F475040

General Info

Members Datasets Scaffolds Average Seq Length
684 240 1368 256

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100196804|Ga0068859_1001968042
Length 287
Sequence MSAAGPPQGANFTPSAGSDPAAAVSAEALRDVVHVVKMPVSSARPAAARTLSIRVLRYNPQDPASVPHLEAYELEEADGMTLFIALNEIREKQDPSLQFDFVCRAGICGSCAMIIDGRPGLACRTLTKNLGKEITLAPLPVFELIGDLSVNTGKWMRAMSERLQAWLHAKQAEVDLRRMEERMEPDLAQEIYELDRCIECGCCVAGCGTARMREDFVGAVGLNKIARFRLDPRDTRSDDDFYEVVGNDQGVFGCMSLLACHDVCPKQLPLATQIAFIRRKMAGMGWK

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
176 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
177 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 4.09
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100196804 3300005617 Bacteria 2100
2 Ga0065712_10073390 3300005290 Bacteria 4408
3 Ga0065715_10090300 3300005293 Bacteria 7271
4 Ga0065707_10002989 3300005295 Bacteria 10649
5 Ga0070658_10441387 3300005327 Bacteria 1121
6 Ga0070676_10024944 3300005328 Bacteria 3374
7 Ga0070676_10145080 3300005328 Bacteria 1514
8 Ga0070676_10171557 3300005328 Bacteria 1403
9 Ga0070676_10191223 3300005328 Bacteria 1336
10 Ga0070683_100018349 3300005329 Bacteria 6194
11 Ga0070690_100016596 3300005330 Bacteria 4415
12 Ga0070690_100103823 3300005330 Bacteria 1887
13 Ga0070670_100005270 3300005331 Bacteria 10892
14 Ga0070670_100008262 3300005331 Bacteria 8863
15 Ga0070670_100052530 3300005331 Bacteria 3500
16 Ga0070670_100105972 3300005331 Bacteria 2422
17 Ga0070670_100268014 3300005331 Bacteria 1490
18 Ga0070670_100302880 3300005331 Bacteria 1398
19 Ga0068869_100037516 3300005334 Bacteria 3446
20 Ga0068869_100147098 3300005334 Bacteria 1824
21 Ga0068869_100183496 3300005334 Bacteria 1641
22 Ga0068869_100183614 3300005334 Bacteria 1641
23 Ga0070666_10039066 3300005335 Bacteria 3161
24 Ga0070666_10081066 3300005335 Bacteria 2218
25 Ga0070680_100115060 3300005336 Bacteria 2241
26 Ga0068868_100037364 3300005338 Bacteria 3764
27 Ga0068868_100159883 3300005338 Bacteria 1860
28 Ga0068868_100546299 3300005338 Bacteria 1020
29 Ga0070660_100033125 3300005339 Bacteria 3892
30 Ga0070660_100102423 3300005339 Bacteria 2269
31 Ga0070660_100338109 3300005339 Bacteria 1239
32 Ga0070689_100001097 3300005340 Bacteria 16989
33 Ga0070689_100195965 3300005340 Unclassified 1647
34 Ga0070689_100305178 3300005340 Bacteria 1326
35 Ga0070689_100575908 3300005340 Bacteria 973
36 Ga0070687_100115915 3300005343 Bacteria 1524
37 Ga0070661_100034438 3300005344 Bacteria 3672
38 Ga0070661_100044811 3300005344 Bacteria 3232
39 Ga0070661_100057128 3300005344 Bacteria 2859
40 Ga0070661_100183319 3300005344 Bacteria 1593
41 Ga0070661_100251150 3300005344 Bacteria 1365
42 Ga0070692_10108701 3300005345 Bacteria 1531
43 Ga0070668_100004282 3300005347 Bacteria 10588
44 Ga0070668_100036551 3300005347 Bacteria 3749
45 Ga0070668_100086662 3300005347 Bacteria 2463
46 Ga0070668_100128244 3300005347 Bacteria 2034
47 Ga0070668_100513743 3300005347 Bacteria 1038
48 Ga0070669_100010576 3300005353 Bacteria 6552
49 Ga0070669_100021621 3300005353 Bacteria 4598
50 Ga0070669_100026606 3300005353 Bacteria 4163
51 Ga0070669_100026890 3300005353 Bacteria 4140
52 Ga0070669_100047459 3300005353 Bacteria 3133
53 Ga0070669_100051584 3300005353 Bacteria 3008
54 Ga0070669_100192226 3300005353 Bacteria 1601
55 Ga0070669_100357018 3300005353 Bacteria 1188
56 Ga0070669_100598449 3300005353 Bacteria 923
57 Ga0070675_100023093 3300005354 Bacteria 4970
58 Ga0070675_100029309 3300005354 Bacteria 4438
59 Ga0070675_100057032 3300005354 Bacteria 3220
60 Ga0070675_100060926 3300005354 Bacteria 3115
61 Ga0070675_100074333 3300005354 Bacteria 2823
62 Ga0070675_100286706 3300005354 Bacteria 1448
63 Ga0070675_100308031 3300005354 Bacteria 1397
64 Ga0070671_100002596 3300005355 Bacteria 13991
65 Ga0070671_100146443 3300005355 Bacteria 1993
66 Ga0070674_100060954 3300005356 Bacteria 2631
67 Ga0070674_100081267 3300005356 Bacteria 2316
68 Ga0070673_100027623 3300005364 Bacteria 4209
69 Ga0070673_100033558 3300005364 Bacteria 3878
70 Ga0070673_100068132 3300005364 Bacteria 2849
71 Ga0070673_100080367 3300005364 Bacteria 2641
72 Ga0070673_100146997 3300005364 Bacteria 1993
73 Ga0070688_100007046 3300005365 Bacteria 6046
74 Ga0070688_100208915 3300005365 Bacteria 1370
75 Ga0070688_100296548 3300005365 Bacteria 1167
76 Ga0070659_100055933 3300005366 Bacteria 3110
77 Ga0070667_100006493 3300005367 Bacteria 9724
78 Ga0070667_100017624 3300005367 Bacteria 5916
79 Ga0070667_100038224 3300005367 Bacteria 4024
80 Ga0070667_100048343 3300005367 Bacteria 3580
81 Ga0070667_100111613 3300005367 Bacteria 2372
82 Ga0070667_100227246 3300005367 Bacteria 1663
83 Ga0070701_10041544 3300005438 Bacteria 2344
84 Ga0070701_10085273 3300005438 Bacteria 1719
85 Ga0070701_10132072 3300005438 Bacteria 1419
86 Ga0070705_100170128 3300005440 Bacteria 1466
87 Ga0070700_100273925 3300005441 Bacteria 1221
88 Ga0070694_100182860 3300005444 Bacteria 1551
89 Ga0070694_100252878 3300005444 Bacteria 1334
90 Ga0070663_100269744 3300005455 Bacteria 1352
91 Ga0070678_100034019 3300005456 Bacteria 3545
92 Ga0070678_100169720 3300005456 Bacteria 1776
93 Ga0070678_100184479 3300005456 Bacteria 1711
94 Ga0070678_100312141 3300005456 Bacteria 1340
95 Ga0070678_100436060 3300005456 Bacteria 1145
96 Ga0070678_100615453 3300005456 Bacteria 971
97 Ga0070662_100009881 3300005457 Bacteria 6251
98 Ga0070662_100054467 3300005457 Bacteria 2899
99 Ga0070662_100103759 3300005457 Bacteria 2156
100 Ga0070662_100137326 3300005457 Bacteria 1891
101 Ga0070662_100244374 3300005457 Bacteria 1440
102 Ga0070681_10052249 3300005458 Bacteria 4075
103 Ga0070681_10068041 3300005458 Bacteria 3529
104 Ga0070681_10108695 3300005458 Bacteria 2713
105 Ga0068867_100090086 3300005459 Bacteria 2326
106 Ga0068867_100101704 3300005459 Bacteria 2196
107 Ga0068867_100197851 3300005459 Bacteria 1607
108 Ga0068867_100676758 3300005459 Bacteria 908
109 Ga0070685_10148130 3300005466 Bacteria 1485
110 Ga0070685_10157165 3300005466 Bacteria 1446
111 Ga0070698_100202045 3300005471 Bacteria 1923
112 Ga0070679_100145092 3300005530 Bacteria 2351
113 Ga0070679_100303600 3300005530 Bacteria 1547
114 Ga0070684_100063752 3300005535 Bacteria 3231
115 Ga0070684_100185049 3300005535 Bacteria 1894
116 Ga0070684_100327121 3300005535 Bacteria 1408
117 Ga0068853_100040526 3300005539 Bacteria 3974
118 Ga0068853_100254461 3300005539 Bacteria 1613
119 Ga0070672_100004002 3300005543 Bacteria 9608
