F475000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 298 | 1366 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0771279|Ga0495628_0771279_296_598 |
| Length | 100 |
| Sequence | MEAALRALADGSRRTVLDTLTRGPATAGELAALLPIARPGVSRHLRVLREEAQRRVYSLRLEPLAEVDDWLGRYRALWEQRLDALHTEVARGKHERRSTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 153 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 177 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 291 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 292 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 293 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 294 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 295 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 296 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 297 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 298 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.24 |
| Metatranscriptomes | 0.59 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0.15 |
| Rhizoplane | 10.98 |
| Rhizosphere | 87.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495628_0771279 | 3300046516 | Bacteria | 674 |
| 2 | JGI25404J52841_10003782 | 3300003659 | Bacteria | 3020 |
| 3 | Ga0070683_100005393 | 3300005329 | Bacteria | 10671 |
| 4 | Ga0070683_100021347 | 3300005329 | Bacteria | 5779 |
| 5 | Ga0070683_100055211 | 3300005329 | Bacteria | 3685 |
| 6 | Ga0070683_100580946 | 3300005329 | Bacteria | 1072 |
| 7 | Ga0070680_100069290 | 3300005336 | Bacteria | 2896 |
| 8 | Ga0070682_100180085 | 3300005337 | Bacteria | 1475 |
| 9 | Ga0070660_100120063 | 3300005339 | Bacteria | 2097 |
| 10 | Ga0070691_10006793 | 3300005341 | Bacteria | 5232 |
| 11 | Ga0070661_100036685 | 3300005344 | Bacteria | 3563 |
| 12 | Ga0070661_100048252 | 3300005344 | Bacteria | 3117 |
| 13 | Ga0070668_100875321 | 3300005347 | Unclassified | 802 |
| 14 | Ga0070669_101431795 | 3300005353 | Bacteria | 600 |
| 15 | Ga0070675_100785942 | 3300005354 | Unclassified | 870 |
| 16 | Ga0070674_100239388 | 3300005356 | Bacteria | 1420 |
| 17 | Ga0070688_100364174 | 3300005365 | Bacteria | 1062 |
| 18 | Ga0070659_100366584 | 3300005366 | Bacteria | 1211 |
| 19 | Ga0070659_101624777 | 3300005366 | Unclassified | 577 |
| 20 | Ga0070709_10080940 | 3300005434 | Bacteria | 2118 |
| 21 | Ga0070709_10096958 | 3300005434 | Bacteria | 1956 |
| 22 | Ga0070714_100001437 | 3300005435 | Bacteria | 17329 |
| 23 | Ga0070714_100033972 | 3300005435 | Bacteria | 4270 |
| 24 | Ga0070714_100073913 | 3300005435 | Bacteria | 2954 |
| 25 | Ga0070714_100139755 | 3300005435 | Bacteria | 2172 |
| 26 | Ga0070714_100286558 | 3300005435 | Bacteria | 1532 |
| 27 | Ga0070714_100352097 | 3300005435 | Bacteria | 1383 |
| 28 | Ga0070714_100878953 | 3300005435 | Bacteria | 870 |
| 29 | Ga0070713_100000286 | 3300005436 | Bacteria | 33358 |
| 30 | Ga0070713_100058288 | 3300005436 | Bacteria | 3220 |
| 31 | Ga0070713_100071625 | 3300005436 | Bacteria | 2930 |
| 32 | Ga0070713_100115163 | 3300005436 | Bacteria | 2350 |
| 33 | Ga0070713_100116418 | 3300005436 | Bacteria | 2337 |
| 34 | Ga0070713_100594447 | 3300005436 | Bacteria | 1051 |
| 35 | Ga0070713_100888683 | 3300005436 | Bacteria | 857 |
| 36 | Ga0070713_102158319 | 3300005436 | Bacteria | 540 |
| 37 | Ga0070710_10029543 | 3300005437 | Bacteria | 2942 |
| 38 | Ga0070710_10098962 | 3300005437 | Bacteria | 1733 |
| 39 | Ga0070710_10184799 | 3300005437 | Bacteria | 1307 |
| 40 | Ga0070701_10255188 | 3300005438 | Bacteria | 1060 |
| 41 | Ga0070711_100018538 | 3300005439 | Bacteria | 4447 |
| 42 | Ga0070711_100095715 | 3300005439 | Bacteria | 2149 |
| 43 | Ga0070711_100200279 | 3300005439 | Bacteria | 1540 |
| 44 | Ga0070705_100166346 | 3300005440 | Bacteria | 1479 |
| 45 | Ga0070694_100044594 | 3300005444 | Bacteria | 2968 |
| 46 | Ga0070694_100271529 | 3300005444 | Bacteria | 1290 |
| 47 | Ga0070708_100000274 | 3300005445 | Bacteria | 38511 |
| 48 | Ga0070708_100316797 | 3300005445 | Bacteria | 1469 |
| 49 | Ga0070708_100389848 | 3300005445 | Bacteria | 1313 |
| 50 | Ga0070708_100574619 | 3300005445 | Bacteria | 1063 |
| 51 | Ga0070663_101975217 | 3300005455 | Bacteria | 525 |
| 52 | Ga0070681_10093222 | 3300005458 | Bacteria | 2960 |
| 53 | Ga0070706_100011662 | 3300005467 | Bacteria | 8164 |
| 54 | Ga0070706_100189864 | 3300005467 | Bacteria | 1920 |
| 55 | Ga0070706_100292693 | 3300005467 | Bacteria | 1519 |
| 56 | Ga0070706_101023268 | 3300005467 | Bacteria | 761 |
| 57 | Ga0070707_100024443 | 3300005468 | Bacteria | 5723 |
| 58 | Ga0070707_100118160 | 3300005468 | Bacteria | 2574 |
| 59 | Ga0070707_100186887 | 3300005468 | Bacteria | 2020 |
| 60 | Ga0070707_100218182 | 3300005468 | Bacteria | 1858 |
| 61 | Ga0070707_100554992 | 3300005468 | Bacteria | 1111 |
| 62 | Ga0070707_100980410 | 3300005468 | Bacteria | 810 |
| 63 | Ga0070707_101445683 | 3300005468 | Bacteria | 654 |
| 64 | Ga0070698_100014396 | 3300005471 | Bacteria | 8357 |
| 65 | Ga0070698_100017553 | 3300005471 | Bacteria | 7542 |
| 66 | Ga0070698_100126953 | 3300005471 | Bacteria | 2508 |
| 67 | Ga0070698_100128913 | 3300005471 | Bacteria | 2486 |
| 68 | Ga0070698_100156240 | 3300005471 | Bacteria | 2226 |
| 69 | Ga0070698_100182180 | 3300005471 | Bacteria | 2039 |
| 70 | Ga0070698_101341625 | 3300005471 | Bacteria | 666 |
| 71 | Ga0070698_102133477 | 3300005471 | Bacteria | 514 |
| 72 | Ga0070699_100000462 | 3300005518 | Bacteria | 38841 |
| 73 | Ga0070699_100005603 | 3300005518 | Bacteria | 11014 |
| 74 | Ga0070699_100364329 | 3300005518 | Bacteria | 1303 |
| 75 | Ga0070699_101399654 | 3300005518 | Bacteria | 641 |
| 76 | Ga0070679_100070794 | 3300005530 | Bacteria | 3479 |
| 77 | Ga0070679_100256179 | 3300005530 | Bacteria | 1705 |
| 78 | Ga0070684_100000509 | 3300005535 | Bacteria | 26687 |
| 79 | Ga0070684_100011478 | 3300005535 | Bacteria | 7056 |
| 80 | Ga0070684_100744829 | 3300005535 | Unclassified | 914 |
| 81 | Ga0070697_100000066 | 3300005536 | Bacteria | 83881 |
| 82 | Ga0070697_100148834 | 3300005536 | Bacteria | 1973 |
| 83 | Ga0070697_100571766 | 3300005536 | Bacteria | 992 |
| 84 | Ga0070697_101119128 | 3300005536 | Bacteria | 701 |
| 85 | Ga0070697_101598789 | 3300005536 | Bacteria | 583 |
| 86 | Ga0068853_100494557 | 3300005539 | Unclassified | 1154 |
| 87 | Ga0070672_100318393 | 3300005543 | Bacteria | 1322 |
| 88 | Ga0070672_102111667 | 3300005543 | Bacteria | 508 |
| 89 | Ga0070695_100095470 | 3300005545 | Bacteria | 1993 |
| 90 | Ga0070695_100121999 | 3300005545 | Bacteria | 1784 |
| 91 | Ga0070695_100935674 | 3300005545 | Bacteria | 702 |
| 92 | Ga0070696_100213742 | 3300005546 | Bacteria | 1444 |
| 93 | Ga0070696_100722734 | 3300005546 | Bacteria | 813 |
| 94 | Ga0070696_101077176 | 3300005546 | Bacteria | 674 |
| 95 | Ga0070704_100090956 | 3300005549 | Bacteria | 2274 |
| 96 | Ga0068855_100062969 | 3300005563 | Bacteria | 4329 |
| 97 | Ga0070664_100184586 | 3300005564 | Bacteria | 1855 |
| 98 | Ga0070664_100465596 | 3300005564 | Bacteria | 1162 |
| 99 | Ga0070664_100633340 | 3300005564 | Bacteria | 993 |
| 100 | Ga0070664_101646996 | 3300005564 | Bacteria | 608 |
| 101 | Ga0070664_101923217 | 3300005564 | Bacteria | 561 |
| 102 | Ga0068857_100002126 | 3300005577 | Bacteria | 16101 |
| 103 | Ga0068857_100048017 | 3300005577 | Bacteria | 3790 |
| 104 | Ga0068857_100520689 | 3300005577 | Unclassified | 1118 |
| 105 | Ga0068854_101827724 | 3300005578 | Unclassified | 557 |
| 106 | Ga0068856_100005240 | 3300005614 | Bacteria | 12794 |
| 107 | Ga0068856_100049542 | 3300005614 | Bacteria | 4140 |
| 108 | Ga0068856_100075252 | 3300005614 | Bacteria | 3344 |
| 109 | Ga0068856_100211992 | 3300005614 | Unclassified | 1952 |
| 110 | Ga0068852_100151209 | 3300005616 | Bacteria | 2159 |
| 111 | Ga0068859_100302931 | 3300005617 | Bacteria | 1692 |
| 112 | Ga0068859_101870311 | 3300005617 | Bacteria | 663 |
| 113 | Ga0068859_102034610 | 3300005617 | Bacteria | 634 |
| 114 | Ga0068864_100146009 | 3300005618 | Bacteria | 2138 |
| 115 | Ga0068866_10430482 | 3300005718 | Bacteria | 858 |
| 116 | Ga0068861_100169638 | 3300005719 | Bacteria | 1807 |
| 117 | Ga0068861_101208828 | 3300005719 | Unclassified | 731 |
| 118 | Ga0068870_10023318 | 3300005840 | Bacteria | 3051 |
