | 371 |
| 317 | 3300047445 | Ga0495677_0002800 | Ga0495677_0002800_437_1564 | 371 |
| 318 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_366351_367466 | 371 |
| 319 | 3300047470 | Ga0495681_0005700 | Ga0495681_0005700_3561_4694 | 371 |
| 320 | 3300048905 | Ga0496102_0000316 | Ga0496102_0000316_3600_4733 | 371 |
| 321 | 3300048906 | Ga0496103_0000166 | Ga0496103_0000166_59248_60381 | 371 |
| 322 | 3300048907 | Ga0496104_0018518 | Ga0496104_0018518_1916_3049 | 371 |
| 323 | 3300048908 | Ga0496105_0000299 | Ga0496105_0000299_9473_10606 | 371 |
| 324 | 3300048917 | Ga0496114_0013204 | Ga0496114_0013204_3059_4192 | 371 |
| 325 | 3300048918 | Ga0496115_0000030 | Ga0496115_0000030_34472_35605 | 371 |
| 326 | 3300048919 | Ga0496116_0001039 | Ga0496116_0001039_19577_20710 | 371 |
| 327 | 3300048920 | Ga0496117_0000142 | Ga0496117_0000142_85545_86678 | 371 |
| 328 | 3300048921 | Ga0496118_0000115 | Ga0496118_0000115_86113_87246 | 371 |
| 329 | 3300048921 | Ga0496118_0029188 | Ga0496118_0029188_3369_4496 | 371 |
| 330 | 3300048922 | Ga0496119_0012947 | Ga0496119_0012947_2197_3330 | 371 |
| 331 | 3300048923 | Ga0496120_0004132 | Ga0496120_0004132_1800_2933 | 371 |
| 332 | 3300048924 | Ga0496121_0000193 | Ga0496121_0000193_86786_87919 | 371 |
| 333 | 3300048925 | Ga0496122_0005084 | Ga0496122_0005084_12450_13583 | 371 |
| 334 | 3300048926 | Ga0496123_0007171 | Ga0496123_0007171_2660_3793 | 371 |
| 335 | 3300048927 | Ga0496124_0000146 | Ga0496124_0000146_59223_60356 | 371 |
| 336 | 3300048928 | Ga0496125_0000463 | Ga0496125_0000463_43512_44645 | 371 |
| 337 | 3300048929 | Ga0496126_0000174 | Ga0496126_0000174_86113_87246 | 371 |
| 338 | 3300049823 | Ga0501044_0144897 | Ga0501044_0144897_238_1365 | 371 |
| 339 | 3300053079 | Ga0500610_0000028 | Ga0500610_0000028_15650_16783 | 371 |
| 340 | 3300053087 | Ga0500643_000199 | Ga0500643_000199_4577_5692 | 371 |
| 341 | 3300053087 | Ga0500643_000964 | Ga0500643_000964_1732_2868 | 371 |
| 342 | 3300053087 | Ga0500643_001644 | Ga0500643_001644_6730_7857 | 371 |
| 343 | 3300053119 | Ga0500595_000340 | Ga0500595_000340_15048_16181 | 371 |
| 344 | 3300053130 | Ga0500642_0001123 | Ga0500642_0001123_3533_4666 | 371 |
| 345 | 3300053136 | Ga0500559_0000551 | Ga0500559_0000551_3465_4580 | 371 |
| 346 | 3300053136 | Ga0500559_0040283 | Ga0500559_0040283_487_1614 | 371 |
| 347 | 3300053151 | Ga0500604_0018624 | Ga0500604_0018624_367_1482 | 371 |
| 348 | 3300053177 | Ga0500636_0000441 | Ga0500636_0000441_19990_21123 | 371 |
| 349 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_150526_151659 | 371 |
| 350 | 3300053735 | Ga0500596_003080 | Ga0500596_003080_1546_2679 | 371 |
| 351 | 3300055283 | Ga0500661_000720 | Ga0500661_000720_1049_2164 | 371 |
| 352 | iso_pu_bacteria | 2510917021 | 2511130563 | 371 |
| 353 | iso_pu_bacteria | 2885429604 | 2885431674 | 371 |
| 354 | iso_pu_bacteria | 8054302542 | 8054303713 | 371 |
| 355 | 3300005843 | Ga0068860_100228458 | Ga0068860_1002284582 | 372 |
| 356 | 3300028381 | Ga0268264_10189681 | Ga0268264_101896812 | 372 |
| 357 | 3300046460 | Ga0495638_0001684 | Ga0495638_0001684_10221_11354 | 372 |
| 358 | 3300053087 | Ga0500643_038005 | Ga0500643_038005_297_1415 | 372 |
| 359 | 3300053119 | Ga0500595_000725 | Ga0500595_000725_9716_10846 | 372 |
| 360 | 3300053134 | Ga0500658_0006537 | Ga0500658_0006537_1837_2970 | 372 |
| 361 | iso_pu_bacteria | 2643221622 | 2644126168 | 372 |
| 362 | 2162886007 | SwRhRL2b_contig_2472434 | SwRhRL2b_0170.00002210 | 373 |
| 363 | 3300002459 | JGI24751J29686_10003145 | JGI24751J29686_100031455 | 373 |
| 364 | 3300003791 | Ga0055530_10000142 | Ga0055530_1000014256 | 373 |