120 Ga0070672_100031647 3300005543 Bacteria 3984
121 Ga0070672_100046716 3300005543 Bacteria 3355
122 Ga0070672_100057437 3300005543 Bacteria 3055
123 Ga0070672_100076620 3300005543 Bacteria 2672
124 Ga0070672_100120559 3300005543 Bacteria 2146
125 Ga0070686_100025228 3300005544 Bacteria 3574
126 Ga0070686_100054663 3300005544 Bacteria 2555
127 Ga0070686_100150390 3300005544 Bacteria 1630
128 Ga0070695_100044604 3300005545 Bacteria 2824
129 Ga0070695_100226665 3300005545 Bacteria 1349
130 Ga0070695_100616149 3300005545 Bacteria 853
131 Ga0070696_100013077 3300005546 Bacteria 5568
132 Ga0070665_100005511 3300005548 Bacteria 13028
133 Ga0070665_100058191 3300005548 Bacteria 3875
134 Ga0070665_100169020 3300005548 Bacteria 2188
135 Ga0070665_100199078 3300005548 Bacteria 2004
136 Ga0070665_100345972 3300005548 Bacteria 1492
137 Ga0070704_100080749 3300005549 Bacteria 2393
138 Ga0070704_100772794 3300005549 Bacteria 857
139 Ga0068855_100102065 3300005563 Bacteria 3301
140 Ga0068855_100224946 3300005563 Bacteria 2103
141 Ga0070664_100070501 3300005564 Bacteria 2993
142 Ga0070664_100317291 3300005564 Bacteria 1411
143 Ga0070664_100543863 3300005564 Bacteria 1073
144 Ga0068857_100042247 3300005577 Bacteria 4043
145 Ga0068857_100074294 3300005577 Bacteria 3029
146 Ga0068857_100378644 3300005577 Bacteria 1314
147 Ga0068854_100046269 3300005578 Bacteria 3097
148 Ga0068854_100096339 3300005578 Bacteria 2211
149 Ga0068854_100427723 3300005578 Bacteria 1101
150 Ga0070702_100030857 3300005615 Bacteria 2926
151 Ga0068852_100007226 3300005616 Bacteria 8100
152 Ga0068852_100144045 3300005616 Bacteria 2208
153 Ga0068859_100004393 3300005617 Bacteria 14383
154 Ga0068859_100319519 3300005617 Bacteria 1646
155 Ga0068864_100002253 3300005618 Bacteria 15949
156 Ga0068864_100002433 3300005618 Bacteria 15392
157 Ga0068864_100087853 3300005618 Bacteria 2737
158 Ga0068864_100142329 3300005618 Bacteria 2165
159 Ga0068864_100430929 3300005618 Bacteria 1258
160 Ga0068866_10003907 3300005718 Bacteria 6117
161 Ga0068861_100037111 3300005719 Bacteria 3622
162 Ga0068861_100067854 3300005719 Bacteria 2754
163 Ga0068861_100126473 3300005719 Bacteria 2068
164 Ga0068861_100282217 3300005719 Bacteria 1431
165 Ga0068851_10010569 3300005834 Bacteria 4310
166 Ga0068851_10029828 3300005834 Bacteria 2702
167 Ga0068851_10283706 3300005834 Bacteria 948
168 Ga0068870_10049727 3300005840 Bacteria 2213
169 Ga0068870_10169802 3300005840 Bacteria 1301
170 Ga0068863_100006387 3300005841 Bacteria 11561
171 Ga0068863_100028525 3300005841 Bacteria 5330
172 Ga0068863_100051893 3300005841 Bacteria 3887
173 Ga0068863_100080259 3300005841 Bacteria 3090
174 Ga0068863_100110976 3300005841 Bacteria 2612
175 Ga0068863_100208406 3300005841 Bacteria 1882
176 Ga0068863_100454908 3300005841 Bacteria 1257
177 Ga0068858_100005933 3300005842 Bacteria 11926
178 Ga0068858_100014006 3300005842 Bacteria 7566
179 Ga0068858_100148739 3300005842 Bacteria 2201
180 Ga0068858_100283902 3300005842 Bacteria 1576
181 Ga0068860_100011123 3300005843 Bacteria 8865
182 Ga0068860_100019589 3300005843 Bacteria 6561
183 Ga0068860_100021053 3300005843 Bacteria 6318
184 Ga0068860_100077769 3300005843 Bacteria 3156
185 Ga0068860_100114044 3300005843 Bacteria 2584
186 Ga0068860_100268498 3300005843 Bacteria 1664
187 Ga0068860_100317981 3300005843 Bacteria 1527
188 Ga0068862_100141802 3300005844 Bacteria 2133
189 Ga0068862_100210286 3300005844 Bacteria 1757
190 Ga0068862_100399305 3300005844 Bacteria 1286
191 Ga0068862_100486870 3300005844 Bacteria 1168
192 Ga0081538_10002640 3300005981 Bacteria 17308
193 Ga0081538_10041681 3300005981 Bacteria 2909
194 Ga0070712_100015334 3300006175 Bacteria 4932
195 Ga0075369_10053566 3300006186 Bacteria 1751
196 Ga0075366_10000429 3300006195 Bacteria 19662
197 Ga0097621_100018546 3300006237 Bacteria 5319
198 Ga0097621_100113172 3300006237 Bacteria 2295
199 Ga0097621_100130415 3300006237 Bacteria 2140
200 Ga0068871_100026413 3300006358 Bacteria 4531
201 Ga0068871_100085925 3300006358 Bacteria 2613
202 Ga0075428_100001720 3300006844 Bacteria 23394
203 Ga0075428_100016022 3300006844 Bacteria 8290
204 Ga0075428_100131517 3300006844 Bacteria 2722
205 Ga0075428_100186313 3300006844 Bacteria 2246
206 Ga0075431_100000325 3300006847 Bacteria 37691
207 Ga0075431_100003569 3300006847 Bacteria 15068
208 Ga0075433_10002325 3300006852 Bacteria 14474
209 Ga0075433_10018745 3300006852 Bacteria 5758
210 Ga0075433_10047154 3300006852 Bacteria 3748
211 Ga0075433_10056426 3300006852 Bacteria 3430
212 Ga0075433_10084371 3300006852 Bacteria 2804
213 Ga0075433_10148791 3300006852 Bacteria 2082
214 Ga0075433_10406666 3300006852 Bacteria 1201
215 Ga0075434_100002836 3300006871 Bacteria 15354
216 Ga0075434_100008905 3300006871 Bacteria 9342
217 Ga0075434_100017855 3300006871 Bacteria 6844
218 Ga0075434_100019818 3300006871 Bacteria 6512
219 Ga0075434_100078105 3300006871 Bacteria 3305
220 Ga0075434_100251306 3300006871 Bacteria 1787
221 Ga0075434_100440200 3300006871 Bacteria 1324
222 Ga0075429_100049199 3300006880 Bacteria 3666
223 Ga0068865_100006814 3300006881 Bacteria 6996
224 Ga0068865_100183086 3300006881 Bacteria 1615
225 Ga0068865_100502931 3300006881 Bacteria 1011
226 Ga0075436_100029694 3300006914 Bacteria 3760
227 Ga0097620_100004393 3300006931 Bacteria 14383
228 Ga0097620_100196804 3300006931 Bacteria 2100
229 Ga0097620_100319536 3300006931 Bacteria 1646
230 Ga0075435_100015332 3300007076 Bacteria 5759
231 Ga0075435_100037701 3300007076 Bacteria 3850
232 Ga0075435_100090484 3300007076 Bacteria 2524
233 Ga0075435_100199113 3300007076 Bacteria 1697
234 Ga0105240_10237501 3300009093 Bacteria 2114
235 Ga0111539_10000087 3300009094 Bacteria 95344
236 Ga0111539_10008130 3300009094 Bacteria 13365
237 Ga0111539_10034034 3300009094 Bacteria 6182
238 Ga0111539_10042845 3300009094 Bacteria 5431
239 Ga0111539_10170719 3300009094 Bacteria 2541
240 Ga0111539_10256629 3300009094 Bacteria 2036
241 Ga0111539_10576345 3300009094 Bacteria 1311
242 Ga0111539_10814899 3300009094 Bacteria 1086
243 Ga0105245_10064970 3300009098 Bacteria 3299
244 Ga0105245_10346664 3300009098 Bacteria 1470
245 Ga0105247_10014517 3300009101 Bacteria 4725
246 Ga0105247_10050147 3300009101 Bacteria 2568
247 Ga0114129_10004609 3300009147 Bacteria 19462
248 Ga0114129_10088672 3300009147 Bacteria 4288
249 Ga0105243_10012320 3300009148 Bacteria 6467
250 Ga0105243_10063916 3300009148 Bacteria 2951