| 119 | Ga0068870_10316232 | 3300005840 | Bacteria | 990 |
| 120 | Ga0068870_11449798 | 3300005840 | Unclassified | 504 |
| 121 | Ga0068860_100155501 | 3300005843 | Bacteria | 2203 |
| 122 | Ga0081540_1000171 | 3300005983 | Bacteria | 67920 |
| 123 | Ga0070717_10152497 | 3300006028 | Bacteria | 2000 |
| 124 | Ga0070717_10168312 | 3300006028 | Bacteria | 1905 |
| 125 | Ga0070717_10381085 | 3300006028 | Bacteria | 1265 |
| 126 | Ga0070717_11041001 | 3300006028 | Bacteria | 745 |
| 127 | Ga0075365_10109792 | 3300006038 | Unclassified | 1895 |
| 128 | Ga0070715_10422775 | 3300006163 | Unclassified | 746 |
| 129 | Ga0070716_100037924 | 3300006173 | Bacteria | 2665 |
| 130 | Ga0070716_100039016 | 3300006173 | Unclassified | 2633 |
| 131 | Ga0070716_100044765 | 3300006173 | Bacteria | 2480 |
| 132 | Ga0070716_100441106 | 3300006173 | Bacteria | 947 |
| 133 | Ga0070716_101116414 | 3300006173 | Unclassified | 629 |
| 134 | Ga0070712_100011245 | 3300006175 | Bacteria | 5668 |
| 135 | Ga0070712_100093408 | 3300006175 | Bacteria | 2208 |
| 136 | Ga0070712_100101296 | 3300006175 | Bacteria | 2130 |
| 137 | Ga0070712_100348445 | 3300006175 | Bacteria | 1211 |
| 138 | Ga0070712_101047872 | 3300006175 | Bacteria | 707 |
| 139 | Ga0070712_101154473 | 3300006175 | Bacteria | 673 |
| 140 | Ga0070712_101241736 | 3300006175 | Bacteria | 649 |
| 141 | Ga0097621_100195076 | 3300006237 | Bacteria | 1755 |
| 142 | Ga0097621_102040862 | 3300006237 | Bacteria | 548 |
| 143 | Ga0068871_100297651 | 3300006358 | Bacteria | 1415 |
| 144 | Ga0075434_101061722 | 3300006871 | Unclassified | 823 |
| 145 | Ga0097620_100302939 | 3300006931 | Bacteria | 1692 |
| 146 | Ga0097620_101869990 | 3300006931 | Bacteria | 663 |
| 147 | Ga0097620_102034896 | 3300006931 | Bacteria | 634 |
| 148 | Ga0075435_100228888 | 3300007076 | Bacteria | 1579 |
| 149 | Ga0099795_10042712 | 3300007788 | Bacteria | 1619 |
| 150 | Ga0105245_10385211 | 3300009098 | Bacteria | 1397 |
| 151 | Ga0105245_10474687 | 3300009098 | Bacteria | 1263 |
| 152 | Ga0105245_10951224 | 3300009098 | Bacteria | 902 |
| 153 | Ga0105245_11576469 | 3300009098 | Bacteria | 708 |
| 154 | Ga0105247_10659598 | 3300009101 | Bacteria | 783 |
| 155 | Ga0105247_11692135 | 3300009101 | Unclassified | 523 |
| 156 | Ga0114129_12328438 | 3300009147 | Unclassified | 642 |
| 157 | Ga0114129_12690765 | 3300009147 | Bacteria | 593 |
| 158 | Ga0105241_10206022 | 3300009174 | Bacteria | 1646 |
| 159 | Ga0105242_10189015 | 3300009176 | Bacteria | 1822 |
| 160 | Ga0105242_12193553 | 3300009176 | Bacteria | 597 |
| 161 | Ga0105237_11554262 | 3300009545 | Bacteria | 668 |
| 162 | Ga0105238_12313288 | 3300009551 | Unclassified | 573 |
| 163 | Ga0105249_10195848 | 3300009553 | Bacteria | 1975 |
| 164 | Ga0105239_10524623 | 3300010375 | Unclassified | 1348 |
| 165 | Ga0105246_10719669 | 3300011119 | Unclassified | 877 |
| 166 | Ga0157370_10019427 | 3300013104 | Bacteria | 6815 |
| 167 | Ga0157369_10006208 | 3300013105 | Bacteria | 13865 |
| 168 | Ga0157369_10574716 | 3300013105 | Unclassified | 1164 |
| 169 | Ga0163162_13066598 | 3300013306 | Bacteria | 537 |
| 170 | Ga0157372_10095283 | 3300013307 | Bacteria | 3391 |
| 171 | Ga0157372_10649356 | 3300013307 | Bacteria | 1229 |
| 172 | Ga0157375_11846201 | 3300013308 | Unclassified | 717 |
| 173 | Ga0157375_12072156 | 3300013308 | Bacteria | 677 |
| 174 | Ga0182008_10169650 | 3300014497 | Bacteria | 1101 |
| 175 | Ga0157377_11444885 | 3300014745 | Bacteria | 544 |
| 176 | Ga0157377_11746775 | 3300014745 | Unclassified | 503 |
| 177 | Ga0157376_10300424 | 3300014969 | Bacteria | 1519 |
| 178 | Ga0157376_11360474 | 3300014969 | Bacteria | 741 |
| 179 | Ga0157376_11625027 | 3300014969 | Bacteria | 681 |
| 180 | Ga0182006_1214162 | 3300015261 | Unclassified | 636 |
| 181 | Ga0206356_10439586 | 3300020070 | Unclassified | 1973 |
| 182 | Ga0206354_10671847 | 3300020081 | Unclassified | 984 |
| 183 | Ga0206353_11740502 | 3300020082 | Unclassified | 1129 |
| 184 | Ga0207653_10016844 | 3300025885 | Bacteria | 2298 |
| 185 | Ga0207653_10140614 | 3300025885 | Bacteria | 882 |
| 186 | Ga0207692_10033668 | 3300025898 | Bacteria | 2474 |
| 187 | Ga0207692_10074920 | 3300025898 | Bacteria | 1794 |
| 188 | Ga0207688_10029581 | 3300025901 | Bacteria | 3016 |
| 189 | Ga0207688_10249864 | 3300025901 | Bacteria | 1074 |
| 190 | Ga0207680_10185821 | 3300025903 | Bacteria | 1408 |
| 191 | Ga0207685_10008037 | 3300025905 | Bacteria | 2980 |
| 192 | Ga0207699_10006744 | 3300025906 | Bacteria | 5576 |
| 193 | Ga0207699_10027013 | 3300025906 | Bacteria | 3172 |
| 194 | Ga0207699_10168367 | 3300025906 | Bacteria | 1464 |
| 195 | Ga0207699_10359462 | 3300025906 | Unclassified | 1029 |
| 196 | Ga0207643_10089068 | 3300025908 | Bacteria | 1797 |
| 197 | Ga0207643_10715827 | 3300025908 | Unclassified | 647 |
| 198 | Ga0207705_10052590 | 3300025909 | Bacteria | 2933 |
| 199 | Ga0207705_10150303 | 3300025909 | Bacteria | 1745 |
| 200 | Ga0207705_10369260 | 3300025909 | Unclassified | 1107 |
| 201 | Ga0207684_10004102 | 3300025910 | Bacteria | 13866 |
| 202 | Ga0207684_10005909 | 3300025910 | Bacteria | 11207 |
| 203 | Ga0207684_10189048 | 3300025910 | Bacteria | 1776 |
| 204 | Ga0207684_10368208 | 3300025910 | Bacteria | 1236 |
| 205 | Ga0207684_10686815 | 3300025910 | Bacteria | 871 |
| 206 | Ga0207707_10061387 | 3300025912 | Bacteria | 3270 |
| 207 | Ga0207671_11030759 | 3300025914 | Bacteria | 648 |
| 208 | Ga0207693_10009068 | 3300025915 | Bacteria | 8119 |
| 209 | Ga0207693_10160748 | 3300025915 | Bacteria | 1767 |
| 210 | Ga0207693_10177530 | 3300025915 | Bacteria | 1676 |
| 211 | Ga0207663_10017987 | 3300025916 | Bacteria | 3948 |
| 212 | Ga0207663_10273339 | 3300025916 | Unclassified | 1252 |
| 213 | Ga0207660_10098263 | 3300025917 | Unclassified | 2183 |
| 214 | Ga0207662_10156940 | 3300025918 | Bacteria | 1451 |
| 215 | Ga0207657_10001447 | 3300025919 | Bacteria | 25415 |
| 216 | Ga0207657_10324153 | 3300025919 | Bacteria | 1217 |
| 217 | Ga0207649_10252773 | 3300025920 | Unclassified | 1270 |
| 218 | Ga0207649_10733770 | 3300025920 | Bacteria | 768 |
| 219 | Ga0207652_10138134 | 3300025921 | Bacteria | 2177 |
| 220 | Ga0207652_10138426 | 3300025921 | Bacteria | 2175 |
| 221 | Ga0207652_10201979 | 3300025921 | Bacteria | 1789 |
| 222 | Ga0207646_10022896 | 3300025922 | Bacteria | 5744 |
| 223 | Ga0207646_10024338 | 3300025922 | Bacteria | 5546 |
| 224 | Ga0207646_10213065 | 3300025922 | Bacteria | 1745 |
| 225 | Ga0207646_10303679 | 3300025922 | Bacteria | 1442 |
| 226 | Ga0207646_10471437 | 3300025922 | Bacteria | 1132 |
| 227 | Ga0207646_10755244 | 3300025922 | Bacteria | 868 |
| 228 | Ga0207694_10297121 | 3300025924 | Bacteria | 1329 |
| 229 | Ga0207694_11325926 | 3300025924 | Bacteria | 609 |
| 230 | Ga0207659_10443682 | 3300025926 | Bacteria | 1092 |
| 231 | Ga0207687_10330460 | 3300025927 | Bacteria | 1236 |
| 232 | Ga0207687_11015725 | 3300025927 | Bacteria | 711 |
| 233 | Ga0207700_10003119 | 3300025928 | Bacteria | 9571 |
| 234 | Ga0207700_10020216 | 3300025928 | Bacteria | 4516 |
| 235 | Ga0207700_10153502 | 3300025928 | Bacteria | 1905 |
| 236 | Ga0207700_10281731 | 3300025928 | Bacteria | 1430 |
| 237 | Ga0207700_10316660 | 3300025928 | Bacteria | 1351 |
| 238 | Ga0207700_10557800 | 3300025928 | Bacteria | 1017 |
| 239 | Ga0207700_11091979 | 3300025928 | Bacteria | 713 |
| 240 | Ga0207664_10000986 | 3300025929 | Bacteria | 19093 |
| 241 | Ga0207664_10004184 | 3300025929 | Bacteria | 9750 |
| 242 | Ga0207664_10017423 | 3300025929 | Bacteria | 5265 |
| 243 | Ga0207664_10025336 | 3300025929 | Bacteria | 4467 |
| 244 | Ga0207664_10026847 | 3300025929 | Bacteria | 4357 |
| 245 | Ga0207664_10052261 | 3300025929 | Bacteria | 3231 |
| 246 | Ga0207664_10296481 | 3300025929 | Bacteria | 1422 |
| 247 | Ga0207664_10301296 | 3300025929 | Bacteria | 1410 |
| 248 | Ga0207664_10911977 | 3300025929 | Unclassified | 789 |
| 249 | Ga0207644_10353487 | 3300025931 | Bacteria | 1194 |
| 250 | Ga0207690_10163739 | 3300025932 | Bacteria | 1660 |
| 251 | Ga0207690_10404811 | 3300025932 | Bacteria | 1089 |
| 252 | Ga0207686_11452800 | 3300025934 | Unclassified | 565 |
| 253 | Ga0207670_10322567 | 3300025936 | Bacteria | 1216 |
| 254 | Ga0207704_10514800 | 3300025938 | Bacteria | 967 |