| 365 | 3300003794 | Ga0055531_10000013 | Ga0055531_100000136 | 373 |
| 366 | 3300005262 | Ga0065165_1002027 | Ga0065165_100202719 | 373 |
| 367 | 3300005262 | Ga0065165_1010792 | Ga0065165_10107921 | 373 |
| 368 | 3300005289 | Ga0065704_10070288 | Ga0065704_1007028831 | 373 |
| 369 | 3300005331 | Ga0070670_100016855 | Ga0070670_1000168555 | 373 |
| 370 | 3300005335 | Ga0070666_10000063 | Ga0070666_1000006313 | 373 |
| 371 | 3300005353 | Ga0070669_100000001 | Ga0070669_100000001550 | 373 |
| 372 | 3300005355 | Ga0070671_100000002 | Ga0070671_10000000265 | 373 |
| 373 | 3300005617 | Ga0068859_100001555 | Ga0068859_10000155513 | 373 |
| 374 | 3300005618 | Ga0068864_100005624 | Ga0068864_1000056246 | 373 |
| 375 | 3300005719 | Ga0068861_100001689 | Ga0068861_1000016897 | 373 |
| 376 | 3300005842 | Ga0068858_100000112 | Ga0068858_10000011266 | 373 |
| 377 | 3300005842 | Ga0068858_100007448 | Ga0068858_10000744810 | 373 |
| 378 | 3300005844 | Ga0068862_100000961 | Ga0068862_1000009618 | 373 |
| 379 | 3300005844 | Ga0068862_100002849 | Ga0068862_10000284912 | 373 |
| 380 | 3300006038 | Ga0075365_10001984 | Ga0075365_100019846 | 373 |
| 381 | 3300006042 | Ga0075368_10003690 | Ga0075368_100036903 | 373 |
| 382 | 3300006048 | Ga0075363_100004524 | Ga0075363_1000045244 | 373 |
| 383 | 3300006051 | Ga0075364_10010179 | Ga0075364_100101793 | 373 |
| 384 | 3300006058 | Ga0075432_10011905 | Ga0075432_100119054 | 373 |
| 385 | 3300006177 | Ga0075362_10000263 | Ga0075362_1000026310 | 373 |
| 386 | 3300006178 | Ga0075367_10004271 | Ga0075367_100042714 | 373 |
| 387 | 3300006931 | Ga0097620_100001555 | Ga0097620_10000155513 | 373 |
| 388 | 3300009098 | Ga0105245_10002027 | Ga0105245_1000202712 | 373 |
| 389 | 3300009101 | Ga0105247_10004847 | Ga0105247_100048475 | 373 |
| 390 | 3300009148 | Ga0105243_10123527 | Ga0105243_101235272 | 373 |
| 391 | 3300009176 | Ga0105242_10227042 | Ga0105242_102270421 | 373 |
| 392 | 3300009551 | Ga0105238_10018856 | Ga0105238_100188565 | 373 |
| 393 | 3300009553 | Ga0105249_10002466 | Ga0105249_100024666 | 373 |
| 394 | 3300013297 | Ga0157378_10148944 | Ga0157378_101489442 | 373 |
| 395 | 3300014325 | Ga0163163_10130559 | Ga0163163_101305592 | 373 |
| 396 | 3300025263 | Ga0209565_1000107 | Ga0209565_100010773 | 373 |
| 397 | 3300025273 | Ga0209673_1022176 | Ga0209673_10221762 | 373 |
| 398 | 3300025292 | Ga0209676_1008112 | Ga0209676_10081123 | 373 |
| 399 | 3300025298 | Ga0209050_1000014 | Ga0209050_1000014158 | 373 |
| 400 | 3300025298 | Ga0209050_1013474 | Ga0209050_10134742 | 373 |
| 401 | 3300025304 | Ga0209257_1000019 | Ga0209257_1000019534 | 373 |
| 402 | 3300025903 | Ga0207680_10000033 | Ga0207680_1000003338 | 373 |
| 403 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002452 | 373 |
| 404 | 3300025924 | Ga0207694_10022950 | Ga0207694_100229502 | 373 |
| 405 | 3300025925 | Ga0207650_10013827 | Ga0207650_100138272 | 373 |
| 406 | 3300025927 | Ga0207687_10002295 | Ga0207687_100022952 | 373 |
| 407 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002456 | 373 |
| 408 | 3300025935 | Ga0207709_10013047 | Ga0207709_100130474 | 373 |
| 409 | 3300025949 | Ga0207667_10286434 | Ga0207667_102864342 | 373 |
| 410 | 3300025986 | Ga0207658_10001337 | Ga0207658_1000133716 | 373 |
| 411 | 3300026035 | Ga0207703_10001786 | Ga0207703_100017868 | 373 |
| 412 | 3300026035 | Ga0207703_10012751 | Ga0207703_100127514 | 373 |
| 413 | 3300026088 | Ga0207641_10003062 | Ga0207641_1000306213 | 373 |
| 414 | 3300026095 | Ga0207676_10025481 | Ga0207676_100254812 | 373 |