251 Ga0105243_10236056 3300009148 Bacteria 1625
252 Ga0105243_10437064 3300009148 Bacteria 1224
253 Ga0105241_10063317 3300009174 Bacteria 2853
254 Ga0105241_10091221 3300009174 Bacteria 2403
255 Ga0105242_10000690 3300009176 Bacteria 26481
256 Ga0105242_10009955 3300009176 Bacteria 7280
257 Ga0105242_10259794 3300009176 Bacteria 1568
258 Ga0105248_10006666 3300009177 Bacteria 12669
259 Ga0105248_10008024 3300009177 Bacteria 11592
260 Ga0105248_10604382 3300009177 Bacteria 1237
261 Ga0105248_10625069 3300009177 Bacteria 1215
262 Ga0105248_10698704 3300009177 Bacteria 1144
263 Ga0105237_10129384 3300009545 Bacteria 2519
264 Ga0105237_10610753 3300009545 Bacteria 1097
265 Ga0105238_10020021 3300009551 Bacteria 6812
266 Ga0105238_10226912 3300009551 Bacteria 1844
267 Ga0105238_10306449 3300009551 Bacteria 1572
268 Ga0105249_10098367 3300009553 Bacteria 2748
269 Ga0105249_10537476 3300009553 Bacteria 1218
270 Ga0105249_10778485 3300009553 Bacteria 1020
271 Ga0105239_10206508 3300010375 Bacteria 2201
272 Ga0157346_1001567 3300012480 Bacteria 1100
273 Ga0157373_10024795 3300013100 Bacteria 4342
274 Ga0157370_10215235 3300013104 Bacteria 1780
275 Ga0157374_10014018 3300013296 Bacteria 7006
276 Ga0157374_10034766 3300013296 Bacteria 4607
277 Ga0157374_10068119 3300013296 Bacteria 3348
278 Ga0157378_10114508 3300013297 Bacteria 2477
279 Ga0157378_10128244 3300013297 Bacteria 2345
280 Ga0157378_10158345 3300013297 Bacteria 2116
281 Ga0157378_10173718 3300013297 Bacteria 2023
282 Ga0163162_10045703 3300013306 Bacteria 4387
283 Ga0163162_10088143 3300013306 Bacteria 3183
284 Ga0163162_10106671 3300013306 Bacteria 2897
285 Ga0163162_10109838 3300013306 Bacteria 2855
286 Ga0163162_10111964 3300013306 Bacteria 2828
287 Ga0163162_10200590 3300013306 Bacteria 2124
288 Ga0163162_10223661 3300013306 Bacteria 2012
289 Ga0163162_10404038 3300013306 Bacteria 1499
290 Ga0157372_10004478 3300013307 Bacteria 14904
291 Ga0157372_10164549 3300013307 Bacteria 2565
292 Ga0157375_10003441 3300013308 Bacteria 13718
293 Ga0157375_10082441 3300013308 Bacteria 3258
294 Ga0157375_10277416 3300013308 Bacteria 1839
295 Ga0157375_10349250 3300013308 Bacteria 1645
296 Ga0157375_10356103 3300013308 Bacteria 1630
297 Ga0157375_10384726 3300013308 Bacteria 1570
298 Ga0157375_10799927 3300013308 Bacteria 1092
299 Ga0163163_10029639 3300014325 Bacteria 5267
300 Ga0163163_10043724 3300014325 Bacteria 4393
301 Ga0163163_10087767 3300014325 Bacteria 3121
302 Ga0163163_10324714 3300014325 Bacteria 1593
303 Ga0157380_10044340 3300014326 Bacteria 3485
304 Ga0157380_10055257 3300014326 Bacteria 3152
305 Ga0157380_10448877 3300014326 Bacteria 1238
306 Ga0157380_10487577 3300014326 Bacteria 1194
307 Ga0157380_10579425 3300014326 Bacteria 1106
308 Ga0157380_10589005 3300014326 Bacteria 1098
309 Ga0157377_10014904 3300014745 Bacteria 3966
310 Ga0157377_10065159 3300014745 Bacteria 2092
311 Ga0157379_10000258 3300014968 Bacteria 41557
312 Ga0157379_10012433 3300014968 Bacteria 7431
313 Ga0157379_10015823 3300014968 Bacteria 6628
314 Ga0157379_10051815 3300014968 Bacteria 3664
315 Ga0157379_10278329 3300014968 Bacteria 1522
316 Ga0157379_10293566 3300014968 Bacteria 1481
317 Ga0157379_10302798 3300014968 Bacteria 1457
318 Ga0157379_10337298 3300014968 Bacteria 1378
319 Ga0157379_10814879 3300014968 Bacteria 882
320 Ga0157376_10021387 3300014969 Bacteria 5023
321 Ga0157376_10089099 3300014969 Bacteria 2667
322 Ga0157376_10157603 3300014969 Bacteria 2054
323 Ga0157376_10237997 3300014969 Bacteria 1695
324 Ga0157376_10294439 3300014969 Bacteria 1534
325 Ga0157376_10442528 3300014969 Bacteria 1266
326 Ga0157376_10524870 3300014969 Bacteria 1168
327 Ga0182007_10050280 3300015262 Bacteria 1376
328 Ga0163161_10033921 3300017792 Bacteria 3649
329 Ga0163161_10042264 3300017792 Bacteria 3278
330 Ga0163161_10079019 3300017792 Bacteria 2418
331 Ga0163161_10083418 3300017792 Bacteria 2355
332 Ga0163161_10124543 3300017792 Bacteria 1939
333 Ga0163161_10136961 3300017792 Bacteria 1852
334 Ga0163161_10409115 3300017792 Bacteria 1089
335 Ga0207697_10012327 3300025315 Bacteria 3586
336 Ga0207697_10019382 3300025315 Bacteria 2786
337 Ga0207697_10034474 3300025315 Bacteria 2072
338 Ga0207656_10007772 3300025321 Bacteria 3923
339 Ga0207656_10113279 3300025321 Bacteria 1256
340 Ga0207682_10001219 3300025893 Bacteria 11881
341 Ga0207682_10003685 3300025893 Bacteria 6603
342 Ga0207642_10077772 3300025899 Bacteria 1601
343 Ga0207710_10018460 3300025900 Bacteria 2967
344 Ga0207710_10019528 3300025900 Bacteria 2891
345 Ga0207688_10010228 3300025901 Bacteria 5107
346 Ga0207688_10015810 3300025901 Bacteria 4094
347 Ga0207680_10027620 3300025903 Bacteria 3163
348 Ga0207680_10307947 3300025903 Bacteria 1105
349 Ga0207645_10000785 3300025907 Bacteria 26534
350 Ga0207645_10023449 3300025907 Bacteria 4012
351 Ga0207645_10104512 3300025907 Bacteria 1829
352 Ga0207645_10141501 3300025907 Bacteria 1568
353 Ga0207645_10181860 3300025907 Bacteria 1379
354 Ga0207643_10002722 3300025908 Bacteria 9562
355 Ga0207643_10031102 3300025908 Bacteria 2974
356 Ga0207643_10233012 3300025908 Bacteria 1130
357 Ga0207684_10007261 3300025910 Bacteria 10005
358 Ga0207707_10004795 3300025912 Bacteria 11864
359 Ga0207707_10117379 3300025912 Bacteria 2326
360 Ga0207693_10080665 3300025915 Bacteria 2547
361 Ga0207660_10016052 3300025917 Bacteria 4951
362 Ga0207660_10202949 3300025917 Bacteria 1549
363 Ga0207662_10004859 3300025918 Bacteria 7107
364 Ga0207662_10090639 3300025918 Bacteria 1880
365 Ga0207662_10141029 3300025918 Bacteria 1527
366 Ga0207662_10223304 3300025918 Bacteria 1228
367 Ga0207657_10006112 3300025919 Bacteria 12517
368 Ga0207657_10012335 3300025919 Bacteria 8442
369 Ga0207657_10047273 3300025919 Bacteria 3764
370 Ga0207657_10392255 3300025919 Bacteria 1092
371 Ga0207649_10190169 3300025920 Bacteria 1443
372 Ga0207649_10337160 3300025920 Bacteria 1112
373 Ga0207681_10007613 3300025923 Bacteria 6638
374 Ga0207681_10017691 3300025923 Bacteria 4480
375 Ga0207681_10094434 3300025923 Bacteria 2143
376 Ga0207681_10102019 3300025923 Bacteria 2071
377 Ga0207681_10136991 3300025923 Bacteria 1818
378 Ga0207681_10182349 3300025923 Bacteria 1600
379 Ga0207681_10324994 3300025923 Bacteria 1224
380 Ga0207681_10411979 3300025923 Bacteria 1093
381 Ga0207694_10078519 3300025924 Bacteria 2588
382 Ga0207650_10004321 3300025925 Bacteria 9702
383 Ga0207650_10009523 3300025925 Bacteria 6639
384 Ga0207650_10010604 3300025925 Bacteria 6328