| 255 | Ga0207665_10058311 | 3300025939 | Bacteria | 2610 |
| 256 | Ga0207665_10086156 | 3300025939 | Bacteria | 2169 |
| 257 | Ga0207665_10133191 | 3300025939 | Bacteria | 1766 |
| 258 | Ga0207661_10000793 | 3300025944 | Bacteria | 20636 |
| 259 | Ga0207661_10026245 | 3300025944 | Bacteria | 4436 |
| 260 | Ga0207661_10182192 | 3300025944 | Bacteria | 1836 |
| 261 | Ga0207661_10381091 | 3300025944 | Unclassified | 1276 |
| 262 | Ga0207661_11215973 | 3300025944 | Bacteria | 693 |
| 263 | Ga0207661_11378841 | 3300025944 | Bacteria | 647 |
| 264 | Ga0207679_10105376 | 3300025945 | Bacteria | 2214 |
| 265 | Ga0207679_10287121 | 3300025945 | Bacteria | 1413 |
| 266 | Ga0207679_10454692 | 3300025945 | Bacteria | 1136 |
| 267 | Ga0207667_10077606 | 3300025949 | Bacteria | 3444 |
| 268 | Ga0207667_10109180 | 3300025949 | Bacteria | 2853 |
| 269 | Ga0207651_10744132 | 3300025960 | Bacteria | 866 |
| 270 | Ga0207712_10292050 | 3300025961 | Bacteria | 1334 |
| 271 | Ga0207668_10352083 | 3300025972 | Bacteria | 1232 |
| 272 | Ga0207668_10804932 | 3300025972 | Unclassified | 832 |
| 273 | Ga0207640_11778802 | 3300025981 | Unclassified | 557 |
| 274 | Ga0207658_11135342 | 3300025986 | Unclassified | 714 |
| 275 | Ga0207639_10233301 | 3300026041 | Unclassified | 1596 |
| 276 | Ga0207639_11097737 | 3300026041 | Unclassified | 746 |
| 277 | Ga0207678_10011014 | 3300026067 | Bacteria | 7942 |
| 278 | Ga0207702_10006333 | 3300026078 | Bacteria | 10222 |
| 279 | Ga0207702_10125739 | 3300026078 | Bacteria | 2301 |
| 280 | Ga0207702_10133944 | 3300026078 | Unclassified | 2233 |
| 281 | Ga0207702_10192316 | 3300026078 | Bacteria | 1886 |
| 282 | Ga0207702_10671742 | 3300026078 | Bacteria | 1020 |
| 283 | Ga0207702_10735197 | 3300026078 | Bacteria | 974 |
| 284 | Ga0207641_10104440 | 3300026088 | Bacteria | 2501 |
| 285 | Ga0207648_11026449 | 3300026089 | Bacteria | 773 |
| 286 | Ga0207676_10707987 | 3300026095 | Bacteria | 976 |
| 287 | Ga0207674_10003127 | 3300026116 | Bacteria | 20420 |
| 288 | Ga0207674_10006750 | 3300026116 | Bacteria | 13474 |
| 289 | Ga0207683_11479697 | 3300026121 | Bacteria | 627 |
| 290 | Ga0207698_10826607 | 3300026142 | Bacteria | 930 |
| 291 | Ga0207428_10279271 | 3300027907 | Bacteria | 1240 |
| 292 | Ga0268266_11983386 | 3300028379 | Bacteria | 556 |
| 293 | Ga0268265_10925861 | 3300028380 | Bacteria | 857 |
| 294 | Ga0307513_10558210 | 3300031456 | Unclassified | 857 |
| 295 | Ga0307410_10088753 | 3300031852 | Bacteria | 2190 |
| 296 | Ga0307409_100042694 | 3300031995 | Bacteria | 3398 |
| 297 | Ga0307416_100707390 | 3300032002 | Bacteria | 1097 |
| 298 | Ga0307414_11447615 | 3300032004 | Bacteria | 639 |
| 299 | Ga0307411_10637262 | 3300032005 | Bacteria | 921 |
| 300 | Ga0373930_0016066 | 3300034816 | Bacteria | 1412 |
| 301 | Ga0373948_0007419 | 3300034817 | Bacteria | 1844 |
| 302 | Ga0373959_0016278 | 3300034820 | Bacteria | 1376 |
| 303 | Ga0373926_0058659 | 3300035083 | Bacteria | 1400 |
| 304 | Ga0373926_0186848 | 3300035083 | Bacteria | 795 |
| 305 | Ga0373928_0232114 | 3300035084 | Bacteria | 543 |
| 306 | Ga0373929_0067888 | 3300035085 | Bacteria | 847 |
| 307 | Ga0373934_0000021 | 3300035086 | Bacteria | 53680 |
| 308 | Ga0373934_0006828 | 3300035086 | Bacteria | 4238 |
| 309 | Ga0373940_0070094 | 3300035088 | Bacteria | 1019 |
| 310 | Ga0373949_0024138 | 3300035090 | Bacteria | 1412 |
| 311 | Ga0373952_0170649 | 3300035092 | Bacteria | 622 |
| 312 | Ga0373923_0016071 | 3300035111 | Bacteria | 2836 |
| 313 | Ga0373923_0034245 | 3300035111 | Bacteria | 2060 |
| 314 | Ga0373923_0539027 | 3300035111 | Bacteria | 571 |
| 315 | Ga0373932_0252755 | 3300035112 | Bacteria | 644 |
| 316 | Ga0373932_0423375 | 3300035112 | Bacteria | 519 |
| 317 | Ga0373939_0019357 | 3300035114 | Bacteria | 1835 |
| 318 | Ga0373945_0062214 | 3300035116 | Bacteria | 1395 |
| 319 | Ga0373953_0001230 | 3300035117 | Bacteria | 7304 |
| 320 | Ga0373953_0049891 | 3300035117 | Bacteria | 1689 |
| 321 | Ga0373953_0112494 | 3300035117 | Bacteria | 1152 |
| 322 | Ga0373954_0002755 | 3300035118 | Bacteria | 7399 |
| 323 | Ga0373954_0173025 | 3300035118 | Bacteria | 1058 |
| 324 | Ga0373954_0219299 | 3300035118 | Bacteria | 935 |
| 325 | Ga0373956_0000073 | 3300035119 | Bacteria | 32947 |
| 326 | Ga0373956_0014378 | 3300035119 | Bacteria | 3306 |
| 327 | Ga0373956_0177128 | 3300035119 | Bacteria | 1007 |
| 328 | Ga0373957_0000110 | 3300035120 | Bacteria | 19703 |
| 329 | Ga0373957_0024169 | 3300035120 | Bacteria | 2180 |
| 330 | Ga0373943_0041453 | 3300035170 | Bacteria | 2226 |
| 331 | Ga0373946_0216949 | 3300035171 | Bacteria | 922 |
| 332 | Ga0373955_0000125 | 3300035172 | Bacteria | 30520 |
| 333 | Ga0373955_0001874 | 3300035172 | Bacteria | 9061 |
| 334 | Ga0373942_0016843 | 3300035207 | Bacteria | 1797 |
| 335 | Ga0373962_0055967 | 3300035242 | Bacteria | 1147 |
| 336 | Ga0373924_0060042 | 3300035410 | Bacteria | 1589 |
| 337 | Ga0373931_0202489 | 3300035691 | Bacteria | 1186 |
| 338 | Ga0373935_0017286 | 3300035692 | Bacteria | 4374 |
| 339 | Ga0373935_0495400 | 3300035692 | Bacteria | 887 |
| 340 | Ga0373927_0152684 | 3300035695 | Bacteria | 1512 |
| 341 | Ga0373933_0000366 | 3300035724 | Bacteria | 28850 |
| 342 | Ga0373933_0023485 | 3300035724 | Bacteria | 3523 |
| 343 | Ga0373933_0078263 | 3300035724 | Bacteria | 2023 |
| 344 | Ga0373933_0277177 | 3300035724 | Bacteria | 1083 |
| 345 | Ga0373933_0549577 | 3300035724 | Bacteria | 758 |
| 346 | Ga0373947_0577817 | 3300035725 | Bacteria | 765 |
| 347 | Ga0373937_0000169 | 3300036401 | Bacteria | 63595 |
| 348 | Ga0373937_0029491 | 3300036401 | Bacteria | 4968 |
| 349 | Ga0373937_0212526 | 3300036401 | Bacteria | 1820 |
| 350 | Ga0373937_0250037 | 3300036401 | Bacteria | 1671 |
| 351 | Ga0373925_0037556 | 3300037068 | Bacteria | 3576 |
| 352 | Ga0395899_0688112 | 3300037312 | Bacteria | 642 |
| 353 | Ga0395900_0197472 | 3300037418 | Bacteria | 2037 |
| 354 | Ga0395898_0203310 | 3300037466 | Bacteria | 1890 |
| 355 | Ga0395898_0281811 | 3300037466 | Bacteria | 1585 |
| 356 | Ga0395905_0158448 | 3300037471 | Bacteria | 2128 |
| 357 | Ga0395905_0832995 | 3300037471 | Bacteria | 825 |
| 358 | Ga0395901_0025177 | 3300038443 | Bacteria | 6109 |
| 359 | Ga0395901_0081949 | 3300038443 | Bacteria | 3370 |
| 360 | Ga0395901_0249073 | 3300038443 | Bacteria | 1851 |
| 361 | Ga0395901_0489977 | 3300038443 | Bacteria | 1253 |
| 362 | Ga0242420_006955 | 3300038996 | Bacteria | 1804 |
| 363 | Ga0451793_0340383 | 3300041452 | Unclassified | 631 |
| 364 | Ga0451793_1106976 | 3300041452 | Bacteria | 563 |
| 365 | Ga0451795_0318555 | 3300041456 | Bacteria | 666 |
| 366 | Ga0451802_0748016 | 3300041460 | Bacteria | 779 |
| 367 | Ga0451802_1480458 | 3300041460 | Unclassified | 918 |
| 368 | Ga0451804_0154004 | 3300041463 | Bacteria | 530 |
| 369 | Ga0451807_0809441 | 3300041486 | Bacteria | 503 |
| 370 | Ga0451807_1225447 | 3300041486 | Bacteria | 533 |
| 371 | Ga0451853_1935145 | 3300041512 | Bacteria | 1953 |
| 372 | Ga0466966_0010653 | 3300044684 | Bacteria | 6112 |
| 373 | Ga0466966_0405085 | 3300044684 | Bacteria | 820 |
| 374 | Ga0466961_0425249 | 3300044693 | Bacteria | 805 |
| 375 | Ga0466963_0026387 | 3300044694 | Bacteria | 3715 |
| 376 | Ga0466968_0042988 | 3300044735 | Unclassified | 1912 |
| 377 | Ga0466968_0607287 | 3300044735 | Bacteria | 553 |
| 378 | Ga0466957_0263987 | 3300044842 | Bacteria | 1148 |
| 379 | Ga0466960_0013201 | 3300044901 | Bacteria | 3504 |
| 380 | Ga0466959_0343428 | 3300045049 | Bacteria | 1018 |
| 381 | Ga0466958_0595228 | 3300045836 | Bacteria | 719 |
| 382 | Ga0466967_0693276 | 3300045976 | Bacteria | 1008 |
| 383 | Ga0466967_0900261 | 3300045976 | Bacteria | 880 |
| 384 | Ga0466967_1713136 | 3300045976 | Bacteria | 626 |
| 385 | Ga0466967_2439165 | 3300045976 | Bacteria | 518 |
| 386 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 387 | Ga0495592_0003134 | 3300046454 | Bacteria | 11815 |
| 388 | Ga0495592_0014732 | 3300046454 | Bacteria | 5936 |
| 389 | Ga0495592_0234977 | 3300046454 | Bacteria | 1219 |
| 390 | Ga0495603_0067657 | 3300046455 | Bacteria | 2102 |
| 391 | Ga0495603_0499556 | 3300046455 | Bacteria | 697 |
| 392 | Ga0495603_0559309 | 3300046455 | Bacteria | 655 |