| 415 | 3300026118 | Ga0207675_100003247 | Ga0207675_1000032479 | 373 |
| 416 | 3300027866 | Ga0209813_10000561 | Ga0209813_100005615 | 373 |
| 417 | 3300028380 | Ga0268265_10000116 | Ga0268265_1000011619 | 373 |
| 418 | 3300028380 | Ga0268265_10019442 | Ga0268265_100194422 | 373 |
| 419 | 3300028381 | Ga0268264_10000116 | Ga0268264_1000011668 | 373 |
| 420 | 3300031824 | Ga0307413_10003252 | Ga0307413_100032522 | 373 |
| 421 | 3300031852 | Ga0307410_10026102 | Ga0307410_100261022 | 373 |
| 422 | 3300031911 | Ga0307412_10033332 | Ga0307412_100333325 | 373 |
| 423 | 3300032133 | Ga0316583_10000363 | Ga0316583_100003639 | 373 |
| 424 | 3300036647 | Ga0316582_0013913 | Ga0316582_0013913_1091_2224 | 373 |
| 425 | 3300036712 | Ga0316584_0069938 | Ga0316584_0069938_224_1357 | 373 |
| 426 | 3300041404 | Ga0439436_0030435 | Ga0439436_0030435_362_1492 | 373 |
| 427 | 3300041410 | Ga0439461_0000031 | Ga0439461_0000031_854_1984 | 373 |
| 428 | 3300041413 | Ga0439465_0007320 | Ga0439465_0007320_1165_2295 | 373 |
| 429 | 3300041997 | Ga0439431_0001137 | Ga0439431_0001137_2349_3479 | 373 |
| 430 | 3300042002 | Ga0439442_004151 | Ga0439442_004151_981_2111 | 373 |
| 431 | 3300042004 | Ga0439445_0017859 | Ga0439445_0017859_463_1593 | 373 |
| 432 | 3300042006 | Ga0439432_007499 | Ga0439432_007499_2005_3135 | 373 |
| 433 | 3300042014 | Ga0439457_012139 | Ga0439457_012139_323_1453 | 373 |
| 434 | 3300042015 | Ga0439462_0003732 | Ga0439462_0003732_494_1624 | 373 |
| 435 | 3300042185 | Ga0450909_003736 | Ga0450909_003736_829_1959 | 373 |
| 436 | 3300042435 | Ga0439434_0000478 | Ga0439434_0000478_9485_10615 | 373 |
| 437 | 3300046453 | Ga0495627_001246 | Ga0495627_001246_9271_10404 | 373 |
| 438 | 3300046471 | Ga0495650_0003342 | Ga0495650_0003342_1445_2578 | 373 |
| 439 | 3300046512 | Ga0495610_0000015 | Ga0495610_0000015_327292_328425 | 373 |
| 440 | 3300046519 | Ga0495632_0002004 | Ga0495632_0002004_5313_6446 | 373 |
| 441 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_260783_261919 | 373 |
| 442 | 3300047470 | Ga0495681_0001939 | Ga0495681_0001939_4735_5868 | 373 |
| 443 | 3300048918 | Ga0496115_0023817 | Ga0496115_0023817_597_1733 | 373 |
| 444 | 3300048924 | Ga0496121_0000104 | Ga0496121_0000104_37618_38751 | 373 |
| 445 | 3300048924 | Ga0496121_0034736 | Ga0496121_0034736_1478_2614 | 373 |
| 446 | 3300050489 | nmdc:mga03683_854_c1 | nmdc:mga03683_854_c1_5480_6613 | 373 |
| 447 | 3300050490 | nmdc:mga03n38_43810_c1 | nmdc:mga03n38_43810_c1_545_1678 | 373 |
| 448 | 3300050492 | nmdc:mga0yw44_69754_c1 | nmdc:mga0yw44_69754_c1_760_1893 | 373 |
| 449 | 3300050494 | nmdc:mga06z11_339_c1 | nmdc:mga06z11_339_c1_6682_7815 | 373 |
| 450 | 3300050495 | nmdc:mga04h51_345_c1 | nmdc:mga04h51_345_c1_5489_6622 | 373 |
| 451 | 3300050496 | nmdc:mga07m45_37521_c1 | nmdc:mga07m45_37521_c1_1353_2492 | 373 |
| 452 | 3300050496 | nmdc:mga07m45_5_c2 | nmdc:mga07m45_5_c2_56571_57704 | 373 |
| 453 | 3300053087 | Ga0500643_016267 | Ga0500643_016267_1183_2313 | 373 |
| 454 | 3300053094 | Ga0500566_0004563 | Ga0500566_0004563_2381_3511 | 373 |
| 455 | 3300053103 | Ga0500555_026164 | Ga0500555_026164_406_1536 | 373 |
| 456 | 3300053122 | Ga0500608_000190 | Ga0500608_000190_17454_18596 | 373 |
| 457 | 3300053134 | Ga0500658_0009079 | Ga0500658_0009079_250_1380 | 373 |
| 458 | 3300053153 | Ga0500616_0001604 | Ga0500616_0001604_7816_8949 | 373 |
| 459 | 3300053157 | Ga0500624_000076 | Ga0500624_000076_45083_46213 | 373 |
| 460 | 3300053723 | Ga0500567_001195 | Ga0500567_001195_6882_8024 | 373 |
| 461 | 3300053729 | Ga0500625_000005 | Ga0500625_000005_157036_158178 | 373 |
| 462 | iso_pu_bacteria | 2739367664 | 2739651288 | 373 |