385 Ga0207650_10014282 3300025925 Bacteria 5517
386 Ga0207650_10059079 3300025925 Bacteria 2857
387 Ga0207650_10218435 3300025925 Bacteria 1533
388 Ga0207659_10003261 3300025926 Bacteria 9718
389 Ga0207659_10031306 3300025926 Bacteria 3641
390 Ga0207659_10035447 3300025926 Bacteria 3448
391 Ga0207659_10127287 3300025926 Bacteria 1961
392 Ga0207659_10372857 3300025926 Bacteria 1189
393 Ga0207687_10081776 3300025927 Bacteria 2335
394 Ga0207644_10010061 3300025931 Bacteria 6228
395 Ga0207644_10237416 3300025931 Bacteria 1450
396 Ga0207644_10266629 3300025931 Bacteria 1371
397 Ga0207706_10011667 3300025933 Bacteria 8012
398 Ga0207706_10018722 3300025933 Bacteria 6229
399 Ga0207706_10045851 3300025933 Bacteria 3872
400 Ga0207706_10129922 3300025933 Bacteria 2215
401 Ga0207706_10296525 3300025933 Bacteria 1409
402 Ga0207686_10019007 3300025934 Bacteria 3899
403 Ga0207709_10032220 3300025935 Bacteria 3067
404 Ga0207709_10069819 3300025935 Bacteria 2225
405 Ga0207670_10209835 3300025936 Bacteria 1485
406 Ga0207669_10009851 3300025937 Bacteria 4571
407 Ga0207669_10117476 3300025937 Bacteria 1797
408 Ga0207669_10130156 3300025937 Bacteria 1727
409 Ga0207704_10045810 3300025938 Bacteria 2601
410 Ga0207704_10067998 3300025938 Bacteria 2244
411 Ga0207704_10106221 3300025938 Bacteria 1885
412 Ga0207704_10507308 3300025938 Bacteria 973
413 Ga0207665_10214678 3300025939 Bacteria 1407
414 Ga0207691_10002075 3300025940 Bacteria 19550
415 Ga0207691_10009142 3300025940 Bacteria 9510
416 Ga0207691_10009216 3300025940 Bacteria 9475
417 Ga0207691_10020396 3300025940 Bacteria 6265
418 Ga0207691_10026948 3300025940 Bacteria 5392
419 Ga0207691_10032258 3300025940 Bacteria 4885
420 Ga0207691_10062638 3300025940 Bacteria 3374
421 Ga0207691_10072660 3300025940 Bacteria 3103
422 Ga0207691_10073795 3300025940 Bacteria 3077
423 Ga0207711_10005459 3300025941 Bacteria 10749
424 Ga0207711_10011471 3300025941 Bacteria 7367
425 Ga0207711_10012512 3300025941 Bacteria 7052
426 Ga0207711_10024048 3300025941 Bacteria 5100
427 Ga0207711_10215708 3300025941 Bacteria 1754
428 Ga0207711_10496893 3300025941 Bacteria 1137
429 Ga0207711_10592112 3300025941 Bacteria 1035
430 Ga0207689_10006427 3300025942 Bacteria 10390
431 Ga0207689_10020331 3300025942 Bacteria 5590
432 Ga0207689_10036483 3300025942 Bacteria 4081
433 Ga0207689_10046656 3300025942 Bacteria 3580
434 Ga0207689_10183144 3300025942 Bacteria 1727
435 Ga0207661_10254103 3300025944 Bacteria 1563
436 Ga0207679_10042031 3300025945 Bacteria 3282
437 Ga0207679_10124586 3300025945 Bacteria 2057
438 Ga0207651_10004677 3300025960 Bacteria 6938
439 Ga0207651_10027955 3300025960 Bacteria 3550
440 Ga0207651_10128361 3300025960 Bacteria 1936
441 Ga0207668_10021382 3300025972 Bacteria 4126
442 Ga0207668_10058562 3300025972 Bacteria 2694
443 Ga0207668_10060856 3300025972 Bacteria 2652
444 Ga0207668_10083171 3300025972 Bacteria 2328
445 Ga0207668_10155315 3300025972 Bacteria 1777
446 Ga0207668_10187998 3300025972 Bacteria 1634
447 Ga0207668_10304655 3300025972 Bacteria 1316
448 Ga0207668_10629778 3300025972 Bacteria 937
449 Ga0207640_10033612 3300025981 Bacteria 3193
450 Ga0207658_10002792 3300025986 Bacteria 12572
451 Ga0207658_10014853 3300025986 Bacteria 5336
452 Ga0207658_10135974 3300025986 Bacteria 1982
453 Ga0207658_10159901 3300025986 Bacteria 1845
454 Ga0207658_10170402 3300025986 Bacteria 1793
455 Ga0207658_10286440 3300025986 Bacteria 1414
456 Ga0207677_10016037 3300026023 Bacteria 4425
457 Ga0207677_10110792 3300026023 Bacteria 2044
458 Ga0207677_10325908 3300026023 Bacteria 1278
459 Ga0207703_10001830 3300026035 Bacteria 18952
460 Ga0207703_10270702 3300026035 Bacteria 1539
461 Ga0207639_10057431 3300026041 Bacteria 2988
462 Ga0207639_10151264 3300026041 Bacteria 1944
463 Ga0207678_10016032 3300026067 Bacteria 6581
464 Ga0207678_10365930 3300026067 Bacteria 1245
465 Ga0207708_10006845 3300026075 Bacteria 8432
466 Ga0207708_10028014 3300026075 Bacteria 4266
467 Ga0207708_10083596 3300026075 Bacteria 2454
468 Ga0207708_10107813 3300026075 Bacteria 2160
469 Ga0207708_10139409 3300026075 Bacteria 1901
470 Ga0207708_10190974 3300026075 Bacteria 1630
471 Ga0207641_10021712 3300026088 Bacteria 5276
472 Ga0207641_10046854 3300026088 Bacteria 3644
473 Ga0207641_10151936 3300026088 Bacteria 2097
474 Ga0207641_10208336 3300026088 Bacteria 1807
475 Ga0207641_10406917 3300026088 Bacteria 1307
476 Ga0207641_10474123 3300026088 Bacteria 1212
477 Ga0207648_10006409 3300026089 Bacteria 11698
478 Ga0207648_10021348 3300026089 Bacteria 5820
479 Ga0207648_10061431 3300026089 Bacteria 3276
480 Ga0207648_10121750 3300026089 Bacteria 2294
481 Ga0207648_10506975 3300026089 Bacteria 1105
482 Ga0207676_10003990 3300026095 Bacteria 10418
483 Ga0207676_10010289 3300026095 Bacteria 6659
484 Ga0207676_10010862 3300026095 Bacteria 6495
485 Ga0207676_10065895 3300026095 Bacteria 2886
486 Ga0207676_10139344 3300026095 Bacteria 2074
487 Ga0207676_10177221 3300026095 Bacteria 1863
488 Ga0207676_10193761 3300026095 Bacteria 1790
489 Ga0207676_10419711 3300026095 Bacteria 1254
490 Ga0207676_10933625 3300026095 Bacteria 852
491 Ga0207674_10003711 3300026116 Bacteria 18650
492 Ga0207674_10003982 3300026116 Bacteria 17963
493 Ga0207674_10128648 3300026116 Bacteria 2497
494 Ga0207674_10194405 3300026116 Bacteria 1978
495 Ga0207675_100003497 3300026118 Bacteria 15329
496 Ga0207675_100009247 3300026118 Bacteria 9242
497 Ga0207675_100027220 3300026118 Bacteria 5325
498 Ga0207675_100046886 3300026118 Bacteria 4037
499 Ga0207675_100071767 3300026118 Bacteria 3238
500 Ga0207675_100150809 3300026118 Bacteria 2212
501 Ga0207675_100252473 3300026118 Bacteria 1707
502 Ga0207675_100564426 3300026118 Bacteria 1138
503 Ga0207675_100622829 3300026118 Bacteria 1084
504 Ga0207683_10011064 3300026121 Bacteria 7688
505 Ga0207683_10023373 3300026121 Bacteria 5317
506 Ga0207683_10050984 3300026121 Bacteria 3626
507 Ga0207683_10073344 3300026121 Bacteria 3028
508 Ga0207683_10192935 3300026121 Bacteria 1850
509 Ga0207698_10754363 3300026142 Bacteria 972
510 Ga0209588_1019933 3300027671 Bacteria 2097
511 Ga0207428_10000173 3300027907 Bacteria 90064
512 Ga0207428_10021067 3300027907 Bacteria 5523
513 Ga0207428_10203295 3300027907 Bacteria 1490
514 Ga0268266_10032193 3300028379 Bacteria 4455
515 Ga0268266_10061594 3300028379 Bacteria 3236
516 Ga0268265_10025711 3300028380 Bacteria 4182
517 Ga0268265_10052152 3300028380 Bacteria 3092