| 393 | Ga0495629_0030737 | 3300046459 | Bacteria | 3805 |
| 394 | Ga0495629_0039999 | 3300046459 | Bacteria | 3299 |
| 395 | Ga0495629_0618315 | 3300046459 | Bacteria | 723 |
| 396 | Ga0495641_0020248 | 3300046461 | Bacteria | 3379 |
| 397 | Ga0495641_0313697 | 3300046461 | Bacteria | 707 |
| 398 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 399 | Ga0495651_0003630 | 3300046462 | Bacteria | 11819 |
| 400 | Ga0495651_0012020 | 3300046462 | Bacteria | 6663 |
| 401 | Ga0495651_0049562 | 3300046462 | Bacteria | 3241 |
| 402 | Ga0495651_0190856 | 3300046462 | Bacteria | 1442 |
| 403 | Ga0495651_0730029 | 3300046462 | Bacteria | 615 |
| 404 | Ga0495653_0001451 | 3300046463 | Bacteria | 18502 |
| 405 | Ga0495653_0026604 | 3300046463 | Bacteria | 4636 |
| 406 | Ga0495653_0160683 | 3300046463 | Bacteria | 1560 |
| 407 | Ga0495653_0226547 | 3300046463 | Bacteria | 1253 |
| 408 | Ga0495582_0016987 | 3300046473 | Bacteria | 3984 |
| 409 | Ga0495582_0227140 | 3300046473 | Bacteria | 1069 |
| 410 | Ga0495582_0728326 | 3300046473 | Unclassified | 574 |
| 411 | Ga0495662_0011166 | 3300046476 | Bacteria | 4389 |
| 412 | Ga0495662_0067476 | 3300046476 | Bacteria | 1731 |
| 413 | Ga0495664_0070349 | 3300046477 | Bacteria | 2090 |
| 414 | Ga0495664_0101446 | 3300046477 | Bacteria | 1734 |
| 415 | Ga0495585_0104256 | 3300046492 | Bacteria | 1514 |
| 416 | Ga0495596_0127048 | 3300046500 | Bacteria | 990 |
| 417 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 418 | Ga0495608_0002527 | 3300046511 | Bacteria | 13114 |
| 419 | Ga0495608_0038630 | 3300046511 | Bacteria | 3204 |
| 420 | Ga0495608_0104340 | 3300046511 | Bacteria | 1826 |
| 421 | Ga0495618_0044331 | 3300046514 | Bacteria | 2805 |
| 422 | Ga0495618_0199374 | 3300046514 | Bacteria | 1267 |
| 423 | Ga0495618_0246839 | 3300046514 | Bacteria | 1121 |
| 424 | Ga0495628_0000106 | 3300046516 | Bacteria | 67965 |
| 425 | Ga0495628_0015941 | 3300046516 | Bacteria | 6270 |
| 426 | Ga0495628_0035322 | 3300046516 | Bacteria | 4018 |
| 427 | Ga0495628_0046405 | 3300046516 | Bacteria | 3451 |
| 428 | Ga0495628_0601187 | 3300046516 | Bacteria | 785 |
| 429 | Ga0495630_0022949 | 3300046517 | Bacteria | 4610 |
| 430 | Ga0495630_0090004 | 3300046517 | Bacteria | 2318 |
| 431 | Ga0495630_0494596 | 3300046517 | Bacteria | 938 |
| 432 | Ga0495663_0230143 | 3300046525 | Bacteria | 654 |
| 433 | Ga0495652_0000119 | 3300046529 | Bacteria | 85582 |
| 434 | Ga0495652_0051433 | 3300046529 | Bacteria | 3518 |
| 435 | Ga0495652_0054950 | 3300046529 | Bacteria | 3388 |
| 436 | Ga0495652_0268712 | 3300046529 | Bacteria | 1254 |
| 437 | Ga0495652_0312299 | 3300046529 | Bacteria | 1138 |
| 438 | Ga0495652_0329572 | 3300046529 | Bacteria | 1100 |
| 439 | Ga0495652_0810156 | 3300046529 | Bacteria | 623 |
| 440 | Ga0495665_0030193 | 3300046531 | Bacteria | 2901 |
| 441 | Ga0495640_0014429 | 3300046533 | Bacteria | 5979 |
| 442 | Ga0495640_0132962 | 3300046533 | Bacteria | 1609 |
| 443 | Ga0495640_0175834 | 3300046533 | Bacteria | 1366 |
| 444 | Ga0495587_0000374 | 3300046536 | Bacteria | 31849 |
| 445 | Ga0495587_0008051 | 3300046536 | Bacteria | 6799 |
| 446 | Ga0495587_0017553 | 3300046536 | Bacteria | 4445 |
| 447 | Ga0495587_0048418 | 3300046536 | Bacteria | 2517 |
| 448 | Ga0495645_0026920 | 3300046543 | Bacteria | 4176 |
| 449 | Ga0495645_0090333 | 3300046543 | Bacteria | 2189 |
| 450 | Ga0495645_0104247 | 3300046543 | Bacteria | 2014 |
| 451 | Ga0495645_0180355 | 3300046543 | Bacteria | 1447 |
| 452 | Ga0495645_0270486 | 3300046543 | Bacteria | 1122 |
| 453 | Ga0495645_0680857 | 3300046543 | Bacteria | 626 |
| 454 | Ga0495667_0000114 | 3300046559 | Bacteria | 58520 |
| 455 | Ga0495667_0008763 | 3300046559 | Bacteria | 6875 |
| 456 | Ga0495667_0046045 | 3300046559 | Bacteria | 2885 |
| 457 | Ga0495667_0095608 | 3300046559 | Bacteria | 1923 |
| 458 | Ga0495634_0011961 | 3300046642 | Bacteria | 6296 |
| 459 | Ga0495634_0014099 | 3300046642 | Bacteria | 5770 |
| 460 | Ga0495634_0214650 | 3300046642 | Bacteria | 1190 |
| 461 | Ga0495625_0159175 | 3300046660 | Bacteria | 1514 |
| 462 | Ga0495635_0018710 | 3300046663 | Bacteria | 4832 |
| 463 | Ga0495635_0060808 | 3300046663 | Bacteria | 2595 |
| 464 | Ga0495588_0041764 | 3300046674 | Bacteria | 2343 |
| 465 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 466 | Ga0495657_0016641 | 3300046675 | Bacteria | 5353 |
| 467 | Ga0495657_0043884 | 3300046675 | Bacteria | 3045 |
| 468 | Ga0495657_0060403 | 3300046675 | Bacteria | 2511 |
| 469 | Ga0495657_0097554 | 3300046675 | Bacteria | 1876 |
| 470 | Ga0495657_0524684 | 3300046675 | Bacteria | 689 |
| 471 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 472 | Ga0495599_0014633 | 3300046678 | Bacteria | 4858 |
| 473 | Ga0495599_0176207 | 3300046678 | Bacteria | 1318 |
| 474 | Ga0495599_0392079 | 3300046678 | Unclassified | 828 |
| 475 | Ga0495623_0000522 | 3300046679 | Bacteria | 25418 |
| 476 | Ga0495623_0027933 | 3300046679 | Bacteria | 3632 |
| 477 | Ga0495623_0236141 | 3300046679 | Bacteria | 1035 |
| 478 | Ga0495646_0015534 | 3300046680 | Bacteria | 4831 |
| 479 | Ga0495646_0016721 | 3300046680 | Bacteria | 4658 |
| 480 | Ga0495658_0103571 | 3300046683 | Bacteria | 1702 |
| 481 | Ga0495658_0479646 | 3300046683 | Bacteria | 795 |
| 482 | Ga0495669_0145372 | 3300046684 | Bacteria | 1121 |
| 483 | Ga0495613_0005882 | 3300046689 | Bacteria | 9181 |
| 484 | Ga0495613_0055982 | 3300046689 | Bacteria | 2896 |
| 485 | Ga0495613_0253111 | 3300046689 | Bacteria | 1229 |
| 486 | Ga0495613_0327794 | 3300046689 | Bacteria | 1056 |
| 487 | Ga0495624_0052665 | 3300046690 | Bacteria | 2571 |
| 488 | Ga0495624_0094122 | 3300046690 | Bacteria | 1847 |
| 489 | Ga0495624_0485526 | 3300046690 | Bacteria | 739 |
| 490 | Ga0495600_0030439 | 3300046809 | Bacteria | 3496 |
| 491 | Ga0495600_0044481 | 3300046809 | Bacteria | 2897 |
| 492 | Ga0495600_0051012 | 3300046809 | Bacteria | 2700 |
| 493 | Ga0495600_0065499 | 3300046809 | Bacteria | 2375 |
| 494 | Ga0495600_0324947 | 3300046809 | Bacteria | 967 |
| 495 | Ga0495600_0724139 | 3300046809 | Bacteria | 597 |
| 496 | Ga0495581_0051991 | 3300047315 | Bacteria | 2366 |
| 497 | Ga0495604_0000121 | 3300047317 | Bacteria | 65991 |
| 498 | Ga0495604_0019477 | 3300047317 | Bacteria | 5431 |
| 499 | Ga0495604_0023212 | 3300047317 | Bacteria | 4950 |
| 500 | Ga0495604_0237587 | 3300047317 | Bacteria | 1247 |
| 501 | Ga0495674_0056198 | 3300047319 | Bacteria | 3448 |
| 502 | Ga0495674_0115068 | 3300047319 | Bacteria | 2277 |
| 503 | Ga0495674_0862777 | 3300047319 | Bacteria | 701 |
| 504 | Ga0495674_0885082 | 3300047319 | Bacteria | 690 |
| 505 | Ga0495672_0394597 | 3300047320 | Bacteria | 634 |
| 506 | Ga0495676_0023733 | 3300047321 | Bacteria | 5318 |
| 507 | Ga0495676_0320891 | 3300047321 | Bacteria | 1041 |
| 508 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 509 | Ga0495680_0008382 | 3300047322 | Bacteria | 9400 |
| 510 | Ga0495680_0041121 | 3300047322 | Bacteria | 3676 |
| 511 | Ga0495680_0093176 | 3300047322 | Bacteria | 2255 |
| 512 | Ga0495680_0450370 | 3300047322 | Bacteria | 881 |
| 513 | Ga0495675_0000346 | 3300047444 | Bacteria | 32587 |
| 514 | Ga0495675_0010975 | 3300047444 | Bacteria | 5678 |
| 515 | Ga0495675_0044283 | 3300047444 | Bacteria | 2835 |
| 516 | Ga0495675_0072674 | 3300047444 | Bacteria | 2170 |
| 517 | Ga0495684_0020047 | 3300047471 | Bacteria | 5151 |
| 518 | Ga0495684_0184075 | 3300047471 | Bacteria | 1547 |
| 519 | Ga0495684_0244152 | 3300047471 | Bacteria | 1309 |
| 520 | Ga0495684_0717379 | 3300047471 | Bacteria | 661 |
| 521 | Ga0495593_0015873 | 3300047673 | Bacteria | 4255 |
| 522 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 523 | Ga0495602_0065498 | 3300048088 | Bacteria | 3136 |
| 524 | Ga0495602_0072856 | 3300048088 | Bacteria | 2926 |
| 525 | Ga0495602_0258709 | 3300048088 | Bacteria | 1292 |
| 526 | Ga0495614_0059791 | 3300048089 | Bacteria | 1637 |
| 527 | Ga0495614_0187102 | 3300048089 | Bacteria | 933 |
| 528 | Ga0496100_0041690 | 3300048903 | Bacteria | 2928 |
| 529 | Ga0496100_0119400 | 3300048903 | Unclassified | 1842 |
| 530 | Ga0496100_0340247 | 3300048903 | Bacteria | 1131 |
| 531 | Ga0496100_0805666 | 3300048903 | Bacteria | 736 |