| 463 | iso_pu_bacteria | 2739367865 | 2740029761 | 373 |
| 464 | iso_pu_bacteria | 2751185897 | 2753767911 | 373 |
| 465 | 3300002459 | JGI24751J29686_10000427 | JGI24751J29686_100004275 | 374 |
| 466 | 3300003758 | Ga0055532_1005765 | Ga0055532_10057652 | 374 |
| 467 | 3300005347 | Ga0070668_100183610 | Ga0070668_1001836102 | 374 |
| 468 | 3300005353 | Ga0070669_100000423 | Ga0070669_1000004235 | 374 |
| 469 | 3300005355 | Ga0070671_100000005 | Ga0070671_10000000517 | 374 |
| 470 | 3300005367 | Ga0070667_100080939 | Ga0070667_1000809392 | 374 |
| 471 | 3300005544 | Ga0070686_100008649 | Ga0070686_1000086494 | 374 |
| 472 | 3300005548 | Ga0070665_100011384 | Ga0070665_1000113843 | 374 |
| 473 | 3300005563 | Ga0068855_100007186 | Ga0068855_1000071866 | 374 |
| 474 | 3300005563 | Ga0068855_100029104 | Ga0068855_1000291046 | 374 |
| 475 | 3300005617 | Ga0068859_100006288 | Ga0068859_1000062882 | 374 |
| 476 | 3300005618 | Ga0068864_100247791 | Ga0068864_1002477912 | 374 |
| 477 | 3300005841 | Ga0068863_100207587 | Ga0068863_1002075872 | 374 |
| 478 | 3300005842 | Ga0068858_100003643 | Ga0068858_10000364314 | 374 |
| 479 | 3300005842 | Ga0068858_100043946 | Ga0068858_1000439463 | 374 |
| 480 | 3300005843 | Ga0068860_100049202 | Ga0068860_1000492025 | 374 |
| 481 | 3300006931 | Ga0097620_100006288 | Ga0097620_10000628813 | 374 |
| 482 | 3300009177 | Ga0105248_10010649 | Ga0105248_100106498 | 374 |
| 483 | 3300013306 | Ga0163162_10198392 | Ga0163162_101983922 | 374 |
| 484 | 3300025229 | Ga0209147_102334 | Ga0209147_1023343 | 374 |
| 485 | 3300025914 | Ga0207671_10036212 | Ga0207671_100362122 | 374 |
| 486 | 3300025923 | Ga0207681_10000686 | Ga0207681_1000068617 | 374 |
| 487 | 3300025925 | Ga0207650_10082461 | Ga0207650_100824612 | 374 |
| 488 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008306 | 374 |
| 489 | 3300025941 | Ga0207711_10046928 | Ga0207711_100469283 | 374 |
| 490 | 3300025949 | Ga0207667_10020860 | Ga0207667_100208606 | 374 |
| 491 | 3300025949 | Ga0207667_10025895 | Ga0207667_100258954 | 374 |
| 492 | 3300025972 | Ga0207668_10073193 | Ga0207668_100731932 | 374 |
| 493 | 3300025972 | Ga0207668_10075184 | Ga0207668_100751842 | 374 |
| 494 | 3300026035 | Ga0207703_10001705 | Ga0207703_100017055 | 374 |
| 495 | 3300028381 | Ga0268264_10048396 | Ga0268264_100483962 | 374 |
| 496 | 3300048905 | Ga0496102_0110074 | Ga0496102_0110074_572_1711 | 374 |
| 497 | 3300048905 | Ga0496102_0199866 | Ga0496102_0199866_450_1589 | 374 |
| 498 | 3300048906 | Ga0496103_0223087 | Ga0496103_0223087_25_1164 | 374 |
| 499 | 3300048907 | Ga0496104_0031801 | Ga0496104_0031801_3198_4337 | 374 |
| 500 | 3300048908 | Ga0496105_0034760 | Ga0496105_0034760_1065_2204 | 374 |
| 501 | 3300048909 | Ga0496106_0001005 | Ga0496106_0001005_10899_12038 | 374 |
| 502 | 3300048910 | Ga0496107_0001434 | Ga0496107_0001434_2487_3626 | 374 |
| 503 | 3300048912 | Ga0496109_0112862 | Ga0496109_0112862_1304_2443 | 374 |
| 504 | 3300048913 | Ga0496110_0150920 | Ga0496110_0150920_367_1506 | 374 |
| 505 | 3300048914 | Ga0496111_0055275 | Ga0496111_0055275_235_1374 | 374 |
| 506 | 3300048916 | Ga0496113_0000970 | Ga0496113_0000970_7784_8923 | 374 |
| 507 | 3300048917 | Ga0496114_0004908 | Ga0496114_0004908_5749_6888 | 374 |
| 508 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_359698_360840 | 374 |
| 509 | 3300048924 | Ga0496121_0022659 | Ga0496121_0022659_542_1693 | 374 |
| 510 | 3300048925 | Ga0496122_0044305 | Ga0496122_0044305_508_1647 | 374 |
| 511 | 3300048926 | Ga0496123_0008421 | Ga0496123_0008421_2362_3501 | 374 |