518 Ga0268265_10163389 3300028380 Bacteria 1894
519 Ga0268265_10189021 3300028380 Bacteria 1776
520 Ga0268265_10192693 3300028380 Bacteria 1762
521 Ga0268265_10215774 3300028380 Bacteria 1675
522 Ga0268264_10015506 3300028381 Bacteria 6247
523 Ga0268264_10038152 3300028381 Bacteria 3964
524 Ga0268264_10063390 3300028381 Bacteria 3106
525 Ga0268264_10091217 3300028381 Bacteria 2628
526 Ga0268264_10098867 3300028381 Bacteria 2531
527 Ga0268264_10106873 3300028381 Bacteria 2444
528 Ga0268264_10834834 3300028381 Bacteria 922
529 Ga0316576_10009155 3300031727 Bacteria 6380
530 Ga0316576_10223423 3300031727 Bacteria 1416
531 Ga0316576_10224033 3300031727 Bacteria 1414
532 Ga0316578_10022953 3300031728 Bacteria 3487
533 Ga0316578_10026806 3300031728 Bacteria 3252
534 Ga0316578_10094029 3300031728 Bacteria 1793
535 Ga0373941_0025253 3300035115 Bacteria 1714
536 Ga0373943_0057696 3300035170 Bacteria 1930
537 Ga0316574_0013405 3300035398 Bacteria 4712
538 Ga0316574_0091542 3300035398 Bacteria 1939
539 Ga0316574_0162373 3300035398 Bacteria 1438
540 Ga0316574_0234698 3300035398 Bacteria 1173
541 Ga0373931_0044342 3300035691 Bacteria 2345
542 Ga0373947_0299335 3300035725 Bacteria 1072
543 Ga0373937_0781629 3300036401 Bacteria 902
544 Ga0316582_0176801 3300036647 Bacteria 1451
545 Ga0316584_0033030 3300036712 Bacteria 3831
546 Ga0316584_0060277 3300036712 Bacteria 2842
547 Ga0373925_0065745 3300037068 Bacteria 2732
548 Ga0395900_0019377 3300037418 Bacteria 6939
549 Ga0395898_0011982 3300037466 Bacteria 8976
550 Ga0395901_0106947 3300038443 Bacteria 2936
551 Ga0400490_18295 3300038726 Bacteria 112507
552 Ga0400490_32130 3300038726 Bacteria 32229
553 Ga0242420_010195 3300038996 Bacteria 1556
554 Ga0242420_017358 3300038996 Bacteria 1259
555 Ga0400489_49957 3300039093 Bacteria 3355
556 Ga0400489_76612 3300039093 Bacteria 4860
557 Ga0436361_0660602 3300039447 Bacteria 1244
558 Ga0439437_008944 3300042000 Bacteria 1132
559 Ga0439441_015581 3300042001 Bacteria 1346
560 Ga0439435_0035175 3300042436 Bacteria 1380
561 Ga0439464_0005561 3300042439 Bacteria 3262
562 Ga0439460_0007985 3300042461 Bacteria 2664
563 Ga0451577_0000160 3300042876 Bacteria 147192
564 Ga0451577_0001218 3300042876 Bacteria 35907
565 Ga0451577_0001837 3300042876 Bacteria 27069
566 Ga0451577_0007430 3300042876 Bacteria 10763
567 Ga0451577_0031034 3300042876 Bacteria 4823
568 Ga0451577_0221954 3300042876 Bacteria 1708
569 Ga0453683_0105625 3300044673 Bacteria 1769
570 Ga0453684_0000052 3300044712 Bacteria 546732
571 Ga0453684_0004837 3300044712 Bacteria 27646
572 Ga0453684_0208023 3300044712 Bacteria 2276
573 Ga0453684_0254204 3300044712 Bacteria 2016
574 Ga0451576_0002497 3300045051 Bacteria 27315
575 Ga0451576_0005175 3300045051 Bacteria 16499
576 Ga0451576_0054692 3300045051 Bacteria 4178
577 Ga0451576_0067314 3300045051 Bacteria 3728
578 Ga0451576_0506517 3300045051 Bacteria 1268
579 Ga0451576_0575168 3300045051 Bacteria 1184
580 Ga0495651_0030705 3300046462 Bacteria 4190
581 Ga0495580_0046889 3300046472 Bacteria 3065
582 Ga0495580_0055245 3300046472 Bacteria 2799
583 Ga0495580_0062009 3300046472 Bacteria 2624
584 Ga0495608_0021110 3300046511 Bacteria 4472
585 Ga0495628_0169725 3300046516 Bacteria 1655
586 Ga0495587_0017851 3300046536 Bacteria 4402
587 Ga0495598_0007215 3300046537 Bacteria 2540
588 Ga0495645_0092355 3300046543 Bacteria 2161
589 Ga0495645_0099786 3300046543 Bacteria 2066
590 Ga0495635_0042778 3300046663 Bacteria 3127
591 Ga0495599_0042229 3300046678 Bacteria 2861
592 Ga0496100_0007430 3300048903 Bacteria 6046
593 Ga0496101_0064399 3300048904 Bacteria 2670
594 Ga0496101_0246262 3300048904 Bacteria 1392
595 Ga0496102_0052531 3300048905 Bacteria 3714
596 Ga0496102_0094632 3300048905 Bacteria 2768
597 Ga0496102_0261851 3300048905 Bacteria 1630
598 Ga0496102_0351204 3300048905 Bacteria 1388
599 Ga0496103_0063395 3300048906 Bacteria 2302
600 Ga0496104_0004946 3300048907 Bacteria 11627
601 Ga0496104_0176282 3300048907 Bacteria 2048
602 Ga0496105_0084637 3300048908 Bacteria 2620
603 Ga0496106_0006839 3300048909 Bacteria 8440
604 Ga0496106_0008227 3300048909 Bacteria 7712
605 Ga0496106_0189753 3300048909 Bacteria 1634
606 Ga0496106_0237528 3300048909 Bacteria 1456
607 Ga0496107_0024302 3300048910 Bacteria 4287
608 Ga0496108_0001021 3300048911 Bacteria 21815
609 Ga0496109_0004372 3300048912 Bacteria 11803
610 Ga0496109_0103452 3300048912 Bacteria 2643
611 Ga0496109_0356851 3300048912 Bacteria 1381
612 Ga0496110_0005019 3300048913 Bacteria 10339
613 Ga0496110_0791656 3300048913 Bacteria 852
614 Ga0496111_0084883 3300048914 Bacteria 2315
615 Ga0496111_0388539 3300048914 Bacteria 1032
616 Ga0496112_0004051 3300048915 Bacteria 12294
617 Ga0496112_0400101 3300048915 Bacteria 1313
618 Ga0496114_0082340 3300048917 Bacteria 2720
619 Ga0496115_0009812 3300048918 Bacteria 7130
620 Ga0501036_0721957 3300049572 Bacteria 823
621 Ga0501039_0275476 3300049575 Bacteria 1323
622 Ga0501040_0134244 3300049576 Bacteria 1742
623 Ga0501042_0069222 3300049578 Bacteria 2524
624 Ga0501046_0102722 3300049580 Bacteria 2192
625 Ga0501071_0129139 3300049587 Bacteria 1877
626 Ga0501071_0392852 3300049587 Bacteria 1059
627 Ga0501072_0044585 3300049588 Bacteria 3487
628 Ga0501072_0048788 3300049588 Bacteria 3333
629 Ga0501074_0240647 3300049590 Bacteria 1287
630 Ga0501075_0102302 3300049591 Bacteria 2176
631 Ga0501075_0288523 3300049591 Bacteria 1250
632 Ga0501076_0024570 3300049592 Bacteria 4659
633 Ga0501076_0178277 3300049592 Bacteria 1732
634 Ga0501079_0031280 3300049741 Bacteria 4090
635 Ga0501079_0154103 3300049741 Bacteria 1791
636 Ga0501080_0217170 3300049742 Bacteria 1751
637 Ga0501081_0002423 3300049743 Bacteria 11770
638 Ga0501081_0378874 3300049743 Bacteria 1045
639 Ga0501081_0507897 3300049743 Bacteria 899
640 Ga0501035_0377398 3300049822 Bacteria 1183
641 Ga0501045_0309217 3300049824 Bacteria 1176
642 nmdc:mga00v17_35925_c1 3300050491 Bacteria 2951
643 nmdc:mga0k408_1278_c1 3300050493 Bacteria 13673
644 nmdc:mga05p37_166192_c1 3300050507 Bacteria 2693
645 nmdc:mga05p37_180919_c1 3300050507 Bacteria 2565
646 nmdc:mga05p37_84428_c1 3300050507 Bacteria 2991
647 nmdc:mga05p37_9619_c1 3300050507 Bacteria 11451
648 nmdc:mga06r32_156967_c1 3300050510 Bacteria 2257
649 nmdc:mga06r32_16654_c1 3300050510 Bacteria 6698
650 nmdc:mga06r32_286_c1 3300050510 Bacteria 41965
651 nmdc:mga06r32_88481_c1 3300050510 Bacteria 3023
652 nmdc:mga08y16_140837_c1 3300050511 Bacteria 2508