| 532 | Ga0496101_0028100 | 3300048904 | Bacteria | 3924 |
| 533 | Ga0496101_0379396 | 3300048904 | Bacteria | 1112 |
| 534 | Ga0496101_0557165 | 3300048904 | Bacteria | 906 |
| 535 | Ga0496101_0873774 | 3300048904 | Bacteria | 708 |
| 536 | Ga0496102_0076533 | 3300048905 | Bacteria | 3078 |
| 537 | Ga0496102_0435305 | 3300048905 | Bacteria | 1231 |
| 538 | Ga0496102_0778067 | 3300048905 | Bacteria | 880 |
| 539 | Ga0496102_0812104 | 3300048905 | Bacteria | 857 |
| 540 | Ga0496102_0829667 | 3300048905 | Bacteria | 847 |
| 541 | Ga0496102_1061769 | 3300048905 | Unclassified | 730 |
| 542 | Ga0496103_0606656 | 3300048906 | Bacteria | 697 |
| 543 | Ga0496104_0000804 | 3300048907 | Bacteria | 27002 |
| 544 | Ga0496104_0000853 | 3300048907 | Bacteria | 26359 |
| 545 | Ga0496104_0248266 | 3300048907 | Bacteria | 1692 |
| 546 | Ga0496104_0774636 | 3300048907 | Bacteria | 866 |
| 547 | Ga0496105_0000546 | 3300048908 | Bacteria | 24815 |
| 548 | Ga0496105_0001245 | 3300048908 | Bacteria | 17776 |
| 549 | Ga0496105_0006415 | 3300048908 | Bacteria | 9043 |
| 550 | Ga0496105_0010038 | 3300048908 | Bacteria | 7431 |
| 551 | Ga0496106_1061990 | 3300048909 | Bacteria | 635 |
| 552 | Ga0496107_0041664 | 3300048910 | Bacteria | 3298 |
| 553 | Ga0496108_0005112 | 3300048911 | Bacteria | 10603 |
| 554 | Ga0496108_0067554 | 3300048911 | Bacteria | 3015 |
| 555 | Ga0496108_0081459 | 3300048911 | Bacteria | 2743 |
| 556 | Ga0496108_0081617 | 3300048911 | Bacteria | 2740 |
| 557 | Ga0496108_0565417 | 3300048911 | Bacteria | 992 |
| 558 | Ga0496109_0000564 | 3300048912 | Bacteria | 30941 |
| 559 | Ga0496109_0147849 | 3300048912 | Bacteria | 2199 |
| 560 | Ga0496109_0177386 | 3300048912 | Bacteria | 2000 |
| 561 | Ga0496109_0216968 | 3300048912 | Bacteria | 1799 |
| 562 | Ga0496109_0290834 | 3300048912 | Bacteria | 1540 |
| 563 | Ga0496109_0331666 | 3300048912 | Bacteria | 1436 |
| 564 | Ga0496109_0346822 | 3300048912 | Bacteria | 1402 |
| 565 | Ga0496109_0842354 | 3300048912 | Bacteria | 855 |
| 566 | Ga0496109_1397139 | 3300048912 | Bacteria | 635 |
| 567 | Ga0496110_0123530 | 3300048913 | Bacteria | 2334 |
| 568 | Ga0496110_0124762 | 3300048913 | Unclassified | 2322 |
| 569 | Ga0496110_0140349 | 3300048913 | Bacteria | 2185 |
| 570 | Ga0496110_0175133 | 3300048913 | Bacteria | 1947 |
| 571 | Ga0496110_0175376 | 3300048913 | Bacteria | 1946 |
| 572 | Ga0496110_1073376 | 3300048913 | Bacteria | 713 |
| 573 | Ga0496110_1618654 | 3300048913 | Bacteria | 558 |
| 574 | Ga0496111_0000683 | 3300048914 | Bacteria | 17861 |
| 575 | Ga0496112_0000898 | 3300048915 | Bacteria | 21435 |
| 576 | Ga0496112_0113522 | 3300048915 | Bacteria | 2680 |
| 577 | Ga0496112_0144405 | 3300048915 | Bacteria | 2348 |
| 578 | Ga0496112_0253177 | 3300048915 | Bacteria | 1712 |
| 579 | Ga0496112_0975386 | 3300048915 | Unclassified | 768 |
| 580 | Ga0496113_0063551 | 3300048916 | Bacteria | 2790 |
| 581 | Ga0496113_0148076 | 3300048916 | Bacteria | 1851 |
| 582 | Ga0496113_0238131 | 3300048916 | Bacteria | 1452 |
| 583 | Ga0496113_1038435 | 3300048916 | Bacteria | 644 |
| 584 | Ga0496114_0000763 | 3300048917 | Bacteria | 24039 |
| 585 | Ga0496114_0159321 | 3300048917 | Bacteria | 1961 |
| 586 | Ga0496114_0182689 | 3300048917 | Bacteria | 1832 |
| 587 | Ga0496114_0233123 | 3300048917 | Unclassified | 1618 |
| 588 | Ga0496114_0255951 | 3300048917 | Bacteria | 1541 |
| 589 | Ga0496114_0290206 | 3300048917 | Unclassified | 1443 |
| 590 | Ga0496114_0466051 | 3300048917 | Bacteria | 1118 |
| 591 | Ga0496114_0903567 | 3300048917 | Bacteria | 764 |
| 592 | Ga0496114_1018496 | 3300048917 | Bacteria | 712 |
| 593 | Ga0496115_0045687 | 3300048918 | Bacteria | 3497 |
| 594 | Ga0496115_0099025 | 3300048918 | Bacteria | 2388 |
| 595 | Ga0496118_0461186 | 3300048921 | Unclassified | 642 |
| 596 | Ga0496120_0014507 | 3300048923 | Bacteria | 5249 |
| 597 | Ga0501031_0000818 | 3300049568 | Bacteria | 18716 |
| 598 | Ga0501031_0011134 | 3300049568 | Bacteria | 5861 |
| 599 | Ga0501031_1021216 | 3300049568 | Bacteria | 528 |
| 600 | Ga0501032_0000978 | 3300049569 | Bacteria | 23112 |
| 601 | Ga0501032_0012449 | 3300049569 | Bacteria | 6078 |
| 602 | Ga0501032_0168353 | 3300049569 | Bacteria | 1437 |
| 603 | Ga0501032_0473636 | 3300049569 | Bacteria | 801 |
| 604 | Ga0501033_0001418 | 3300049570 | Bacteria | 21283 |
| 605 | Ga0501033_0011843 | 3300049570 | Bacteria | 6667 |
| 606 | Ga0501034_0003564 | 3300049571 | Bacteria | 17672 |
| 607 | Ga0501034_0017200 | 3300049571 | Bacteria | 7417 |
| 608 | Ga0501034_1527960 | 3300049571 | Bacteria | 541 |
| 609 | Ga0501036_0010755 | 3300049572 | Bacteria | 7565 |
| 610 | Ga0501036_0039610 | 3300049572 | Bacteria | 3987 |
| 611 | Ga0501036_0676956 | 3300049572 | Bacteria | 853 |
| 612 | Ga0501037_0002882 | 3300049573 | Bacteria | 12471 |
| 613 | Ga0501037_0008604 | 3300049573 | Bacteria | 7485 |
| 614 | Ga0501037_0032786 | 3300049573 | Bacteria | 3837 |
| 615 | Ga0501037_0089054 | 3300049573 | Bacteria | 2234 |
| 616 | Ga0501038_0000501 | 3300049574 | Bacteria | 34383 |
| 617 | Ga0501038_0013575 | 3300049574 | Bacteria | 7422 |
| 618 | Ga0501038_0113494 | 3300049574 | Bacteria | 2242 |
| 619 | Ga0501039_0004987 | 3300049575 | Bacteria | 10073 |
| 620 | Ga0501039_0005351 | 3300049575 | Bacteria | 9709 |
| 621 | Ga0501039_0394154 | 3300049575 | Bacteria | 1087 |
| 622 | Ga0501042_0052390 | 3300049578 | Bacteria | 2911 |
| 623 | Ga0501043_0001130 | 3300049579 | Bacteria | 23419 |
| 624 | Ga0501043_0031070 | 3300049579 | Bacteria | 4200 |
| 625 | Ga0501043_0215715 | 3300049579 | Bacteria | 1486 |
| 626 | Ga0501046_0002038 | 3300049580 | Bacteria | 19203 |
| 627 | Ga0501046_0004866 | 3300049580 | Bacteria | 12100 |
| 628 | Ga0501046_0028839 | 3300049580 | Bacteria | 4516 |
| 629 | Ga0501047_0006489 | 3300049581 | Bacteria | 11008 |
| 630 | Ga0501047_0023766 | 3300049581 | Bacteria | 5884 |
| 631 | Ga0501047_1201407 | 3300049581 | Bacteria | 572 |
| 632 | Ga0501048_0000474 | 3300049582 | Bacteria | 28128 |
| 633 | Ga0501048_0007929 | 3300049582 | Bacteria | 8044 |
| 634 | Ga0501067_0029067 | 3300049583 | Bacteria | 3064 |
| 635 | Ga0501067_0166411 | 3300049583 | Bacteria | 1228 |
| 636 | Ga0501068_0070837 | 3300049584 | Bacteria | 2127 |
| 637 | Ga0501068_0201700 | 3300049584 | Bacteria | 1261 |
| 638 | Ga0501069_0014299 | 3300049585 | Bacteria | 4241 |
| 639 | Ga0501070_0001907 | 3300049586 | Bacteria | 18439 |
| 640 | Ga0501070_0011322 | 3300049586 | Bacteria | 7537 |
| 641 | Ga0501070_0225520 | 3300049586 | Bacteria | 1536 |
| 642 | Ga0501070_1354410 | 3300049586 | Bacteria | 542 |
| 643 | Ga0501072_0854295 | 3300049588 | Bacteria | 712 |
| 644 | Ga0501073_0007439 | 3300049589 | Bacteria | 8140 |
| 645 | Ga0501074_0014483 | 3300049590 | Bacteria | 5738 |
| 646 | Ga0501074_0082553 | 3300049590 | Bacteria | 2304 |
| 647 | Ga0501080_0002944 | 3300049742 | Bacteria | 14965 |
| 648 | Ga0501083_0001473 | 3300049744 | Bacteria | 16087 |
| 649 | Ga0501035_0002308 | 3300049822 | Bacteria | 18823 |
| 650 | Ga0501035_0004669 | 3300049822 | Bacteria | 13005 |
| 651 | Ga0501044_0016708 | 3300049823 | Bacteria | 7878 |
| 652 | Ga0501044_0045026 | 3300049823 | Bacteria | 4575 |
| 653 | Ga0501044_0356011 | 3300049823 | Bacteria | 1382 |
| 654 | Ga0501045_0023437 | 3300049824 | Bacteria | 4425 |
| 655 | Ga0501045_0386204 | 3300049824 | Bacteria | 1042 |
| 656 | nmdc:mga0rr50_23983_c1 | 3300050513 | Bacteria | 4219 |
| 657 | Ga0495601_0009537 | 3300053077 | Bacteria | 5747 |
| 658 | Ga0495601_0036879 | 3300053077 | Bacteria | 3055 |
| 659 | Ga0495601_0091862 | 3300053077 | Bacteria | 1954 |
| 660 | Ga0495601_0516622 | 3300053077 | Bacteria | 770 |
| 661 | Ga0495601_0588530 | 3300053077 | Bacteria | 714 |
| 662 | Ga0495612_0036041 | 3300053078 | Bacteria | 2007 |
| 663 | Ga0495612_0064129 | 3300053078 | Bacteria | 1524 |
| 664 | Ga0495595_0025398 | 3300053084 | Bacteria | 2625 |
| 665 | Ga0495595_0028131 | 3300053084 | Bacteria | 2509 |
| 666 | Ga0495595_0040959 | 3300053084 | Bacteria | 2118 |
| 667 | Ga0495619_0108773 | 3300053085 | Bacteria | 1892 |
| 668 | Ga0495619_0160348 | 3300053085 | Bacteria | 1553 |
| 669 | Ga0495619_0209639 | 3300053085 | Bacteria | 1349 |
| 670 | Ga0500556_0000204 | 3300053104 | Bacteria | 48558 |