| 512 | 3300048927 | Ga0496124_0000674 | Ga0496124_0000674_10132_11271 | 374 |
| 513 | 3300048927 | Ga0496124_0003581 | Ga0496124_0003581_12902_14053 | 374 |
| 514 | 3300048929 | Ga0496126_0005924 | Ga0496126_0005924_5179_6318 | 374 |
| 515 | 3300053125 | Ga0500618_004968 | Ga0500618_004968_1475_2605 | 374 |
| 516 | iso_pu_bacteria | 2599185359 | 2600225326 | 374 |
| 517 | iso_pu_bacteria | 2818991438 | 2819554058 | 374 |
| 518 | iso_pu_bacteria | 2818991466 | 2819713595 | 374 |
| 519 | iso_pu_bacteria | 2919138771 | 2919139178 | 374 |
| 520 | iso_pu_bacteria | 2928526807 | 2928530103 | 374 |
| 521 | iso_pu_bacteria | 2928968154 | 2928969710 | 374 |
| 522 | 3300005327 | Ga0070658_10000458 | Ga0070658_100004587 | 375 |
| 523 | 3300005331 | Ga0070670_100003675 | Ga0070670_1000036752 | 375 |
| 524 | 3300005335 | Ga0070666_10081160 | Ga0070666_100811602 | 375 |
| 525 | 3300005353 | Ga0070669_100000726 | Ga0070669_10000072613 | 375 |
| 526 | 3300005367 | Ga0070667_100000238 | Ga0070667_10000023828 | 375 |
| 527 | 3300005548 | Ga0070665_100000370 | Ga0070665_10000037012 | 375 |
| 528 | 3300005548 | Ga0070665_100001932 | Ga0070665_1000019324 | 375 |
| 529 | 3300005563 | Ga0068855_100108910 | Ga0068855_1001089103 | 375 |
| 530 | 3300005616 | Ga0068852_100000113 | Ga0068852_10000011349 | 375 |
| 531 | 3300005618 | Ga0068864_100007078 | Ga0068864_1000070785 | 375 |
| 532 | 3300005841 | Ga0068863_100000138 | Ga0068863_10000013835 | 375 |
| 533 | 3300005841 | Ga0068863_100035599 | Ga0068863_1000355994 | 375 |
| 534 | 3300005841 | Ga0068863_100082589 | Ga0068863_1000825892 | 375 |
| 535 | 3300005842 | Ga0068858_100017464 | Ga0068858_1000174642 | 375 |
| 536 | 3300005843 | Ga0068860_100000028 | Ga0068860_10000002842 | 375 |
| 537 | 3300005843 | Ga0068860_100067930 | Ga0068860_1000679302 | 375 |
| 538 | 3300005844 | Ga0068862_100055446 | Ga0068862_1000554463 | 375 |
| 539 | 3300006048 | Ga0075363_100001965 | Ga0075363_1000019652 | 375 |
| 540 | 3300006051 | Ga0075364_10002350 | Ga0075364_100023505 | 375 |
| 541 | 3300006177 | Ga0075362_10000097 | Ga0075362_1000009715 | 375 |
| 542 | 3300006195 | Ga0075366_10000086 | Ga0075366_1000008610 | 375 |
| 543 | 3300006353 | Ga0075370_10000026 | Ga0075370_1000002625 | 375 |
| 544 | 3300009011 | Ga0105251_10007900 | Ga0105251_100079005 | 375 |
| 545 | 3300009093 | Ga0105240_10005105 | Ga0105240_100051055 | 375 |
| 546 | 3300009177 | Ga0105248_10037905 | Ga0105248_100379053 | 375 |
| 547 | 3300009553 | Ga0105249_10531642 | Ga0105249_105316421 | 375 |
| 548 | 3300017792 | Ga0163161_10038097 | Ga0163161_100380973 | 375 |
| 549 | 3300017792 | Ga0163161_10060565 | Ga0163161_100605652 | 375 |
| 550 | 3300025298 | Ga0209050_1000426 | Ga0209050_100042619 | 375 |
| 551 | 3300025735 | Ga0207713_1006187 | Ga0207713_10061873 | 375 |
| 552 | 3300025903 | Ga0207680_10056932 | Ga0207680_100569322 | 375 |
| 553 | 3300025904 | Ga0207647_10007386 | Ga0207647_100073864 | 375 |
| 554 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007186 | 375 |
| 555 | 3300025913 | Ga0207695_10077338 | Ga0207695_100773382 | 375 |
| 556 | 3300025923 | Ga0207681_10001532 | Ga0207681_1000153213 | 375 |
| 557 | 3300025931 | Ga0207644_10007222 | Ga0207644_100072223 | 375 |
| 558 | 3300025941 | Ga0207711_10018707 | Ga0207711_100187074 | 375 |
| 559 | 3300025949 | Ga0207667_10093904 | Ga0207667_100939043 | 375 |
| 560 | 3300025961 | Ga0207712_10323349 | Ga0207712_103233491 | 375 |
| 561 | 3300025972 | Ga0207668_10001925 | Ga0207668_100019257 | 375 |
| 562 | 3300025986 | Ga0207658_10000625 | Ga0207658_1000062517 | 375 |
| 563 | 3300025986 | Ga0207658_10001396 | Ga0207658_100013962 | 375 |