653 nmdc:mga08y16_14929_c1 3300050511 Bacteria 8171
654 nmdc:mga08y16_156697_c1 3300050511 Bacteria 2367
655 nmdc:mga08y16_179843_c1 3300050511 Bacteria 2196
656 nmdc:mga08y16_54272_c1 3300050511 Bacteria 4187
657 nmdc:mga08y16_602856_c1 3300050511 Bacteria 1107
658 nmdc:mga08y16_689087_c1 3300050511 Bacteria 1023
659 nmdc:mga0n895_16330_c1 3300050512 Bacteria 6808
660 nmdc:mga0n895_25942_c1 3300050512 Bacteria 5542
661 nmdc:mga0n895_48798_c1 3300050512 Bacteria 4146
662 nmdc:mga0n895_50709_c1 3300050512 Bacteria 4069
663 nmdc:mga0n895_55301_c1 3300050512 Bacteria 3906
664 nmdc:mga0n895_61760_c1 3300050512 Bacteria 3701
665 nmdc:mga0rr50_10137_c1 3300050513 Bacteria 5964
666 nmdc:mga0rr50_106589_c1 3300050513 Bacteria 2211
667 nmdc:mga0rr50_45039_c1 3300050513 Bacteria 1925
668 nmdc:mga0rr50_48728_c1 3300050513 Bacteria 3133
669 nmdc:mga0rr50_99667_c1 3300050513 Bacteria 2280
670 nmdc:mga0a205_10348_c1 3300050515 Bacteria 8575
671 nmdc:mga0a205_16323_c1 3300050515 Bacteria 6953
672 nmdc:mga0a205_182442_c1 3300050515 Bacteria 1993
673 nmdc:mga0a205_2381_c1 3300050515 Bacteria 16567
674 nmdc:mga0a205_244182_c1 3300050515 Bacteria 1676
675 nmdc:mga0a205_47526_c1 3300050515 Bacteria 4141
676 nmdc:mga0a205_50867_c1 3300050515 Bacteria 4000
677 nmdc:mga0a205_9660_c1 3300050515 Bacteria 7226
678 nmdc:mga0sz30_6388_c1 3300050516 Bacteria 1775
679 Ga0495601_0046049 3300053077 Bacteria 2745
680 Ga0501084_0021865 3300054114 Bacteria 5334
681 Ga0501084_0186722 3300054114 Bacteria 1749
682 Ga0501082_0007685 3300060353 Bacteria 9305
683 Ga0530510_0567996 3300061734 Bacteria 862
684 2524003562 2523533628 Bacteria 4098242
685 Ga0068859_100196804
686 Ga0065712_10073390
687 Ga0065715_10090300
688 Ga0065707_10002989
689 Ga0070658_10441387
690 Ga0070676_10024944
691 Ga0070676_10145080
692 Ga0070676_10171557
693 Ga0070676_10191223
694 Ga0070683_100018349
695 Ga0070690_100016596
696 Ga0070690_100103823
697 Ga0070670_100005270
698 Ga0070670_100008262
699 Ga0070670_100052530
700 Ga0070670_100105972
701 Ga0070670_100268014
702 Ga0070670_100302880
703 Ga0068869_100037516
704 Ga0068869_100147098
705 Ga0068869_100183496
706 Ga0068869_100183614
707 Ga0070666_10039066
708 Ga0070666_10081066
709 Ga0070680_100115060
710 Ga0068868_100037364
711 Ga0068868_100159883
712 Ga0068868_100546299
713 Ga0070660_100033125
714 Ga0070660_100102423
715 Ga0070660_100338109
716 Ga0070689_100001097
717 Ga0070689_100195965
718 Ga0070689_100305178
719 Ga0070689_100575908
720 Ga0070687_100115915
721 Ga0070661_100034438
722 Ga0070661_100044811
723 Ga0070661_100057128
724 Ga0070661_100183319
725 Ga0070661_100251150
726 Ga0070692_10108701
727 Ga0070668_100004282
728 Ga0070668_100036551
729 Ga0070668_100086662
730 Ga0070668_100128244
731 Ga0070668_100513743
732 Ga0070669_100010576
733 Ga0070669_100021621
734 Ga0070669_100026606
735 Ga0070669_100026890
736 Ga0070669_100047459
737 Ga0070669_100051584
738 Ga0070669_100192226
739 Ga0070669_100357018
740 Ga0070669_100598449
741 Ga0070675_100023093
742 Ga0070675_100029309
743 Ga0070675_100057032
744 Ga0070675_100060926
745 Ga0070675_100074333
746 Ga0070675_100286706
747 Ga0070675_100308031
748 Ga0070671_100002596
749 Ga0070671_100146443
750 Ga0070674_100060954
751 Ga0070674_100081267
752 Ga0070673_100027623
753 Ga0070673_100033558
754 Ga0070673_100068132
755 Ga0070673_100080367
756 Ga0070673_100146997
757 Ga0070688_100007046
758 Ga0070688_100208915
759 Ga0070688_100296548
760 Ga0070659_100055933
761 Ga0070667_100006493
762 Ga0070667_100017624
763 Ga0070667_100038224
764 Ga0070667_100048343
765 Ga0070667_100111613
766 Ga0070667_100227246
767 Ga0070701_10041544
768 Ga0070701_10085273
769 Ga0070701_10132072
770 Ga0070705_100170128
771 Ga0070700_100273925
772 Ga0070694_100182860
773 Ga0070694_100252878
774 Ga0070663_100269744
775 Ga0070678_100034019
776 Ga0070678_100169720
777 Ga0070678_100184479
778 Ga0070678_100312141
779 Ga0070678_100436060
780 Ga0070678_100615453
781 Ga0070662_100009881
782 Ga0070662_100054467
783 Ga0070662_100103759
784 Ga0070662_100137326
785 Ga0070662_100244374
786 Ga0070681_10052249
787 Ga0070681_10068041
788 Ga0070681_10108695
789 Ga0068867_100090086
790 Ga0068867_100101704
791 Ga0068867_100197851
792 Ga0068867_100676758
793 Ga0070685_10148130
794 Ga0070685_10157165
795 Ga0070698_100202045
796 Ga0070679_100145092
797 Ga0070679_100303600
798 Ga0070684_100063752
799 Ga0070684_100185049
800 Ga0070684_100327121
801 Ga0068853_100040526
802 Ga0068853_100254461
803 Ga0070672_100004002
804 Ga0070672_100031647
805 Ga0070672_100046716
806 Ga0070672_100057437
807 Ga0070672_100076620
808 Ga0070672_100120559
809 Ga0070686_100025228
810 Ga0070686_100054663
811 Ga0070686_100150390
812 Ga0070695_100044604
813 Ga0070695_100226665
814 Ga0070695_100616149
815 Ga0070696_100013077
816 Ga0070665_100005511
817 Ga0070665_100058191
818 Ga0070665_100169020
819 Ga0070665_100199078
820 Ga0070665_100345972
821 Ga0070704_100080749
822 Ga0070704_100772794
823 Ga0068855_100102065
824 Ga0068855_100224946
825 Ga0070664_100070501
826 Ga0070664_100317291
827 Ga0070664_100543863
828 Ga0068857_100042247
829 Ga0068857_100074294
830 Ga0068857_100378644
831 Ga0068854_100046269
832 Ga0068854_100096339
833 Ga0068854_100427723
834 Ga0070702_100030857
835 Ga0068852_100007226
836 Ga0068852_100144045
837 Ga0068859_100004393
838 Ga0068859_100319519
839 Ga0068864_100002253
840 Ga0068864_100002433
841 Ga0068864_100087853
842 Ga0068864_100142329
843 Ga0068864_100430929
844 Ga0068866_10003907
845 Ga0068861_100037111
846 Ga0068861_100067854
847 Ga0068861_100126473
848 Ga0068861_100282217
849 Ga0068851_10010569
850 Ga0068851_10029828
851 Ga0068851_10283706
852 Ga0068870_10049727
853 Ga0068870_10169802
854 Ga0068863_100006387
855 Ga0068863_100028525
856 Ga0068863_100051893
857 Ga0068863_100080259
858 Ga0068863_100110976
859 Ga0068863_100208406
860 Ga0068863_100454908
861 Ga0068858_100005933
862 Ga0068858_100014006
863 Ga0068858_100148739
864 Ga0068858_100283902
865 Ga0068860_100011123
866 Ga0068860_100019589
867 Ga0068860_100021053
868 Ga0068860_100077769
869 Ga0068860_100114044
870 Ga0068860_100268498
871 Ga0068860_100317981
872 Ga0068862_100141802
873 Ga0068862_100210286
874 Ga0068862_100399305
875 Ga0068862_100486870
876 Ga0081538_10002640
877 Ga0081538_10041681
878 Ga0070712_100015334
879 Ga0075369_10053566
880 Ga0075366_10000429
881 Ga0097621_100018546
882 Ga0097621_100113172
883 Ga0097621_100130415
884 Ga0068871_100026413