| 671 | Ga0500593_001484 | 3300053117 | Bacteria | 8442 |
| 672 | Ga0500616_0000081 | 3300053153 | Bacteria | 199653 |
| 673 | Ga0501084_0032552 | 3300054114 | Bacteria | 4361 |
| 674 | Ga0587073_0041641 | 3300059492 | Bacteria | 1004 |
| 675 | Ga0530510_1513615 | 3300061734 | Bacteria | 515 |
| 676 | 2676477495 | 2675903058 | Bacteria | 6822861 |
| 677 | 2819426916 | 2818991318 | Bacteria | 5266538 |
| 678 | 2827634752 | 2827628540 | Bacteria | 6858585 |
| 679 | 2858854772 | 2858848962 | Bacteria | 6963058 |
| 680 | 2858893017 | 2858888857 | Bacteria | 7060307 |
| 681 | 2880496921 | 2880495981 | Bacteria | 7340502 |
| 682 | 2946033574 | 2946033335 | Bacteria | 3835514 |
| 683 | 8054734501 | 8054727385 | Bacteria | 7558670 |
| 684 | Ga0495628_0771279 | |||
| 685 | JGI25404J52841_10003782 | |||
| 686 | Ga0070683_100005393 | |||
| 687 | Ga0070683_100021347 | |||
| 688 | Ga0070683_100055211 | |||
| 689 | Ga0070683_100580946 | |||
| 690 | Ga0070680_100069290 | |||
| 691 | Ga0070682_100180085 | |||
| 692 | Ga0070660_100120063 | |||
| 693 | Ga0070691_10006793 | |||
| 694 | Ga0070661_100036685 | |||
| 695 | Ga0070661_100048252 | |||
| 696 | Ga0070668_100875321 | |||
| 697 | Ga0070669_101431795 | |||
| 698 | Ga0070675_100785942 | |||
| 699 | Ga0070674_100239388 | |||
| 700 | Ga0070688_100364174 | |||
| 701 | Ga0070659_100366584 | |||
| 702 | Ga0070659_101624777 | |||
| 703 | Ga0070709_10080940 | |||
| 704 | Ga0070709_10096958 | |||
| 705 | Ga0070714_100001437 | |||
| 706 | Ga0070714_100033972 | |||
| 707 | Ga0070714_100073913 | |||
| 708 | Ga0070714_100139755 | |||
| 709 | Ga0070714_100286558 | |||
| 710 | Ga0070714_100352097 | |||
| 711 | Ga0070714_100878953 | |||
| 712 | Ga0070713_100000286 | |||
| 713 | Ga0070713_100058288 | |||
| 714 | Ga0070713_100071625 | |||
| 715 | Ga0070713_100115163 | |||
| 716 | Ga0070713_100116418 | |||
| 717 | Ga0070713_100594447 | |||
| 718 | Ga0070713_100888683 | |||
| 719 | Ga0070713_102158319 | |||
| 720 | Ga0070710_10029543 | |||
| 721 | Ga0070710_10098962 | |||
| 722 | Ga0070710_10184799 | |||
| 723 | Ga0070701_10255188 | |||
| 724 | Ga0070711_100018538 | |||
| 725 | Ga0070711_100095715 | |||
| 726 | Ga0070711_100200279 | |||
| 727 | Ga0070705_100166346 | |||
| 728 | Ga0070694_100044594 | |||
| 729 | Ga0070694_100271529 | |||
| 730 | Ga0070708_100000274 | |||
| 731 | Ga0070708_100316797 | |||
| 732 | Ga0070708_100389848 | |||
| 733 | Ga0070708_100574619 | |||
| 734 | Ga0070663_101975217 | |||
| 735 | Ga0070681_10093222 | |||
| 736 | Ga0070706_100011662 | |||
| 737 | Ga0070706_100189864 | |||
| 738 | Ga0070706_100292693 | |||
| 739 | Ga0070706_101023268 | |||
| 740 | Ga0070707_100024443 | |||
| 741 | Ga0070707_100118160 | |||
| 742 | Ga0070707_100186887 | |||
| 743 | Ga0070707_100218182 | |||
| 744 | Ga0070707_100554992 | |||
| 745 | Ga0070707_100980410 | |||
| 746 | Ga0070707_101445683 | |||
| 747 | Ga0070698_100014396 | |||
| 748 | Ga0070698_100017553 | |||
| 749 | Ga0070698_100126953 | |||
| 750 | Ga0070698_100128913 | |||
| 751 | Ga0070698_100156240 | |||
| 752 | Ga0070698_100182180 | |||
| 753 | Ga0070698_101341625 | |||
| 754 | Ga0070698_102133477 | |||
| 755 | Ga0070699_100000462 | |||
| 756 | Ga0070699_100005603 | |||
| 757 | Ga0070699_100364329 | |||
| 758 | Ga0070699_101399654 | |||
| 759 | Ga0070679_100070794 | |||
| 760 | Ga0070679_100256179 | |||
| 761 | Ga0070684_100000509 | |||
| 762 | Ga0070684_100011478 | |||
| 763 | Ga0070684_100744829 | |||
| 764 | Ga0070697_100000066 | |||
| 765 | Ga0070697_100148834 | |||
| 766 | Ga0070697_100571766 | |||
| 767 | Ga0070697_101119128 | |||
| 768 | Ga0070697_101598789 | |||
| 769 | Ga0068853_100494557 | |||
| 770 | Ga0070672_100318393 | |||
| 771 | Ga0070672_102111667 | |||
| 772 | Ga0070695_100095470 | |||
| 773 | Ga0070695_100121999 | |||
| 774 | Ga0070695_100935674 | |||
| 775 | Ga0070696_100213742 | |||
| 776 | Ga0070696_100722734 | |||
| 777 | Ga0070696_101077176 | |||
| 778 | Ga0070704_100090956 | |||
| 779 | Ga0068855_100062969 | |||
| 780 | Ga0070664_100184586 | |||
| 781 | Ga0070664_100465596 | |||
| 782 | Ga0070664_100633340 | |||
| 783 | Ga0070664_101646996 | |||
| 784 | Ga0070664_101923217 | |||
| 785 | Ga0068857_100002126 | |||
| 786 | Ga0068857_100048017 | |||
| 787 | Ga0068857_100520689 | |||
| 788 | Ga0068854_101827724 | |||
| 789 | Ga0068856_100005240 | |||
| 790 | Ga0068856_100049542 | |||
| 791 | Ga0068856_100075252 | |||
| 792 | Ga0068856_100211992 | |||
| 793 | Ga0068852_100151209 | |||
| 794 | Ga0068859_100302931 | |||
| 795 | Ga0068859_101870311 | |||
| 796 | Ga0068859_102034610 | |||
| 797 | Ga0068864_100146009 | |||
| 798 | Ga0068866_10430482 | |||
| 799 | Ga0068861_100169638 | |||
| 800 | Ga0068861_101208828 | |||
| 801 | Ga0068870_10023318 | |||
| 802 | Ga0068870_10316232 | |||
| 803 | Ga0068870_11449798 | |||
| 804 | Ga0068860_100155501 | |||
| 805 | Ga0081540_1000171 | |||
| 806 | Ga0070717_10152497 | |||
| 807 | Ga0070717_10168312 | |||
| 808 | Ga0070717_10381085 | |||
| 809 | Ga0070717_11041001 | |||
| 810 | Ga0075365_10109792 | |||
| 811 | Ga0070715_10422775 | |||
| 812 | Ga0070716_100037924 | |||
| 813 | Ga0070716_100039016 | |||
| 814 | Ga0070716_100044765 | |||
| 815 | Ga0070716_100441106 | |||
| 816 | Ga0070716_101116414 | |||
| 817 | Ga0070712_100011245 | |||
| 818 | Ga0070712_100093408 | |||
| 819 | Ga0070712_100101296 | |||
| 820 | Ga0070712_100348445 | |||
| 821 | Ga0070712_101047872 | |||
| 822 | Ga0070712_101154473 | |||
| 823 | Ga0070712_101241736 | |||
| 824 | Ga0097621_100195076 | |||
| 825 | Ga0097621_102040862 | |||
| 826 | Ga0068871_100297651 | |||
| 827 | Ga0075434_101061722 | |||
| 828 | Ga0097620_100302939 | |||
| 829 | Ga0097620_101869990 | |||
| 830 | Ga0097620_102034896 | |||
| 831 | Ga0075435_100228888 | |||
| 832 | Ga0099795_10042712 | |||
| 833 | Ga0105245_10385211 | |||
| 834 | Ga0105245_10474687 | |||
| 835 | Ga0105245_10951224 | |||
| 836 | Ga0105245_11576469 | |||
| 837 | Ga0105247_10659598 | |||
| 838 | Ga0105247_11692135 | |||
| 839 | Ga0114129_12328438 | |||
| 840 | Ga0114129_12690765 | |||
| 841 | Ga0105241_10206022 | |||
| 842 | Ga0105242_10189015 | |||
| 843 | Ga0105242_12193553 | |||
| 844 | Ga0105237_11554262 | |||
| 845 | Ga0105238_12313288 | |||
| 846 | Ga0105249_10195848 | |||
| 847 | Ga0105239_10524623 | |||
| 848 | Ga0105246_10719669 | |||
| 849 | Ga0157370_10019427 | |||
| 850 | Ga0157369_10006208 | |||
| 851 | Ga0157369_10574716 | |||
| 852 | Ga0163162_13066598 | |||
| 853 | Ga0157372_10095283 | |||
| 854 | Ga0157372_10649356 | |||
| 855 | Ga0157375_11846201 | |||
| 856 | Ga0157375_12072156 | |||
| 857 | Ga0182008_10169650 | |||
| 858 | Ga0157377_11444885 | |||
| 859 | Ga0157377_11746775 | |||
| 860 | Ga0157376_10300424 | |||
| 861 | Ga0157376_11360474 | |||
| 862 | Ga0157376_11625027 | |||
| 863 | Ga0182006_1214162 | |||
| 864 | Ga0206356_10439586 | |||
| 865 | Ga0206354_10671847 | |||
| 866 | Ga0206353_11740502 | |||
| 867 | Ga0207653_10016844 | |||
| 868 | Ga0207653_10140614 | |||
| 869 | Ga0207692_10033668 | |||
| 870 | Ga0207692_10074920 | |||
| 871 | Ga0207688_10029581 | |||
| 872 | Ga0207688_10249864 | |||
| 873 | Ga0207680_10185821 | |||
| 874 | Ga0207685_10008037 | |||
| 875 | Ga0207699_10006744 | |||
| 876 | Ga0207699_10027013 | |||
| 877 | Ga0207699_10168367 | |||
| 878 | Ga0207699_10359462 | |||
| 879 | Ga0207643_10089068 | |||
| 880 | Ga0207643_10715827 | |||
| 881 | Ga0207705_10052590 | |||
| 882 | Ga0207705_10150303 | |||
| 883 | Ga0207705_10369260 | |||
| 884 | Ga0207684_10004102 | |||
| 885 | Ga0207684_10005909 | |||
| 886 | Ga0207684_10189048 | |||
| 887 | Ga0207684_10368208 | |||
| 888 | Ga0207684_10686815 | |||
| 889 | Ga0207707_10061387 | |||
| 890 | Ga0207671_11030759 | |||
| 891 | Ga0207693_10009068 | |||
| 892 | Ga0207693_10160748 | |||
| 893 | Ga0207693_10177530 | |||
| 894 | Ga0207663_10017987 | |||
| 895 | Ga0207663_10273339 | |||
| 896 | Ga0207660_10098263 | |||
| 897 | Ga0207662_10156940 | |||
| 898 | Ga0207657_10001447 | |||
| 899 | Ga0207657_10324153 | |||
| 900 | Ga0207649_10252773 | |||
| 901 | Ga0207649_10733770 | |||
| 902 | Ga0207652_10138134 | |||
| 903 | Ga0207652_10138426 | |||
| 904 | Ga0207652_10201979 | |||
| 905 | Ga0207646_10022896 | |||
| 906 | Ga0207646_10024338 | |||