| 564 | 3300026088 | Ga0207641_10000195 | Ga0207641_1000019561 | 375 |
| 565 | 3300026088 | Ga0207641_10014892 | Ga0207641_100148921 | 375 |
| 566 | 3300026088 | Ga0207641_10035452 | Ga0207641_100354522 | 375 |
| 567 | 3300026095 | Ga0207676_10026705 | Ga0207676_100267053 | 375 |
| 568 | 3300026116 | Ga0207674_10057678 | Ga0207674_100576785 | 375 |
| 569 | 3300026142 | Ga0207698_10000036 | Ga0207698_1000003647 | 375 |
| 570 | 3300027111 | Ga0209281_1015308 | Ga0209281_10153082 | 375 |
| 571 | 3300028379 | Ga0268266_10000694 | Ga0268266_1000069434 | 375 |
| 572 | 3300028379 | Ga0268266_10009905 | Ga0268266_100099052 | 375 |
| 573 | 3300028380 | Ga0268265_10131709 | Ga0268265_101317092 | 375 |
| 574 | 3300028381 | Ga0268264_10000066 | Ga0268264_1000006653 | 375 |
| 575 | 3300028381 | Ga0268264_10012271 | Ga0268264_100122713 | 375 |
| 576 | 3300031616 | Ga0307508_10004576 | Ga0307508_100045765 | 375 |
| 577 | 3300032005 | Ga0307411_10244623 | Ga0307411_102446231 | 375 |
| 578 | 3300038705 | Ga0237819_01392 | Ga0237819_01392_120_1259 | 375 |
| 579 | 3300046452 | Ga0495617_037259 | Ga0495617_037259_111_1256 | 375 |
| 580 | 3300046453 | Ga0495627_000912 | Ga0495627_000912_16575_17720 | 375 |
| 581 | 3300046500 | Ga0495596_0000736 | Ga0495596_0000736_16811_17965 | 375 |
| 582 | 3300046512 | Ga0495610_0000206 | Ga0495610_0000206_35588_36733 | 375 |
| 583 | 3300046520 | Ga0495637_0006825 | Ga0495637_0006825_654_1787 | 375 |
| 584 | 3300046691 | Ga0495670_0096517 | Ga0495670_0096517_167_1324 | 375 |
| 585 | 3300047470 | Ga0495681_0000106 | Ga0495681_0000106_23234_24379 | 375 |
| 586 | 3300047472 | Ga0495686_0027514 | Ga0495686_0027514_2349_3494 | 375 |
| 587 | 3300047472 | Ga0495686_0177568 | Ga0495686_0177568_15_1142 | 375 |
| 588 | 3300048091 | Ga0495626_0001664 | Ga0495626_0001664_9619_10773 | 375 |
| 589 | 3300048904 | Ga0496101_0186842 | Ga0496101_0186842_11_1150 | 375 |
| 590 | 3300048908 | Ga0496105_0000436 | Ga0496105_0000436_18444_19619 | 375 |
| 591 | 3300048919 | Ga0496116_0000062 | Ga0496116_0000062_42634_43773 | 375 |
| 592 | 3300048919 | Ga0496116_0058621 | Ga0496116_0058621_496_1635 | 375 |
| 593 | 3300048920 | Ga0496117_0042297 | Ga0496117_0042297_814_1989 | 375 |
| 594 | 3300048920 | Ga0496117_0088922 | Ga0496117_0088922_695_1834 | 375 |
| 595 | 3300048921 | Ga0496118_0006969 | Ga0496118_0006969_2999_4174 | 375 |
| 596 | 3300048924 | Ga0496121_0002119 | Ga0496121_0002119_20216_21355 | 375 |
| 597 | 3300048924 | Ga0496121_0003456 | Ga0496121_0003456_6740_7915 | 375 |
| 598 | 3300048924 | Ga0496121_0234814 | Ga0496121_0234814_73_1257 | 375 |
| 599 | 3300048925 | Ga0496122_0002041 | Ga0496122_0002041_25552_26691 | 375 |
| 600 | 3300048926 | Ga0496123_0000428 | Ga0496123_0000428_4123_5262 | 375 |
| 601 | 3300048927 | Ga0496124_0001631 | Ga0496124_0001631_22550_23716 | 375 |
| 602 | 3300048927 | Ga0496124_0161244 | Ga0496124_0161244_89_1228 | 375 |
| 603 | 3300048928 | Ga0496125_0000663 | Ga0496125_0000663_888_2027 | 375 |
| 604 | 3300048928 | Ga0496125_0009305 | Ga0496125_0009305_509_1675 | 375 |
| 605 | 3300048929 | Ga0496126_0006947 | Ga0496126_0006947_2767_3933 | 375 |
| 606 | 3300048929 | Ga0496126_0093778 | Ga0496126_0093778_128_1267 | 375 |
| 607 | 3300049573 | Ga0501037_0044933 | Ga0501037_0044933_1439_2578 | 375 |
| 608 | 3300049823 | Ga0501044_0000424 | Ga0501044_0000424_36675_37814 | 375 |
| 609 | 3300050489 | nmdc:mga03683_53_c1 | nmdc:mga03683_53_c1_16160_17332 | 375 |
| 610 | 3300050489 | nmdc:mga03683_7266_c1 | nmdc:mga03683_7266_c1_2105_3244 | 375 |
| 611 | 3300050490 | nmdc:mga03n38_47651_c1 | nmdc:mga03n38_47651_c1_22_1194 | 375 |