885 Ga0068871_100085925
886 Ga0075428_100001720
887 Ga0075428_100016022
888 Ga0075428_100131517
889 Ga0075428_100186313
890 Ga0075431_100000325
891 Ga0075431_100003569
892 Ga0075433_10002325
893 Ga0075433_10018745
894 Ga0075433_10047154
895 Ga0075433_10056426
896 Ga0075433_10084371
897 Ga0075433_10148791
898 Ga0075433_10406666
899 Ga0075434_100002836
900 Ga0075434_100008905
901 Ga0075434_100017855
902 Ga0075434_100019818
903 Ga0075434_100078105
904 Ga0075434_100251306
905 Ga0075434_100440200
906 Ga0075429_100049199
907 Ga0068865_100006814
908 Ga0068865_100183086
909 Ga0068865_100502931
910 Ga0075436_100029694
911 Ga0097620_100004393
912 Ga0097620_100196804
913 Ga0097620_100319536
914 Ga0075435_100015332
915 Ga0075435_100037701
916 Ga0075435_100090484
917 Ga0075435_100199113
918 Ga0105240_10237501
919 Ga0111539_10000087
920 Ga0111539_10008130
921 Ga0111539_10034034
922 Ga0111539_10042845
923 Ga0111539_10170719
924 Ga0111539_10256629
925 Ga0111539_10576345
926 Ga0111539_10814899
927 Ga0105245_10064970
928 Ga0105245_10346664
929 Ga0105247_10014517
930 Ga0105247_10050147
931 Ga0114129_10004609
932 Ga0114129_10088672
933 Ga0105243_10012320
934 Ga0105243_10063916
935 Ga0105243_10236056
936 Ga0105243_10437064
937 Ga0105241_10063317
938 Ga0105241_10091221
939 Ga0105242_10000690
940 Ga0105242_10009955
941 Ga0105242_10259794
942 Ga0105248_10006666
943 Ga0105248_10008024
944 Ga0105248_10604382
945 Ga0105248_10625069
946 Ga0105248_10698704
947 Ga0105237_10129384
948 Ga0105237_10610753
949 Ga0105238_10020021
950 Ga0105238_10226912
951 Ga0105238_10306449
952 Ga0105249_10098367
953 Ga0105249_10537476
954 Ga0105249_10778485
955 Ga0105239_10206508
956 Ga0157346_1001567
957 Ga0157373_10024795
958 Ga0157370_10215235
959 Ga0157374_10014018
960 Ga0157374_10034766
961 Ga0157374_10068119
962 Ga0157378_10114508
963 Ga0157378_10128244
964 Ga0157378_10158345
965 Ga0157378_10173718
966 Ga0163162_10045703
967 Ga0163162_10088143
968 Ga0163162_10106671
969 Ga0163162_10109838
970 Ga0163162_10111964
971 Ga0163162_10200590
972 Ga0163162_10223661
973 Ga0163162_10404038
974 Ga0157372_10004478
975 Ga0157372_10164549
976 Ga0157375_10003441
977 Ga0157375_10082441
978 Ga0157375_10277416
979 Ga0157375_10349250
980 Ga0157375_10356103
981 Ga0157375_10384726
982 Ga0157375_10799927
983 Ga0163163_10029639
984 Ga0163163_10043724
985 Ga0163163_10087767
986 Ga0163163_10324714
987 Ga0157380_10044340
988 Ga0157380_10055257
989 Ga0157380_10448877
990 Ga0157380_10487577
991 Ga0157380_10579425
992 Ga0157380_10589005
993 Ga0157377_10014904
994 Ga0157377_10065159
995 Ga0157379_10000258
996 Ga0157379_10012433
997 Ga0157379_10015823
998 Ga0157379_10051815
999 Ga0157379_10278329
1000 Ga0157379_10293566
1001 Ga0157379_10302798
1002 Ga0157379_10337298
1003 Ga0157379_10814879
1004 Ga0157376_10021387
1005 Ga0157376_10089099
1006 Ga0157376_10157603
1007 Ga0157376_10237997
1008 Ga0157376_10294439
1009 Ga0157376_10442528
1010 Ga0157376_10524870
1011 Ga0182007_10050280
1012 Ga0163161_10033921
1013 Ga0163161_10042264
1014 Ga0163161_10079019
1015 Ga0163161_10083418
1016 Ga0163161_10124543
1017 Ga0163161_10136961
1018 Ga0163161_10409115
1019 Ga0207697_10012327
1020 Ga0207697_10019382
1021 Ga0207697_10034474
1022 Ga0207656_10007772
1023 Ga0207656_10113279
1024 Ga0207682_10001219
1025 Ga0207682_10003685
1026 Ga0207642_10077772
1027 Ga0207710_10018460
1028 Ga0207710_10019528
1029 Ga0207688_10010228
1030 Ga0207688_10015810
1031 Ga0207680_10027620
1032 Ga0207680_10307947
1033 Ga0207645_10000785
1034 Ga0207645_10023449
1035 Ga0207645_10104512
1036 Ga0207645_10141501
1037 Ga0207645_10181860
1038 Ga0207643_10002722
1039 Ga0207643_10031102
1040 Ga0207643_10233012
1041 Ga0207684_10007261
1042 Ga0207707_10004795
1043 Ga0207707_10117379
1044 Ga0207693_10080665
1045 Ga0207660_10016052
1046 Ga0207660_10202949
1047 Ga0207662_10004859
1048 Ga0207662_10090639
1049 Ga0207662_10141029
1050 Ga0207662_10223304
1051 Ga0207657_10006112
1052 Ga0207657_10012335
1053 Ga0207657_10047273
1054 Ga0207657_10392255
1055 Ga0207649_10190169
1056 Ga0207649_10337160
1057 Ga0207681_10007613
1058 Ga0207681_10017691
1059 Ga0207681_10094434
1060 Ga0207681_10102019
1061 Ga0207681_10136991
1062 Ga0207681_10182349
1063 Ga0207681_10324994
1064 Ga0207681_10411979
1065 Ga0207694_10078519
1066 Ga0207650_10004321
1067 Ga0207650_10009523
1068 Ga0207650_10010604
1069 Ga0207650_10014282
1070 Ga0207650_10059079
1071 Ga0207650_10218435
1072 Ga0207659_10003261
1073 Ga0207659_10031306
1074 Ga0207659_10035447
1075 Ga0207659_10127287
1076 Ga0207659_10372857
1077 Ga0207687_10081776
1078 Ga0207644_10010061
1079 Ga0207644_10237416
1080 Ga0207644_10266629
1081 Ga0207706_10011667
1082 Ga0207706_10018722
1083 Ga0207706_10045851
1084 Ga0207706_10129922
1085 Ga0207706_10296525
1086 Ga0207686_10019007
1087 Ga0207709_10032220
1088 Ga0207709_10069819
1089 Ga0207670_10209835
1090 Ga0207669_10009851
1091 Ga0207669_10117476
1092 Ga0207669_10130156
1093 Ga0207704_10045810
1094 Ga0207704_10067998
1095 Ga0207704_10106221
1096 Ga0207704_10507308
1097 Ga0207665_10214678
1098 Ga0207691_10002075
1099 Ga0207691_10009142
1100 Ga0207691_10009216
1101 Ga0207691_10020396
1102 Ga0207691_10026948
1103 Ga0207691_10032258
1104 Ga0207691_10062638
1105 Ga0207691_10072660
1106 Ga0207691_10073795
1107 Ga0207711_10005459
1108 Ga0207711_10011471
1109 Ga0207711_10012512
1110 Ga0207711_10024048
1111 Ga0207711_10215708
1112 Ga0207711_10496893
1113 Ga0207711_10592112
1114 Ga0207689_10006427
1115 Ga0207689_10020331
1116 Ga0207689_10036483
1117 Ga0207689_10046656
1118 Ga0207689_10183144
1119 Ga0207661_10254103
1120 Ga0207679_10042031
1121 Ga0207679_10124586
1122 Ga0207651_10004677
1123 Ga0207651_10027955
1124 Ga0207651_10128361
1125 Ga0207668_10021382
1126 Ga0207668_10058562
1127 Ga0207668_10060856
1128 Ga0207668_10083171
1129 Ga0207668_10155315
1130 Ga0207668_10187998
1131 Ga0207668_10304655
1132 Ga0207668_10629778
1133 Ga0207640_10033612
1134 Ga0207658_10002792
1135 Ga0207658_10014853
1136 Ga0207658_10135974
1137 Ga0207658_10159901
1138 Ga0207658_10170402
1139 Ga0207658_10286440
1140 Ga0207677_10016037
1141 Ga0207677_10110792
1142 Ga0207677_10325908
1143 Ga0207703_10001830
1144 Ga0207703_10270702
1145 Ga0207639_10057431
1146 Ga0207639_10151264
1147 Ga0207678_10016032
1148 Ga0207678_10365930
1149 Ga0207708_10006845
1150 Ga0207708_10028014
1151 Ga0207708_10083596
1152 Ga0207708_10107813
1153 Ga0207708_10139409
1154 Ga0207708_10190974
1155 Ga0207641_10021712