| 907 | Ga0207646_10213065 | |||
| 908 | Ga0207646_10303679 | |||
| 909 | Ga0207646_10471437 | |||
| 910 | Ga0207646_10755244 | |||
| 911 | Ga0207694_10297121 | |||
| 912 | Ga0207694_11325926 | |||
| 913 | Ga0207659_10443682 | |||
| 914 | Ga0207687_10330460 | |||
| 915 | Ga0207687_11015725 | |||
| 916 | Ga0207700_10003119 | |||
| 917 | Ga0207700_10020216 | |||
| 918 | Ga0207700_10153502 | |||
| 919 | Ga0207700_10281731 | |||
| 920 | Ga0207700_10316660 | |||
| 921 | Ga0207700_10557800 | |||
| 922 | Ga0207700_11091979 | |||
| 923 | Ga0207664_10000986 | |||
| 924 | Ga0207664_10004184 | |||
| 925 | Ga0207664_10017423 | |||
| 926 | Ga0207664_10025336 | |||
| 927 | Ga0207664_10026847 | |||
| 928 | Ga0207664_10052261 | |||
| 929 | Ga0207664_10296481 | |||
| 930 | Ga0207664_10301296 | |||
| 931 | Ga0207664_10911977 | |||
| 932 | Ga0207644_10353487 | |||
| 933 | Ga0207690_10163739 | |||
| 934 | Ga0207690_10404811 | |||
| 935 | Ga0207686_11452800 | |||
| 936 | Ga0207670_10322567 | |||
| 937 | Ga0207704_10514800 | |||
| 938 | Ga0207665_10058311 | |||
| 939 | Ga0207665_10086156 | |||
| 940 | Ga0207665_10133191 | |||
| 941 | Ga0207661_10000793 | |||
| 942 | Ga0207661_10026245 | |||
| 943 | Ga0207661_10182192 | |||
| 944 | Ga0207661_10381091 | |||
| 945 | Ga0207661_11215973 | |||
| 946 | Ga0207661_11378841 | |||
| 947 | Ga0207679_10105376 | |||
| 948 | Ga0207679_10287121 | |||
| 949 | Ga0207679_10454692 | |||
| 950 | Ga0207667_10077606 | |||
| 951 | Ga0207667_10109180 | |||
| 952 | Ga0207651_10744132 | |||
| 953 | Ga0207712_10292050 | |||
| 954 | Ga0207668_10352083 | |||
| 955 | Ga0207668_10804932 | |||
| 956 | Ga0207640_11778802 | |||
| 957 | Ga0207658_11135342 | |||
| 958 | Ga0207639_10233301 | |||
| 959 | Ga0207639_11097737 | |||
| 960 | Ga0207678_10011014 | |||
| 961 | Ga0207702_10006333 | |||
| 962 | Ga0207702_10125739 | |||
| 963 | Ga0207702_10133944 | |||
| 964 | Ga0207702_10192316 | |||
| 965 | Ga0207702_10671742 | |||
| 966 | Ga0207702_10735197 | |||
| 967 | Ga0207641_10104440 | |||
| 968 | Ga0207648_11026449 | |||
| 969 | Ga0207676_10707987 | |||
| 970 | Ga0207674_10003127 | |||
| 971 | Ga0207674_10006750 | |||
| 972 | Ga0207683_11479697 | |||
| 973 | Ga0207698_10826607 | |||
| 974 | Ga0207428_10279271 | |||
| 975 | Ga0268266_11983386 | |||
| 976 | Ga0268265_10925861 | |||
| 977 | Ga0307513_10558210 | |||
| 978 | Ga0307410_10088753 | |||
| 979 | Ga0307409_100042694 | |||
| 980 | Ga0307416_100707390 | |||
| 981 | Ga0307414_11447615 | |||
| 982 | Ga0307411_10637262 | |||
| 983 | Ga0373930_0016066 | |||
| 984 | Ga0373948_0007419 | |||
| 985 | Ga0373959_0016278 | |||
| 986 | Ga0373926_0058659 | |||
| 987 | Ga0373926_0186848 | |||
| 988 | Ga0373928_0232114 | |||
| 989 | Ga0373929_0067888 | |||
| 990 | Ga0373934_0000021 | |||
| 991 | Ga0373934_0006828 | |||
| 992 | Ga0373940_0070094 | |||
| 993 | Ga0373949_0024138 | |||
| 994 | Ga0373952_0170649 | |||
| 995 | Ga0373923_0016071 | |||
| 996 | Ga0373923_0034245 | |||
| 997 | Ga0373923_0539027 | |||
| 998 | Ga0373932_0252755 | |||
| 999 | Ga0373932_0423375 | |||
| 1000 | Ga0373939_0019357 | |||
| 1001 | Ga0373945_0062214 | |||
| 1002 | Ga0373953_0001230 | |||
| 1003 | Ga0373953_0049891 | |||
| 1004 | Ga0373953_0112494 | |||
| 1005 | Ga0373954_0002755 | |||
| 1006 | Ga0373954_0173025 | |||
| 1007 | Ga0373954_0219299 | |||
| 1008 | Ga0373956_0000073 | |||
| 1009 | Ga0373956_0014378 | |||
| 1010 | Ga0373956_0177128 | |||
| 1011 | Ga0373957_0000110 | |||
| 1012 | Ga0373957_0024169 | |||
| 1013 | Ga0373943_0041453 | |||
| 1014 | Ga0373946_0216949 | |||
| 1015 | Ga0373955_0000125 | |||
| 1016 | Ga0373955_0001874 | |||
| 1017 | Ga0373942_0016843 | |||
| 1018 | Ga0373962_0055967 | |||
| 1019 | Ga0373924_0060042 | |||
| 1020 | Ga0373931_0202489 | |||
| 1021 | Ga0373935_0017286 | |||
| 1022 | Ga0373935_0495400 | |||
| 1023 | Ga0373927_0152684 | |||
| 1024 | Ga0373933_0000366 | |||
| 1025 | Ga0373933_0023485 | |||
| 1026 | Ga0373933_0078263 | |||
| 1027 | Ga0373933_0277177 | |||
| 1028 | Ga0373933_0549577 | |||
| 1029 | Ga0373947_0577817 | |||
| 1030 | Ga0373937_0000169 | |||
| 1031 | Ga0373937_0029491 | |||
| 1032 | Ga0373937_0212526 | |||
| 1033 | Ga0373937_0250037 | |||
| 1034 | Ga0373925_0037556 | |||
| 1035 | Ga0395899_0688112 | |||
| 1036 | Ga0395900_0197472 | |||
| 1037 | Ga0395898_0203310 | |||
| 1038 | Ga0395898_0281811 | |||
| 1039 | Ga0395905_0158448 | |||
| 1040 | Ga0395905_0832995 | |||
| 1041 | Ga0395901_0025177 | |||
| 1042 | Ga0395901_0081949 | |||
| 1043 | Ga0395901_0249073 | |||
| 1044 | Ga0395901_0489977 | |||
| 1045 | Ga0242420_006955 | |||
| 1046 | Ga0451793_0340383 | |||
| 1047 | Ga0451793_1106976 | |||
| 1048 | Ga0451795_0318555 | |||
| 1049 | Ga0451802_0748016 | |||
| 1050 | Ga0451802_1480458 | |||
| 1051 | Ga0451804_0154004 | |||
| 1052 | Ga0451807_0809441 | |||
| 1053 | Ga0451807_1225447 | |||
| 1054 | Ga0451853_1935145 | |||
| 1055 | Ga0466966_0010653 | |||
| 1056 | Ga0466966_0405085 | |||
| 1057 | Ga0466961_0425249 | |||
| 1058 | Ga0466963_0026387 | |||
| 1059 | Ga0466968_0042988 | |||
| 1060 | Ga0466968_0607287 | |||
| 1061 | Ga0466957_0263987 | |||
| 1062 | Ga0466960_0013201 | |||
| 1063 | Ga0466959_0343428 | |||
| 1064 | Ga0466958_0595228 | |||
| 1065 | Ga0466967_0693276 | |||
| 1066 | Ga0466967_0900261 | |||
| 1067 | Ga0466967_1713136 | |||
| 1068 | Ga0466967_2439165 | |||
| 1069 | Ga0495592_0000070 | |||
| 1070 | Ga0495592_0003134 | |||
| 1071 | Ga0495592_0014732 | |||
| 1072 | Ga0495592_0234977 | |||
| 1073 | Ga0495603_0067657 | |||
| 1074 | Ga0495603_0499556 | |||
| 1075 | Ga0495603_0559309 | |||
| 1076 | Ga0495629_0030737 | |||
| 1077 | Ga0495629_0039999 | |||
| 1078 | Ga0495629_0618315 | |||
| 1079 | Ga0495641_0020248 | |||
| 1080 | Ga0495641_0313697 | |||
| 1081 | Ga0495651_0000042 | |||
| 1082 | Ga0495651_0003630 | |||
| 1083 | Ga0495651_0012020 | |||
| 1084 | Ga0495651_0049562 | |||
| 1085 | Ga0495651_0190856 | |||
| 1086 | Ga0495651_0730029 | |||
| 1087 | Ga0495653_0001451 | |||
| 1088 | Ga0495653_0026604 | |||
| 1089 | Ga0495653_0160683 | |||
| 1090 | Ga0495653_0226547 | |||
| 1091 | Ga0495582_0016987 | |||
| 1092 | Ga0495582_0227140 | |||
| 1093 | Ga0495582_0728326 | |||
| 1094 | Ga0495662_0011166 | |||
| 1095 | Ga0495662_0067476 | |||
| 1096 | Ga0495664_0070349 | |||
| 1097 | Ga0495664_0101446 | |||
| 1098 | Ga0495585_0104256 | |||
| 1099 | Ga0495596_0127048 | |||
| 1100 | Ga0495608_0000054 | |||
| 1101 | Ga0495608_0002527 | |||
| 1102 | Ga0495608_0038630 | |||
| 1103 | Ga0495608_0104340 | |||
| 1104 | Ga0495618_0044331 | |||
| 1105 | Ga0495618_0199374 | |||
| 1106 | Ga0495618_0246839 | |||
| 1107 | Ga0495628_0000106 | |||
| 1108 | Ga0495628_0015941 | |||
| 1109 | Ga0495628_0035322 | |||
| 1110 | Ga0495628_0046405 | |||
| 1111 | Ga0495628_0601187 | |||
| 1112 | Ga0495630_0022949 | |||
| 1113 | Ga0495630_0090004 | |||
| 1114 | Ga0495630_0494596 | |||
| 1115 | Ga0495663_0230143 | |||
| 1116 | Ga0495652_0000119 | |||
| 1117 | Ga0495652_0051433 | |||
| 1118 | Ga0495652_0054950 | |||
| 1119 | Ga0495652_0268712 | |||
| 1120 | Ga0495652_0312299 | |||
| 1121 | Ga0495652_0329572 | |||
| 1122 | Ga0495652_0810156 | |||
| 1123 | Ga0495665_0030193 | |||
| 1124 | Ga0495640_0014429 | |||
| 1125 | Ga0495640_0132962 | |||
| 1126 | Ga0495640_0175834 | |||
| 1127 | Ga0495587_0000374 | |||
| 1128 | Ga0495587_0008051 | |||
| 1129 | Ga0495587_0017553 | |||
| 1130 | Ga0495587_0048418 | |||
| 1131 | Ga0495645_0026920 | |||
| 1132 | Ga0495645_0090333 | |||
| 1133 | Ga0495645_0104247 | |||
| 1134 | Ga0495645_0180355 | |||
| 1135 | Ga0495645_0270486 | |||
| 1136 | Ga0495645_0680857 | |||
| 1137 | Ga0495667_0000114 | |||
| 1138 | Ga0495667_0008763 | |||
| 1139 | Ga0495667_0046045 | |||
| 1140 | Ga0495667_0095608 | |||
| 1141 | Ga0495634_0011961 | |||
| 1142 | Ga0495634_0014099 | |||
| 1143 | Ga0495634_0214650 | |||
| 1144 | Ga0495625_0159175 | |||
| 1145 | Ga0495635_0018710 | |||
| 1146 | Ga0495635_0060808 | |||
| 1147 | Ga0495588_0041764 | |||
| 1148 | Ga0495657_0000067 | |||
| 1149 | Ga0495657_0016641 | |||
| 1150 | Ga0495657_0043884 | |||
| 1151 | Ga0495657_0060403 | |||
| 1152 | Ga0495657_0097554 | |||
| 1153 | Ga0495657_0524684 | |||
| 1154 | Ga0495599_0000042 | |||
| 1155 | Ga0495599_0014633 | |||
| 1156 | Ga0495599_0176207 | |||
| 1157 | Ga0495599_0392079 | |||
| 1158 | Ga0495623_0000522 | |||
| 1159 | Ga0495623_0027933 | |||
| 1160 | Ga0495623_0236141 | |||
| 1161 | Ga0495646_0015534 | |||
| 1162 | Ga0495646_0016721 | |||
| 1163 | Ga0495658_0103571 | |||
| 1164 | Ga0495658_0479646 | |||
| 1165 | Ga0495669_0145372 | |||
| 1166 | Ga0495613_0005882 | |||
| 1167 | Ga0495613_0055982 | |||
| 1168 | Ga0495613_0253111 | |||
| 1169 | Ga0495613_0327794 | |||
| 1170 | Ga0495624_0052665 | |||
| 1171 | Ga0495624_0094122 | |||
| 1172 | Ga0495624_0485526 | |||
| 1173 | Ga0495600_0030439 | |||
| 1174 | Ga0495600_0044481 | |||
| 1175 | Ga0495600_0051012 | |||
| 1176 | Ga0495600_0065499 | |||
| 1177 | Ga0495600_0324947 | |||
| 1178 | Ga0495600_0724139 | |||
| 1179 | Ga0495581_0051991 | |||
| 1180 | Ga0495604_0000121 | |||
| 1181 | Ga0495604_0019477 | |||
| 1182 | Ga0495604_0023212 | |||
| 1183 | Ga0495604_0237587 | |||
| 1184 | Ga0495674_0056198 | |||
| 1185 | Ga0495674_0115068 | |||
| 1186 | Ga0495674_0862777 | |||
| 1187 | Ga0495674_0885082 | |||
| 1188 | Ga0495672_0394597 | |||
| 1189 | Ga0495676_0023733 | |||
| 1190 | Ga0495676_0320891 | |||
| 1191 | Ga0495680_0000054 | |||
| 1192 | Ga0495680_0008382 | |||
| 1193 | Ga0495680_0041121 | |||
| 1194 | Ga0495680_0093176 | |||
| 1195 | Ga0495680_0450370 | |||
| 1196 | Ga0495675_0000346 | |||
| 1197 | Ga0495675_0010975 | |||
| 1198 | Ga0495675_0044283 | |||
| 1199 | Ga0495675_0072674 | |||
| 1200 | Ga0495684_0020047 | |||
| 1201 | Ga0495684_0184075 | |||
| 1202 | Ga0495684_0244152 | |||
| 1203 | Ga0495684_0717379 | |||
| 1204 | Ga0495593_0015873 | |||
| 1205 | Ga0495602_0000083 | |||
| 1206 | Ga0495602_0065498 | |||
| 1207 | Ga0495602_0072856 | |||
| 1208 | Ga0495602_0258709 | |||
| 1209 | Ga0495614_0059791 | |||
| 1210 | Ga0495614_0187102 | |||
| 1211 | Ga0496100_0041690 | |||
| 1212 | Ga0496100_0119400 | |||
| 1213 | Ga0496100_0340247 | |||
| 1214 | Ga0496100_0805666 | |||
| 1215 | Ga0496101_0028100 | |||
| 1216 | Ga0496101_0379396 | |||
| 1217 | Ga0496101_0557165 | |||
| 1218 | Ga0496101_0873774 | |||
| 1219 | Ga0496102_0076533 | |||
| 1220 | Ga0496102_0435305 | |||
| 1221 | Ga0496102_0778067 | |||
| 1222 | Ga0496102_0812104 | |||
| 1223 | Ga0496102_0829667 | |||
| 1224 | Ga0496102_1061769 | |||
| 1225 | Ga0496103_0606656 | |||
| 1226 | Ga0496104_0000804 | |||
| 1227 | Ga0496104_0000853 | |||
| 1228 | Ga0496104_0248266 | |||
| 1229 | Ga0496104_0774636 | |||
| 1230 | Ga0496105_0000546 | |||
| 1231 | Ga0496105_0001245 | |||
| 1232 | Ga0496105_0006415 | |||
| 1233 | Ga0496105_0010038 | |||
| 1234 | Ga0496106_1061990 | |||
| 1235 | Ga0496107_0041664 | |||
| 1236 | Ga0496108_0005112 | |||
| 1237 | Ga0496108_0067554 | |||
| 1238 | Ga0496108_0081459 | |||
| 1239 | Ga0496108_0081617 | |||
| 1240 | Ga0496108_0565417 | |||
| 1241 | Ga0496109_0000564 | |||
| 1242 | Ga0496109_0147849 | |||
| 1243 | Ga0496109_0177386 | |||
| 1244 | Ga0496109_0216968 | |||
| 1245 | Ga0496109_0290834 | |||
| 1246 | Ga0496109_0331666 | |||
| 1247 | Ga0496109_0346822 | |||
| 1248 | Ga0496109_0842354 | |||
| 1249 | Ga0496109_1397139 | |||
| 1250 | Ga0496110_0123530 | |||
| 1251 | Ga0496110_0124762 | |||
| 1252 | Ga0496110_0140349 | |||
| 1253 | Ga0496110_0175133 | |||
| 1254 | Ga0496110_0175376 | |||
| 1255 | Ga0496110_1073376 | |||
| 1256 | Ga0496110_1618654 | |||
| 1257 | Ga0496111_0000683 | |||
| 1258 | Ga0496112_0000898 | |||
| 1259 | Ga0496112_0113522 | |||
| 1260 | Ga0496112_0144405 | |||
| 1261 | Ga0496112_0253177 | |||
| 1262 | Ga0496112_0975386 | |||
| 1263 | Ga0496113_0063551 | |||
| 1264 | Ga0496113_0148076 | |||
| 1265 | Ga0496113_0238131 | |||
| 1266 | Ga0496113_1038435 | |||
| 1267 | Ga0496114_0000763 | |||
| 1268 | Ga0496114_0159321 | |||
| 1269 | Ga0496114_0182689 | |||
| 1270 | Ga0496114_0233123 | |||
| 1271 | Ga0496114_0255951 | |||
| 1272 | Ga0496114_0290206 | |||
| 1273 | Ga0496114_0466051 | |||
| 1274 | Ga0496114_0903567 | |||
| 1275 | Ga0496114_1018496 | |||
| 1276 | Ga0496115_0045687 | |||
| 1277 | Ga0496115_0099025 | |||
| 1278 | Ga0496118_0461186 | |||
| 1279 | Ga0496120_0014507 | |||
| 1280 | Ga0501031_0000818 | |||
| 1281 | Ga0501031_0011134 | |||
| 1282 | Ga0501031_1021216 | |||
| 1283 | Ga0501032_0000978 | |||
| 1284 | Ga0501032_0012449 | |||
| 1285 | Ga0501032_0168353 | |||
| 1286 | Ga0501032_0473636 | |||
| 1287 | Ga0501033_0001418 | |||
| 1288 | Ga0501033_0011843 | |||
| 1289 | Ga0501034_0003564 | |||
| 1290 | Ga0501034_0017200 | |||
| 1291 | Ga0501034_1527960 | |||
| 1292 | Ga0501036_0010755 | |||
| 1293 | Ga0501036_0039610 | |||
| 1294 | Ga0501036_0676956 | |||
| 1295 | Ga0501037_0002882 | |||
| 1296 | Ga0501037_0008604 | |||
| 1297 | Ga0501037_0032786 | |||
| 1298 | Ga0501037_0089054 | |||
| 1299 | Ga0501038_0000501 | |||
| 1300 | Ga0501038_0013575 | |||
| 1301 | Ga0501038_0113494 | |||
| 1302 | Ga0501039_0004987 | |||
| 1303 | Ga0501039_0005351 | |||
| 1304 | Ga0501039_0394154 | |||
| 1305 | Ga0501042_0052390 | |||
| 1306 | Ga0501043_0001130 | |||
| 1307 | Ga0501043_0031070 | |||
| 1308 | Ga0501043_0215715 | |||
| 1309 | Ga0501046_0002038 | |||
| 1310 | Ga0501046_0004866 | |||
| 1311 | Ga0501046_0028839 | |||
| 1312 | Ga0501047_0006489 | |||
| 1313 | Ga0501047_0023766 | |||
| 1314 | Ga0501047_1201407 | |||
| 1315 | Ga0501048_0000474 | |||
| 1316 | Ga0501048_0007929 | |||
| 1317 | Ga0501067_0029067 | |||
| 1318 | Ga0501067_0166411 | |||
| 1319 | Ga0501068_0070837 | |||
| 1320 | Ga0501068_0201700 | |||
| 1321 | Ga0501069_0014299 | |||
| 1322 | Ga0501070_0001907 | |||
| 1323 | Ga0501070_0011322 | |||
| 1324 | Ga0501070_0225520 | |||
| 1325 | Ga0501070_1354410 | |||
| 1326 | Ga0501072_0854295 | |||
| 1327 | Ga0501073_0007439 | |||
| 1328 | Ga0501074_0014483 | |||
| 1329 | Ga0501074_0082553 | |||
| 1330 | Ga0501080_0002944 | |||
| 1331 | Ga0501083_0001473 | |||
| 1332 | Ga0501035_0002308 | |||
| 1333 | Ga0501035_0004669 | |||
| 1334 | Ga0501044_0016708 | |||
| 1335 | Ga0501044_0045026 | |||
| 1336 | Ga0501044_0356011 | |||
| 1337 | Ga0501045_0023437 | |||
| 1338 | Ga0501045_0386204 | |||
| 1339 | nmdc:mga0rr50_23983_c1 | |||
| 1340 | Ga0495601_0009537 | |||
| 1341 | Ga0495601_0036879 | |||
| 1342 | Ga0495601_0091862 | |||
| 1343 | Ga0495601_0516622 | |||
| 1344 | Ga0495601_0588530 | |||
| 1345 | Ga0495612_0036041 | |||
| 1346 | Ga0495612_0064129 | |||
| 1347 | Ga0495595_0025398 | |||
| 1348 | Ga0495595_0028131 | |||
| 1349 | Ga0495595_0040959 | |||
| 1350 | Ga0495619_0108773 | |||
| 1351 | Ga0495619_0160348 | |||
| 1352 | Ga0495619_0209639 | |||
| 1353 | Ga0500556_0000204 | |||
| 1354 | Ga0500593_001484 | |||
| 1355 | Ga0500616_0000081 | |||
| 1356 | Ga0501084_0032552 | |||
| 1357 | Ga0587073_0041641 | |||
| 1358 | Ga0530510_1513615 | |||
| 1359 | 2676477495 | |||
| 1360 | 2819426916 | |||
| 1361 | 2827634752 | |||
| 1362 | 2858854772 | |||
| 1363 | 2858893017 | |||
| 1364 | 2880496921 | |||
| 1365 | 2946033574 | |||
| 1366 | 8054734501 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9431 | 2 | 58 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9399 | 2 | 61 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9388 | 3 | 52 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9258 | 3 | 52 |
| 4a6d-assembly1.cif.gz_A | crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam | 0.9251 | 8 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53838_4_115_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9818 | 2 | 52 | 1.10.10.10 |
| af_P9WMI9_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9588 | 2 | 52 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9582 | 2 | 51 | 1.10.10.10 |
| af_Q4DPL3_4_78_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9493 | 9 | 54 | 1.10.10.10 |
| af_Q58184_329_408_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9459 | 6 | 52 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A542ZEQ3-F1-model_v4 | ArsR family transcriptional regulator | 0.9757 | 3 | 62 |
GO:0003700
|
| AF-A0A4Q8ADR8-F1-model_v4 | ArsR family transcriptional regulator | 0.9721 | 2 | 69 |
GO:0003700
|
| AF-A0A4R1P4G4-F1-model_v4 | deleted | 0.9695 | 2 | 82 |
|
| AF-A0A3S9EKF9-F1-model_v4 | ArsR family transcriptional regulator | 0.9671 | 2 | 78 |
GO:0003700
|
| AF-A0A2V5DNL0-F1-model_v4 | deleted | 0.9641 | 2 | 67 |
|