| 612 | 3300050491 | nmdc:mga00v17_22427_c1 | nmdc:mga00v17_22427_c1_1175_2359 | 375 |
| 613 | 3300050493 | nmdc:mga0k408_5_c2 | nmdc:mga0k408_5_c2_95681_96853 | 375 |
| 614 | 3300050496 | nmdc:mga07m45_30_c1 | nmdc:mga07m45_30_c1_52688_53833 | 375 |
| 615 | 3300053121 | Ga0500607_000009 | Ga0500607_000009_52059_53210 | 375 |
| 616 | 3300053121 | Ga0500607_000162 | Ga0500607_000162_45418_46557 | 375 |
| 617 | 3300053136 | Ga0500559_0000353 | Ga0500559_0000353_32644_33795 | 375 |
| 618 | 3300053136 | Ga0500559_0000540 | Ga0500559_0000540_1245_2390 | 375 |
| 619 | 3300053148 | Ga0500590_015582 | Ga0500590_015582_1470_2657 | 375 |
| 620 | 3300053156 | Ga0500622_0000924 | Ga0500622_0000924_19319_20467 | 375 |
| 621 | 3300053178 | Ga0500637_0002218 | Ga0500637_0002218_3844_4989 | 375 |
| 622 | 3300053730 | Ga0500645_037364 | Ga0500645_037364_263_1414 | 375 |
| 623 | 3300048922 | Ga0496119_0109473 | Ga0496119_0109473_346_1491 | 376 |
| 624 | 3300048923 | Ga0496120_0008554 | Ga0496120_0008554_2325_3470 | 376 |
| 625 | 3300048927 | Ga0496124_0000071 | Ga0496124_0000071_11530_12675 | 376 |
| 626 | 3300048929 | Ga0496126_0052633 | Ga0496126_0052633_120_1265 | 376 |
| 627 | iso_pu_bacteria | 2775507255 | 2778124379 | 376 |
| 628 | iso_pu_bacteria | 3000865235 | 3000867470 | 376 |
| 629 | 3300005445 | Ga0070708_100226767 | Ga0070708_1002267672 | 377 |
| 630 | 3300005841 | Ga0068863_100068810 | Ga0068863_1000688103 | 377 |
| 631 | 3300006042 | Ga0075368_10018571 | Ga0075368_100185712 | 378 |
| 632 | 3300006048 | Ga0075363_100008368 | Ga0075363_1000083684 | 378 |
| 633 | 3300006178 | Ga0075367_10000067 | Ga0075367_1000006717 | 378 |
| 634 | 3300006353 | Ga0075370_10178916 | Ga0075370_101789161 | 378 |
| 635 | 3300027866 | Ga0209813_10000041 | Ga0209813_1000004140 | 378 |
| 636 | 3300050490 | nmdc:mga03n38_38987_c1 | nmdc:mga03n38_38987_c1_894_2030 | 378 |
| 637 | 3300050494 | nmdc:mga06z11_9_c1 | nmdc:mga06z11_9_c1_15709_16845 | 378 |
| 638 | 3300050495 | nmdc:mga04h51_128_c1 | nmdc:mga04h51_128_c1_15700_16836 | 378 |
| 639 | 3300053730 | Ga0500645_005022 | Ga0500645_005022_3682_4845 | 378 |
| 640 | 3300005578 | Ga0068854_100050156 | Ga0068854_1000501563 | 379 |
| 641 | 3300005616 | Ga0068852_100085589 | Ga0068852_1000855892 | 379 |
| 642 | 3300048919 | Ga0496116_0071188 | Ga0496116_0071188_596_1792 | 379 |
| 643 | 3300048920 | Ga0496117_0154240 | Ga0496117_0154240_203_1342 | 379 |
| 644 | 3300048924 | Ga0496121_0000175 | Ga0496121_0000175_70198_71394 | 379 |
| 645 | 3300048927 | Ga0496124_0027468 | Ga0496124_0027468_555_1751 | 379 |
| 646 | 3300053140 | Ga0500573_0000029 | Ga0500573_0000029_24151_25302 | 379 |
| 647 | 3300009148 | Ga0105243_10253334 | Ga0105243_102533342 | 380 |
| 648 | 3300049574 | Ga0501038_0206188 | Ga0501038_0206188_202_1353 | 380 |
| 649 | 2162886007 | SwRhRL2b_contig_1296284 | SwRhRL2b_0190.00000810 | 381 |
| 650 | 3300001904 | JGI24736J21556_1000271 | JGI24736J21556_10002717 | 381 |
| 651 | 3300001915 | JGI24741J21665_1000044 | JGI24741J21665_100004413 | 381 |
| 652 | 3300001979 | JGI24740J21852_10000438 | JGI24740J21852_1000043812 | 381 |
| 653 | 3300005289 | Ga0065704_10125720 | Ga0065704_101257202 | 381 |
| 654 | 3300005355 | Ga0070671_100035026 | Ga0070671_1000350263 | 381 |
| 655 | 3300005466 | Ga0070685_10097002 | Ga0070685_100970021 | 381 |
| 656 | 3300005563 | Ga0068855_100037943 | Ga0068855_1000379431 | 381 |
| 657 | 3300009545 | Ga0105237_10017692 | Ga0105237_100176926 | 381 |
| 658 | 3300009978 | Ga0105148_100321 | Ga0105148_1003213 | 381 |
| 659 | 3300010375 | Ga0105239_10106211 | Ga0105239_101062111 | 381 |