1156 Ga0207641_10046854
1157 Ga0207641_10151936
1158 Ga0207641_10208336
1159 Ga0207641_10406917
1160 Ga0207641_10474123
1161 Ga0207648_10006409
1162 Ga0207648_10021348
1163 Ga0207648_10061431
1164 Ga0207648_10121750
1165 Ga0207648_10506975
1166 Ga0207676_10003990
1167 Ga0207676_10010289
1168 Ga0207676_10010862
1169 Ga0207676_10065895
1170 Ga0207676_10139344
1171 Ga0207676_10177221
1172 Ga0207676_10193761
1173 Ga0207676_10419711
1174 Ga0207676_10933625
1175 Ga0207674_10003711
1176 Ga0207674_10003982
1177 Ga0207674_10128648
1178 Ga0207674_10194405
1179 Ga0207675_100003497
1180 Ga0207675_100009247
1181 Ga0207675_100027220
1182 Ga0207675_100046886
1183 Ga0207675_100071767
1184 Ga0207675_100150809
1185 Ga0207675_100252473
1186 Ga0207675_100564426
1187 Ga0207675_100622829
1188 Ga0207683_10011064
1189 Ga0207683_10023373
1190 Ga0207683_10050984
1191 Ga0207683_10073344
1192 Ga0207683_10192935
1193 Ga0207698_10754363
1194 Ga0209588_1019933
1195 Ga0207428_10000173
1196 Ga0207428_10021067
1197 Ga0207428_10203295
1198 Ga0268266_10032193
1199 Ga0268266_10061594
1200 Ga0268265_10025711
1201 Ga0268265_10052152
1202 Ga0268265_10163389
1203 Ga0268265_10189021
1204 Ga0268265_10192693
1205 Ga0268265_10215774
1206 Ga0268264_10015506
1207 Ga0268264_10038152
1208 Ga0268264_10063390
1209 Ga0268264_10091217
1210 Ga0268264_10098867
1211 Ga0268264_10106873
1212 Ga0268264_10834834
1213 Ga0316576_10009155
1214 Ga0316576_10223423
1215 Ga0316576_10224033
1216 Ga0316578_10022953
1217 Ga0316578_10026806
1218 Ga0316578_10094029
1219 Ga0373941_0025253
1220 Ga0373943_0057696
1221 Ga0316574_0013405
1222 Ga0316574_0091542
1223 Ga0316574_0162373
1224 Ga0316574_0234698
1225 Ga0373931_0044342
1226 Ga0373947_0299335
1227 Ga0373937_0781629
1228 Ga0316582_0176801
1229 Ga0316584_0033030
1230 Ga0316584_0060277
1231 Ga0373925_0065745
1232 Ga0395900_0019377
1233 Ga0395898_0011982
1234 Ga0395901_0106947
1235 Ga0400490_18295
1236 Ga0400490_32130
1237 Ga0242420_010195
1238 Ga0242420_017358
1239 Ga0400489_49957
1240 Ga0400489_76612
1241 Ga0436361_0660602
1242 Ga0439437_008944
1243 Ga0439441_015581
1244 Ga0439435_0035175
1245 Ga0439464_0005561
1246 Ga0439460_0007985
1247 Ga0451577_0000160
1248 Ga0451577_0001218
1249 Ga0451577_0001837
1250 Ga0451577_0007430
1251 Ga0451577_0031034
1252 Ga0451577_0221954
1253 Ga0453683_0105625
1254 Ga0453684_0000052
1255 Ga0453684_0004837
1256 Ga0453684_0208023
1257 Ga0453684_0254204
1258 Ga0451576_0002497
1259 Ga0451576_0005175
1260 Ga0451576_0054692
1261 Ga0451576_0067314
1262 Ga0451576_0506517
1263 Ga0451576_0575168
1264 Ga0495651_0030705
1265 Ga0495580_0046889
1266 Ga0495580_0055245
1267 Ga0495580_0062009
1268 Ga0495608_0021110
1269 Ga0495628_0169725
1270 Ga0495587_0017851
1271 Ga0495598_0007215
1272 Ga0495645_0092355
1273 Ga0495645_0099786
1274 Ga0495635_0042778
1275 Ga0495599_0042229
1276 Ga0496100_0007430
1277 Ga0496101_0064399
1278 Ga0496101_0246262
1279 Ga0496102_0052531
1280 Ga0496102_0094632
1281 Ga0496102_0261851
1282 Ga0496102_0351204
1283 Ga0496103_0063395
1284 Ga0496104_0004946
1285 Ga0496104_0176282
1286 Ga0496105_0084637
1287 Ga0496106_0006839
1288 Ga0496106_0008227
1289 Ga0496106_0189753
1290 Ga0496106_0237528
1291 Ga0496107_0024302
1292 Ga0496108_0001021
1293 Ga0496109_0004372
1294 Ga0496109_0103452
1295 Ga0496109_0356851
1296 Ga0496110_0005019
1297 Ga0496110_0791656
1298 Ga0496111_0084883
1299 Ga0496111_0388539
1300 Ga0496112_0004051
1301 Ga0496112_0400101
1302 Ga0496114_0082340
1303 Ga0496115_0009812
1304 Ga0501036_0721957
1305 Ga0501039_0275476
1306 Ga0501040_0134244
1307 Ga0501042_0069222
1308 Ga0501046_0102722
1309 Ga0501071_0129139
1310 Ga0501071_0392852
1311 Ga0501072_0044585
1312 Ga0501072_0048788
1313 Ga0501074_0240647
1314 Ga0501075_0102302
1315 Ga0501075_0288523
1316 Ga0501076_0024570
1317 Ga0501076_0178277
1318 Ga0501079_0031280
1319 Ga0501079_0154103
1320 Ga0501080_0217170
1321 Ga0501081_0002423
1322 Ga0501081_0378874
1323 Ga0501081_0507897
1324 Ga0501035_0377398
1325 Ga0501045_0309217
1326 nmdc:mga00v17_35925_c1
1327 nmdc:mga0k408_1278_c1
1328 nmdc:mga05p37_166192_c1
1329 nmdc:mga05p37_180919_c1
1330 nmdc:mga05p37_84428_c1
1331 nmdc:mga05p37_9619_c1
1332 nmdc:mga06r32_156967_c1
1333 nmdc:mga06r32_16654_c1
1334 nmdc:mga06r32_286_c1
1335 nmdc:mga06r32_88481_c1
1336 nmdc:mga08y16_140837_c1
1337 nmdc:mga08y16_14929_c1
1338 nmdc:mga08y16_156697_c1
1339 nmdc:mga08y16_179843_c1
1340 nmdc:mga08y16_54272_c1
1341 nmdc:mga08y16_602856_c1
1342 nmdc:mga08y16_689087_c1
1343 nmdc:mga0n895_16330_c1
1344 nmdc:mga0n895_25942_c1
1345 nmdc:mga0n895_48798_c1
1346 nmdc:mga0n895_50709_c1
1347 nmdc:mga0n895_55301_c1
1348 nmdc:mga0n895_61760_c1
1349 nmdc:mga0rr50_10137_c1
1350 nmdc:mga0rr50_106589_c1
1351 nmdc:mga0rr50_45039_c1
1352 nmdc:mga0rr50_48728_c1
1353 nmdc:mga0rr50_99667_c1
1354 nmdc:mga0a205_10348_c1
1355 nmdc:mga0a205_16323_c1
1356 nmdc:mga0a205_182442_c1
1357 nmdc:mga0a205_2381_c1
1358 nmdc:mga0a205_244182_c1
1359 nmdc:mga0a205_47526_c1
1360 nmdc:mga0a205_50867_c1
1361 nmdc:mga0a205_9660_c1
1362 nmdc:mga0sz30_6388_c1
1363 Ga0495601_0046049
1364 Ga0501084_0021865
1365 Ga0501084_0186722
1366 Ga0501082_0007685
1367 Ga0530510_0567996
1368 2524003562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

52

157

0.95

PF13183

Fer4_8

4Fe-4S dicluster domain

193

268

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.6988 8 126
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.6829 8 126
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.6794 29 98
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.6668 8 98
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.6547 9 99
ID Description Score Start End Superfamily
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9778 7 110 3.10.20.30
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9597 7 110 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.919 8 110 3.10.20.30
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9059 8 110 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9019 8 110 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A643CY32-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit (EC 1.3.5.1) 0.9726 7 104 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A3D4GDS9-F1-model_v4 deleted 0.9703 6 86
AF-A0A2T6RWR4-F1-model_v4 deleted 0.9642 4 86
AF-A0A842PZP7-F1-model_v4 deleted 0.9595 9 109
AF-K6GK16-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.9591 7 126 GO:0009055
GO:0009060
GO:0022904
GO:0051537

Map