| 660 | 3300013100 | Ga0157373_10113096 | Ga0157373_101130961 | 381 |
| 661 | 3300017792 | Ga0163161_10046224 | Ga0163161_100462244 | 381 |
| 662 | 3300025904 | Ga0207647_10028997 | Ga0207647_100289972 | 381 |
| 663 | 3300025911 | Ga0207654_10042898 | Ga0207654_100428982 | 381 |
| 664 | 3300025913 | Ga0207695_10030301 | Ga0207695_100303013 | 381 |
| 665 | 3300025919 | Ga0207657_10002424 | Ga0207657_100024248 | 381 |
| 666 | 3300026067 | Ga0207678_10001311 | Ga0207678_1000131113 | 381 |
| 667 | 3300026116 | Ga0207674_10054413 | Ga0207674_100544133 | 381 |
| 668 | 3300026142 | Ga0207698_10022290 | Ga0207698_100222905 | 381 |
| 669 | 3300031548 | Ga0307408_100100625 | Ga0307408_1001006252 | 381 |
| 670 | 3300031731 | Ga0307405_10036048 | Ga0307405_100360482 | 381 |
| 671 | 3300031852 | Ga0307410_10227732 | Ga0307410_102277321 | 381 |
| 672 | 3300031911 | Ga0307412_10075331 | Ga0307412_100753312 | 381 |
| 673 | 3300031995 | Ga0307409_100278623 | Ga0307409_1002786231 | 381 |
| 674 | 3300032005 | Ga0307411_10068934 | Ga0307411_100689342 | 381 |
| 675 | 3300048913 | Ga0496110_0082643 | Ga0496110_0082643_1419_2564 | 381 |
| 676 | 3300048925 | Ga0496122_0007531 | Ga0496122_0007531_5633_6778 | 381 |
| 677 | 3300048926 | Ga0496123_0003949 | Ga0496123_0003949_5285_6430 | 381 |
| 678 | 3300048927 | Ga0496124_0005460 | Ga0496124_0005460_7764_8909 | 381 |
| 679 | 3300048927 | Ga0496124_0069768 | Ga0496124_0069768_1082_2227 | 381 |
| 680 | 3300048928 | Ga0496125_0000445 | Ga0496125_0000445_5335_6480 | 381 |
| 681 | 3300048928 | Ga0496125_0104516 | Ga0496125_0104516_791_1936 | 381 |
| 682 | 3300048929 | Ga0496126_0108152 | Ga0496126_0108152_865_2010 | 381 |
| 683 | 3300049663 | Ga0501223_000084 | Ga0501223_000084_2969_4114 | 381 |
| 684 | 3300049705 | Ga0501225_0004209 | Ga0501225_0004209_2771_3916 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vlc-assembly1.cif.gz_A | crystal structure of udp-glcnac 2-epimerase from neisseria meningitidis bound to udp-glcnac | 0.9727 | 1 | 367 |
| 7vz6-assembly1.cif.gz_B | the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose | 0.9679 | 2 | 363 |
| 7vza-assembly1.cif.gz_D-3 | the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp | 0.9663 | 2 | 363 |
| 7vza-assembly1.cif.gz_F-4 | the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp | 0.966 | 2 | 363 |
| 7vza-assembly1.cif.gz_H-4 | the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp | 0.9656 | 2 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5enzB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9857 | 2 | 177 | 3.40.50.2000 |
| af_P27828_2_186_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.982 | 3 | 184 | 3.40.50.2000 |
| af_Q2G1J3_4_329_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9694 | 4 | 334 | 3.40.50.2000 |
| af_P27828_3_337_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9648 | 4 | 334 | 3.90.180.10 |
| af_P27828_2_186_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9612 | 3 | 184 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W1X5F7-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) | 0.9935 | 277 | 356 |
GO:0008761
|
| AF-A0A645ELD0-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) | 0.9859 | 201 | 369 |
GO:0008761
|
| AF-A0A377B7T1-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) | 0.9854 | 47 | 157 |
GO:0008761
|
| AF-A0A117LDD0-F1-model_v4 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (EC 5.1.3.14) | 0.9834 | 1 | 178 |
GO:0008761
|
| AF-A0A6I3TBJ2-F1-model_v4 | deleted | 0.9829 | 70 | 150 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar