F475000

General Info

Members Datasets Scaffolds Average Seq Length
683 298 1366 105

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0771279|Ga0495628_0771279_296_598
Length 100
Sequence MEAALRALADGSRRTVLDTLTRGPATAGELAALLPIARPGVSRHLRVLREEAQRRVYSLRLEPLAEVDDWLGRYRALWEQRLDALHTEVARGKHERRSTT

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
292 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
293 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
294 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
295 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
296 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
297 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
298 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0.59
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0.15
Rhizoplane 10.98
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0771279 3300046516 Bacteria 674
2 JGI25404J52841_10003782 3300003659 Bacteria 3020
3 Ga0070683_100005393 3300005329 Bacteria 10671
4 Ga0070683_100021347 3300005329 Bacteria 5779
5 Ga0070683_100055211 3300005329 Bacteria 3685
6 Ga0070683_100580946 3300005329 Bacteria 1072
7 Ga0070680_100069290 3300005336 Bacteria 2896
8 Ga0070682_100180085 3300005337 Bacteria 1475
9 Ga0070660_100120063 3300005339 Bacteria 2097
10 Ga0070691_10006793 3300005341 Bacteria 5232
11 Ga0070661_100036685 3300005344 Bacteria 3563
12 Ga0070661_100048252 3300005344 Bacteria 3117
13 Ga0070668_100875321 3300005347 Unclassified 802
14 Ga0070669_101431795 3300005353 Bacteria 600
15 Ga0070675_100785942 3300005354 Unclassified 870
16 Ga0070674_100239388 3300005356 Bacteria 1420
17 Ga0070688_100364174 3300005365 Bacteria 1062
18 Ga0070659_100366584 3300005366 Bacteria 1211
19 Ga0070659_101624777 3300005366 Unclassified 577
20 Ga0070709_10080940 3300005434 Bacteria 2118
21 Ga0070709_10096958 3300005434 Bacteria 1956
22 Ga0070714_100001437 3300005435 Bacteria 17329
23 Ga0070714_100033972 3300005435 Bacteria 4270
24 Ga0070714_100073913 3300005435 Bacteria 2954
25 Ga0070714_100139755 3300005435 Bacteria 2172
26 Ga0070714_100286558 3300005435 Bacteria 1532
27 Ga0070714_100352097 3300005435 Bacteria 1383
28 Ga0070714_100878953 3300005435 Bacteria 870
29 Ga0070713_100000286 3300005436 Bacteria 33358
30 Ga0070713_100058288 3300005436 Bacteria 3220
31 Ga0070713_100071625 3300005436 Bacteria 2930
32 Ga0070713_100115163 3300005436 Bacteria 2350
33 Ga0070713_100116418 3300005436 Bacteria 2337
34 Ga0070713_100594447 3300005436 Bacteria 1051
35 Ga0070713_100888683 3300005436 Bacteria 857
36 Ga0070713_102158319 3300005436 Bacteria 540
37 Ga0070710_10029543 3300005437 Bacteria 2942
38 Ga0070710_10098962 3300005437 Bacteria 1733
39 Ga0070710_10184799 3300005437 Bacteria 1307
40 Ga0070701_10255188 3300005438 Bacteria 1060
41 Ga0070711_100018538 3300005439 Bacteria 4447
42 Ga0070711_100095715 3300005439 Bacteria 2149
43 Ga0070711_100200279 3300005439 Bacteria 1540
44 Ga0070705_100166346 3300005440 Bacteria 1479
45 Ga0070694_100044594 3300005444 Bacteria 2968
46 Ga0070694_100271529 3300005444 Bacteria 1290
47 Ga0070708_100000274 3300005445 Bacteria 38511
48 Ga0070708_100316797 3300005445 Bacteria 1469
49 Ga0070708_100389848 3300005445 Bacteria 1313
50 Ga0070708_100574619 3300005445 Bacteria 1063
51 Ga0070663_101975217 3300005455 Bacteria 525
52 Ga0070681_10093222 3300005458 Bacteria 2960
53 Ga0070706_100011662 3300005467 Bacteria 8164
54 Ga0070706_100189864 3300005467 Bacteria 1920
55 Ga0070706_100292693 3300005467 Bacteria 1519
56 Ga0070706_101023268 3300005467 Bacteria 761
57 Ga0070707_100024443 3300005468 Bacteria 5723
58 Ga0070707_100118160 3300005468 Bacteria 2574
59 Ga0070707_100186887 3300005468 Bacteria 2020
60 Ga0070707_100218182 3300005468 Bacteria 1858
61 Ga0070707_100554992 3300005468 Bacteria 1111
62 Ga0070707_100980410 3300005468 Bacteria 810
63 Ga0070707_101445683 3300005468 Bacteria 654
64 Ga0070698_100014396 3300005471 Bacteria 8357
65 Ga0070698_100017553 3300005471 Bacteria 7542
66 Ga0070698_100126953 3300005471 Bacteria 2508
67 Ga0070698_100128913 3300005471 Bacteria 2486
68 Ga0070698_100156240 3300005471 Bacteria 2226
69 Ga0070698_100182180 3300005471 Bacteria 2039
70 Ga0070698_101341625 3300005471 Bacteria 666
71 Ga0070698_102133477 3300005471 Bacteria 514
72 Ga0070699_100000462 3300005518 Bacteria 38841
73 Ga0070699_100005603 3300005518 Bacteria 11014
74 Ga0070699_100364329 3300005518 Bacteria 1303
75 Ga0070699_101399654 3300005518 Bacteria 641
76 Ga0070679_100070794 3300005530 Bacteria 3479
77 Ga0070679_100256179 3300005530 Bacteria 1705
78 Ga0070684_100000509 3300005535 Bacteria 26687
79 Ga0070684_100011478 3300005535 Bacteria 7056
80 Ga0070684_100744829 3300005535 Unclassified 914
81 Ga0070697_100000066 3300005536 Bacteria 83881
82 Ga0070697_100148834 3300005536 Bacteria 1973
83 Ga0070697_100571766 3300005536 Bacteria 992
84 Ga0070697_101119128 3300005536 Bacteria 701
85 Ga0070697_101598789 3300005536 Bacteria 583
86 Ga0068853_100494557 3300005539 Unclassified 1154
87 Ga0070672_100318393 3300005543 Bacteria 1322
88 Ga0070672_102111667 3300005543 Bacteria 508
89 Ga0070695_100095470 3300005545 Bacteria 1993
90 Ga0070695_100121999 3300005545 Bacteria 1784
91 Ga0070695_100935674 3300005545 Bacteria 702
92 Ga0070696_100213742 3300005546 Bacteria 1444
93 Ga0070696_100722734 3300005546 Bacteria 813
94 Ga0070696_101077176 3300005546 Bacteria 674
95 Ga0070704_100090956 3300005549 Bacteria 2274
96 Ga0068855_100062969 3300005563 Bacteria 4329
97 Ga0070664_100184586 3300005564 Bacteria 1855
98 Ga0070664_100465596 3300005564 Bacteria 1162
99 Ga0070664_100633340 3300005564 Bacteria 993
100 Ga0070664_101646996 3300005564 Bacteria 608
101 Ga0070664_101923217 3300005564 Bacteria 561
102 Ga0068857_100002126 3300005577 Bacteria 16101
103 Ga0068857_100048017 3300005577 Bacteria 3790
104 Ga0068857_100520689 3300005577 Unclassified 1118
105 Ga0068854_101827724 3300005578 Unclassified 557
106 Ga0068856_100005240 3300005614 Bacteria 12794
107 Ga0068856_100049542 3300005614 Bacteria 4140
108 Ga0068856_100075252 3300005614 Bacteria 3344
109 Ga0068856_100211992 3300005614 Unclassified 1952
110 Ga0068852_100151209 3300005616 Bacteria 2159
111 Ga0068859_100302931 3300005617 Bacteria 1692
112 Ga0068859_101870311 3300005617 Bacteria 663
113 Ga0068859_102034610 3300005617 Bacteria 634
114 Ga0068864_100146009 3300005618 Bacteria 2138
115 Ga0068866_10430482 3300005718 Bacteria 858
116 Ga0068861_100169638 3300005719 Bacteria 1807
117 Ga0068861_101208828 3300005719 Unclassified 731
118 Ga0068870_10023318 3300005840 Bacteria 3051
119 Ga0068870_10316232 3300005840 Bacteria 990
120 Ga0068870_11449798 3300005840 Unclassified 504
121 Ga0068860_100155501 3300005843 Bacteria 2203
122 Ga0081540_1000171 3300005983 Bacteria 67920
123 Ga0070717_10152497 3300006028 Bacteria 2000
124 Ga0070717_10168312 3300006028 Bacteria 1905
125 Ga0070717_10381085 3300006028 Bacteria 1265
126 Ga0070717_11041001 3300006028 Bacteria 745
127 Ga0075365_10109792 3300006038 Unclassified 1895
128 Ga0070715_10422775 3300006163 Unclassified 746
129 Ga0070716_100037924 3300006173 Bacteria 2665
130 Ga0070716_100039016 3300006173 Unclassified 2633
131 Ga0070716_100044765 3300006173 Bacteria 2480
132 Ga0070716_100441106 3300006173 Bacteria 947
133 Ga0070716_101116414 3300006173 Unclassified 629
134 Ga0070712_100011245 3300006175 Bacteria 5668
135 Ga0070712_100093408 3300006175 Bacteria 2208
136 Ga0070712_100101296 3300006175 Bacteria 2130
137 Ga0070712_100348445 3300006175 Bacteria 1211
138 Ga0070712_101047872 3300006175 Bacteria 707
139 Ga0070712_101154473 3300006175 Bacteria 673
140 Ga0070712_101241736 3300006175 Bacteria 649
141 Ga0097621_100195076 3300006237 Bacteria 1755
142 Ga0097621_102040862 3300006237 Bacteria 548
143 Ga0068871_100297651 3300006358 Bacteria 1415
144 Ga0075434_101061722 3300006871 Unclassified 823
145 Ga0097620_100302939 3300006931 Bacteria 1692
146 Ga0097620_101869990 3300006931 Bacteria 663
147 Ga0097620_102034896 3300006931 Bacteria 634
148 Ga0075435_100228888 3300007076 Bacteria 1579
149 Ga0099795_10042712 3300007788 Bacteria 1619
150 Ga0105245_10385211 3300009098 Bacteria 1397
151 Ga0105245_10474687 3300009098 Bacteria 1263
152 Ga0105245_10951224 3300009098 Bacteria 902
153 Ga0105245_11576469 3300009098 Bacteria 708
154 Ga0105247_10659598 3300009101 Bacteria 783
155 Ga0105247_11692135 3300009101 Unclassified 523
156 Ga0114129_12328438 3300009147 Unclassified 642
157 Ga0114129_12690765 3300009147 Bacteria 593
158 Ga0105241_10206022 3300009174 Bacteria 1646
159 Ga0105242_10189015 3300009176 Bacteria 1822
160 Ga0105242_12193553 3300009176 Bacteria 597
161 Ga0105237_11554262 3300009545 Bacteria 668
162 Ga0105238_12313288 3300009551 Unclassified 573
163 Ga0105249_10195848 3300009553 Bacteria 1975
164 Ga0105239_10524623 3300010375 Unclassified 1348
165 Ga0105246_10719669 3300011119 Unclassified 877
166 Ga0157370_10019427 3300013104 Bacteria 6815
167 Ga0157369_10006208 3300013105 Bacteria 13865
168 Ga0157369_10574716 3300013105 Unclassified 1164
169 Ga0163162_13066598 3300013306 Bacteria 537
170 Ga0157372_10095283 3300013307 Bacteria 3391
171 Ga0157372_10649356 3300013307 Bacteria 1229
172 Ga0157375_11846201 3300013308 Unclassified 717
173 Ga0157375_12072156 3300013308 Bacteria 677
174 Ga0182008_10169650 3300014497 Bacteria 1101
175 Ga0157377_11444885 3300014745 Bacteria 544
176 Ga0157377_11746775 3300014745 Unclassified 503
177 Ga0157376_10300424 3300014969 Bacteria 1519
178 Ga0157376_11360474 3300014969 Bacteria 741
179 Ga0157376_11625027 3300014969 Bacteria 681
180 Ga0182006_1214162 3300015261 Unclassified 636
181 Ga0206356_10439586 3300020070 Unclassified 1973
182 Ga0206354_10671847 3300020081 Unclassified 984
183 Ga0206353_11740502 3300020082 Unclassified 1129
184 Ga0207653_10016844 3300025885 Bacteria 2298
185 Ga0207653_10140614 3300025885 Bacteria 882
186 Ga0207692_10033668 3300025898 Bacteria 2474
187 Ga0207692_10074920 3300025898 Bacteria 1794
188 Ga0207688_10029581 3300025901 Bacteria 3016
189 Ga0207688_10249864 3300025901 Bacteria 1074
190 Ga0207680_10185821 3300025903 Bacteria 1408
191 Ga0207685_10008037 3300025905 Bacteria 2980
192 Ga0207699_10006744 3300025906 Bacteria 5576
193 Ga0207699_10027013 3300025906 Bacteria 3172
194 Ga0207699_10168367 3300025906 Bacteria 1464
195 Ga0207699_10359462 3300025906 Unclassified 1029
196 Ga0207643_10089068 3300025908 Bacteria 1797
197 Ga0207643_10715827 3300025908 Unclassified 647
198 Ga0207705_10052590 3300025909 Bacteria 2933
199 Ga0207705_10150303 3300025909 Bacteria 1745
200 Ga0207705_10369260 3300025909 Unclassified 1107
201 Ga0207684_10004102 3300025910 Bacteria 13866
202 Ga0207684_10005909 3300025910 Bacteria 11207
203 Ga0207684_10189048 3300025910 Bacteria 1776
204 Ga0207684_10368208 3300025910 Bacteria 1236
205 Ga0207684_10686815 3300025910 Bacteria 871
206 Ga0207707_10061387 3300025912 Bacteria 3270
207 Ga0207671_11030759 3300025914 Bacteria 648
208 Ga0207693_10009068 3300025915 Bacteria 8119
209 Ga0207693_10160748 3300025915 Bacteria 1767
210 Ga0207693_10177530 3300025915 Bacteria 1676
211 Ga0207663_10017987 3300025916 Bacteria 3948
212 Ga0207663_10273339 3300025916 Unclassified 1252
213 Ga0207660_10098263 3300025917 Unclassified 2183
214 Ga0207662_10156940 3300025918 Bacteria 1451
215 Ga0207657_10001447 3300025919 Bacteria 25415
216 Ga0207657_10324153 3300025919 Bacteria 1217
217 Ga0207649_10252773 3300025920 Unclassified 1270
218 Ga0207649_10733770 3300025920 Bacteria 768
219 Ga0207652_10138134 3300025921 Bacteria 2177
220 Ga0207652_10138426 3300025921 Bacteria 2175
221 Ga0207652_10201979 3300025921 Bacteria 1789
222 Ga0207646_10022896 3300025922 Bacteria 5744
223 Ga0207646_10024338 3300025922 Bacteria 5546
224 Ga0207646_10213065 3300025922 Bacteria 1745
225 Ga0207646_10303679 3300025922 Bacteria 1442
226 Ga0207646_10471437 3300025922 Bacteria 1132
227 Ga0207646_10755244 3300025922 Bacteria 868
228 Ga0207694_10297121 3300025924 Bacteria 1329
229 Ga0207694_11325926 3300025924 Bacteria 609
230 Ga0207659_10443682 3300025926 Bacteria 1092
231 Ga0207687_10330460 3300025927 Bacteria 1236
232 Ga0207687_11015725 3300025927 Bacteria 711
233 Ga0207700_10003119 3300025928 Bacteria 9571
234 Ga0207700_10020216 3300025928 Bacteria 4516
235 Ga0207700_10153502 3300025928 Bacteria 1905
236 Ga0207700_10281731 3300025928 Bacteria 1430
237 Ga0207700_10316660 3300025928 Bacteria 1351
238 Ga0207700_10557800 3300025928 Bacteria 1017
239 Ga0207700_11091979 3300025928 Bacteria 713
240 Ga0207664_10000986 3300025929 Bacteria 19093
241 Ga0207664_10004184 3300025929 Bacteria 9750
242 Ga0207664_10017423 3300025929 Bacteria 5265
243 Ga0207664_10025336 3300025929 Bacteria 4467
244 Ga0207664_10026847 3300025929 Bacteria 4357
245 Ga0207664_10052261 3300025929 Bacteria 3231
246 Ga0207664_10296481 3300025929 Bacteria 1422
247 Ga0207664_10301296 3300025929 Bacteria 1410
248 Ga0207664_10911977 3300025929 Unclassified 789
249 Ga0207644_10353487 3300025931 Bacteria 1194
250 Ga0207690_10163739 3300025932 Bacteria 1660
251 Ga0207690_10404811 3300025932 Bacteria 1089
252 Ga0207686_11452800 3300025934 Unclassified 565
253 Ga0207670_10322567 3300025936 Bacteria 1216
254 Ga0207704_10514800 3300025938 Bacteria 967
255 Ga0207665_10058311 3300025939 Bacteria 2610
256 Ga0207665_10086156 3300025939 Bacteria 2169
257 Ga0207665_10133191 3300025939 Bacteria 1766
258 Ga0207661_10000793 3300025944 Bacteria 20636
259 Ga0207661_10026245 3300025944 Bacteria 4436
260 Ga0207661_10182192 3300025944 Bacteria 1836
261 Ga0207661_10381091 3300025944 Unclassified 1276
262 Ga0207661_11215973 3300025944 Bacteria 693
263 Ga0207661_11378841 3300025944 Bacteria 647
264 Ga0207679_10105376 3300025945 Bacteria 2214
265 Ga0207679_10287121 3300025945 Bacteria 1413
266 Ga0207679_10454692 3300025945 Bacteria 1136
267 Ga0207667_10077606 3300025949 Bacteria 3444
268 Ga0207667_10109180 3300025949 Bacteria 2853
269 Ga0207651_10744132 3300025960 Bacteria 866
270 Ga0207712_10292050 3300025961 Bacteria 1334
271 Ga0207668_10352083 3300025972 Bacteria 1232
272 Ga0207668_10804932 3300025972 Unclassified 832
273 Ga0207640_11778802 3300025981 Unclassified 557
274 Ga0207658_11135342 3300025986 Unclassified 714
275 Ga0207639_10233301 3300026041 Unclassified 1596
276 Ga0207639_11097737 3300026041 Unclassified 746
277 Ga0207678_10011014 3300026067 Bacteria 7942
278 Ga0207702_10006333 3300026078 Bacteria 10222
279 Ga0207702_10125739 3300026078 Bacteria 2301
280 Ga0207702_10133944 3300026078 Unclassified 2233
281 Ga0207702_10192316 3300026078 Bacteria 1886
282 Ga0207702_10671742 3300026078 Bacteria 1020
283 Ga0207702_10735197 3300026078 Bacteria 974
284 Ga0207641_10104440 3300026088 Bacteria 2501
285 Ga0207648_11026449 3300026089 Bacteria 773
286 Ga0207676_10707987 3300026095 Bacteria 976
287 Ga0207674_10003127 3300026116 Bacteria 20420
288 Ga0207674_10006750 3300026116 Bacteria 13474
289 Ga0207683_11479697 3300026121 Bacteria 627
290 Ga0207698_10826607 3300026142 Bacteria 930
291 Ga0207428_10279271 3300027907 Bacteria 1240
292 Ga0268266_11983386 3300028379 Bacteria 556
293 Ga0268265_10925861 3300028380 Bacteria 857
294 Ga0307513_10558210 3300031456 Unclassified 857
295 Ga0307410_10088753 3300031852 Bacteria 2190
296 Ga0307409_100042694 3300031995 Bacteria 3398
297 Ga0307416_100707390 3300032002 Bacteria 1097
298 Ga0307414_11447615 3300032004 Bacteria 639
299 Ga0307411_10637262 3300032005 Bacteria 921
300 Ga0373930_0016066 3300034816 Bacteria 1412
301 Ga0373948_0007419 3300034817 Bacteria 1844
302 Ga0373959_0016278 3300034820 Bacteria 1376
303 Ga0373926_0058659 3300035083 Bacteria 1400
304 Ga0373926_0186848 3300035083 Bacteria 795
305 Ga0373928_0232114 3300035084 Bacteria 543
306 Ga0373929_0067888 3300035085 Bacteria 847
307 Ga0373934_0000021 3300035086 Bacteria 53680
308 Ga0373934_0006828 3300035086 Bacteria 4238
309 Ga0373940_0070094 3300035088 Bacteria 1019
310 Ga0373949_0024138 3300035090 Bacteria 1412
311 Ga0373952_0170649 3300035092 Bacteria 622
312 Ga0373923_0016071 3300035111 Bacteria 2836
313 Ga0373923_0034245 3300035111 Bacteria 2060
314 Ga0373923_0539027 3300035111 Bacteria 571
315 Ga0373932_0252755 3300035112 Bacteria 644
316 Ga0373932_0423375 3300035112 Bacteria 519
317 Ga0373939_0019357 3300035114 Bacteria 1835
318 Ga0373945_0062214 3300035116 Bacteria 1395
319 Ga0373953_0001230 3300035117 Bacteria 7304
320 Ga0373953_0049891 3300035117 Bacteria 1689
321 Ga0373953_0112494 3300035117 Bacteria 1152
322 Ga0373954_0002755 3300035118 Bacteria 7399
323 Ga0373954_0173025 3300035118 Bacteria 1058
324 Ga0373954_0219299 3300035118 Bacteria 935
325 Ga0373956_0000073 3300035119 Bacteria 32947
326 Ga0373956_0014378 3300035119 Bacteria 3306
327 Ga0373956_0177128 3300035119 Bacteria 1007
328 Ga0373957_0000110 3300035120 Bacteria 19703
329 Ga0373957_0024169 3300035120 Bacteria 2180
330 Ga0373943_0041453 3300035170 Bacteria 2226
331 Ga0373946_0216949 3300035171 Bacteria 922
332 Ga0373955_0000125 3300035172 Bacteria 30520
333 Ga0373955_0001874 3300035172 Bacteria 9061
334 Ga0373942_0016843 3300035207 Bacteria 1797
335 Ga0373962_0055967 3300035242 Bacteria 1147
336 Ga0373924_0060042 3300035410 Bacteria 1589
337 Ga0373931_0202489 3300035691 Bacteria 1186
338 Ga0373935_0017286 3300035692 Bacteria 4374
339 Ga0373935_0495400 3300035692 Bacteria 887
340 Ga0373927_0152684 3300035695 Bacteria 1512
341 Ga0373933_0000366 3300035724 Bacteria 28850
342 Ga0373933_0023485 3300035724 Bacteria 3523
343 Ga0373933_0078263 3300035724 Bacteria 2023
344 Ga0373933_0277177 3300035724 Bacteria 1083
345 Ga0373933_0549577 3300035724 Bacteria 758
346 Ga0373947_0577817 3300035725 Bacteria 765
347 Ga0373937_0000169 3300036401 Bacteria 63595
348 Ga0373937_0029491 3300036401 Bacteria 4968
349 Ga0373937_0212526 3300036401 Bacteria 1820
350 Ga0373937_0250037 3300036401 Bacteria 1671
351 Ga0373925_0037556 3300037068 Bacteria 3576
352 Ga0395899_0688112 3300037312 Bacteria 642
353 Ga0395900_0197472 3300037418 Bacteria 2037
354 Ga0395898_0203310 3300037466 Bacteria 1890
355 Ga0395898_0281811 3300037466 Bacteria 1585
356 Ga0395905_0158448 3300037471 Bacteria 2128
357 Ga0395905_0832995 3300037471 Bacteria 825
358 Ga0395901_0025177 3300038443 Bacteria 6109
359 Ga0395901_0081949 3300038443 Bacteria 3370
360 Ga0395901_0249073 3300038443 Bacteria 1851
361 Ga0395901_0489977 3300038443 Bacteria 1253
362 Ga0242420_006955 3300038996 Bacteria 1804
363 Ga0451793_0340383 3300041452 Unclassified 631
364 Ga0451793_1106976 3300041452 Bacteria 563
365 Ga0451795_0318555 3300041456 Bacteria 666
366 Ga0451802_0748016 3300041460 Bacteria 779
367 Ga0451802_1480458 3300041460 Unclassified 918
368 Ga0451804_0154004 3300041463 Bacteria 530
369 Ga0451807_0809441 3300041486 Bacteria 503
370 Ga0451807_1225447 3300041486 Bacteria 533
371 Ga0451853_1935145 3300041512 Bacteria 1953
372 Ga0466966_0010653 3300044684 Bacteria 6112
373 Ga0466966_0405085 3300044684 Bacteria 820
374 Ga0466961_0425249 3300044693 Bacteria 805
375 Ga0466963_0026387 3300044694 Bacteria 3715
376 Ga0466968_0042988 3300044735 Unclassified 1912
377 Ga0466968_0607287 3300044735 Bacteria 553
378 Ga0466957_0263987 3300044842 Bacteria 1148
379 Ga0466960_0013201 3300044901 Bacteria 3504
380 Ga0466959_0343428 3300045049 Bacteria 1018
381 Ga0466958_0595228 3300045836 Bacteria 719
382 Ga0466967_0693276 3300045976 Bacteria 1008
383 Ga0466967_0900261 3300045976 Bacteria 880
384 Ga0466967_1713136 3300045976 Bacteria 626
385 Ga0466967_2439165 3300045976 Bacteria 518
386 Ga0495592_0000070 3300046454 Bacteria 93255
387 Ga0495592_0003134 3300046454 Bacteria 11815
388 Ga0495592_0014732 3300046454 Bacteria 5936
389 Ga0495592_0234977 3300046454 Bacteria 1219
390 Ga0495603_0067657 3300046455 Bacteria 2102
391 Ga0495603_0499556 3300046455 Bacteria 697
392 Ga0495603_0559309 3300046455 Bacteria 655
393 Ga0495629_0030737 3300046459 Bacteria 3805
394 Ga0495629_0039999 3300046459 Bacteria 3299
395 Ga0495629_0618315 3300046459 Bacteria 723
396 Ga0495641_0020248 3300046461 Bacteria 3379
397 Ga0495641_0313697 3300046461 Bacteria 707
398 Ga0495651_0000042 3300046462 Bacteria 93255
399 Ga0495651_0003630 3300046462 Bacteria 11819
400 Ga0495651_0012020 3300046462 Bacteria 6663
401 Ga0495651_0049562 3300046462 Bacteria 3241
402 Ga0495651_0190856 3300046462 Bacteria 1442
403 Ga0495651_0730029 3300046462 Bacteria 615
404 Ga0495653_0001451 3300046463 Bacteria 18502
405 Ga0495653_0026604 3300046463 Bacteria 4636
406 Ga0495653_0160683 3300046463 Bacteria 1560
407 Ga0495653_0226547 3300046463 Bacteria 1253
408 Ga0495582_0016987 3300046473 Bacteria 3984
409 Ga0495582_0227140 3300046473 Bacteria 1069
410 Ga0495582_0728326 3300046473 Unclassified 574
411 Ga0495662_0011166 3300046476 Bacteria 4389
412 Ga0495662_0067476 3300046476 Bacteria 1731
413 Ga0495664_0070349 3300046477 Bacteria 2090
414 Ga0495664_0101446 3300046477 Bacteria 1734
415 Ga0495585_0104256 3300046492 Bacteria 1514
416 Ga0495596_0127048 3300046500 Bacteria 990
417 Ga0495608_0000054 3300046511 Bacteria 93255
418 Ga0495608_0002527 3300046511 Bacteria 13114
419 Ga0495608_0038630 3300046511 Bacteria 3204
420 Ga0495608_0104340 3300046511 Bacteria 1826
421 Ga0495618_0044331 3300046514 Bacteria 2805
422 Ga0495618_0199374 3300046514 Bacteria 1267
423 Ga0495618_0246839 3300046514 Bacteria 1121
424 Ga0495628_0000106 3300046516 Bacteria 67965
425 Ga0495628_0015941 3300046516 Bacteria 6270
426 Ga0495628_0035322 3300046516 Bacteria 4018
427 Ga0495628_0046405 3300046516 Bacteria 3451
428 Ga0495628_0601187 3300046516 Bacteria 785
429 Ga0495630_0022949 3300046517 Bacteria 4610
430 Ga0495630_0090004 3300046517 Bacteria 2318
431 Ga0495630_0494596 3300046517 Bacteria 938
432 Ga0495663_0230143 3300046525 Bacteria 654
433 Ga0495652_0000119 3300046529 Bacteria 85582
434 Ga0495652_0051433 3300046529 Bacteria 3518
435 Ga0495652_0054950 3300046529 Bacteria 3388
436 Ga0495652_0268712 3300046529 Bacteria 1254
437 Ga0495652_0312299 3300046529 Bacteria 1138
438 Ga0495652_0329572 3300046529 Bacteria 1100
439 Ga0495652_0810156 3300046529 Bacteria 623
440 Ga0495665_0030193 3300046531 Bacteria 2901
441 Ga0495640_0014429 3300046533 Bacteria 5979
442 Ga0495640_0132962 3300046533 Bacteria 1609
443 Ga0495640_0175834 3300046533 Bacteria 1366
444 Ga0495587_0000374 3300046536 Bacteria 31849
445 Ga0495587_0008051 3300046536 Bacteria 6799
446 Ga0495587_0017553 3300046536 Bacteria 4445
447 Ga0495587_0048418 3300046536 Bacteria 2517
448 Ga0495645_0026920 3300046543 Bacteria 4176
449 Ga0495645_0090333 3300046543 Bacteria 2189
450 Ga0495645_0104247 3300046543 Bacteria 2014
451 Ga0495645_0180355 3300046543 Bacteria 1447
452 Ga0495645_0270486 3300046543 Bacteria 1122
453 Ga0495645_0680857 3300046543 Bacteria 626
454 Ga0495667_0000114 3300046559 Bacteria 58520
455 Ga0495667_0008763 3300046559 Bacteria 6875
456 Ga0495667_0046045 3300046559 Bacteria 2885
457 Ga0495667_0095608 3300046559 Bacteria 1923
458 Ga0495634_0011961 3300046642 Bacteria 6296
459 Ga0495634_0014099 3300046642 Bacteria 5770
460 Ga0495634_0214650 3300046642 Bacteria 1190
461 Ga0495625_0159175 3300046660 Bacteria 1514
462 Ga0495635_0018710 3300046663 Bacteria 4832
463 Ga0495635_0060808 3300046663 Bacteria 2595
464 Ga0495588_0041764 3300046674 Bacteria 2343
465 Ga0495657_0000067 3300046675 Bacteria 93255
466 Ga0495657_0016641 3300046675 Bacteria 5353
467 Ga0495657_0043884 3300046675 Bacteria 3045
468 Ga0495657_0060403 3300046675 Bacteria 2511
469 Ga0495657_0097554 3300046675 Bacteria 1876
470 Ga0495657_0524684 3300046675 Bacteria 689
471 Ga0495599_0000042 3300046678 Bacteria 94912
472 Ga0495599_0014633 3300046678 Bacteria 4858
473 Ga0495599_0176207 3300046678 Bacteria 1318
474 Ga0495599_0392079 3300046678 Unclassified 828
475 Ga0495623_0000522 3300046679 Bacteria 25418
476 Ga0495623_0027933 3300046679 Bacteria 3632
477 Ga0495623_0236141 3300046679 Bacteria 1035
478 Ga0495646_0015534 3300046680 Bacteria 4831
479 Ga0495646_0016721 3300046680 Bacteria 4658
480 Ga0495658_0103571 3300046683 Bacteria 1702
481 Ga0495658_0479646 3300046683 Bacteria 795
482 Ga0495669_0145372 3300046684 Bacteria 1121
483 Ga0495613_0005882 3300046689 Bacteria 9181
484 Ga0495613_0055982 3300046689 Bacteria 2896
485 Ga0495613_0253111 3300046689 Bacteria 1229
486 Ga0495613_0327794 3300046689 Bacteria 1056
487 Ga0495624_0052665 3300046690 Bacteria 2571
488 Ga0495624_0094122 3300046690 Bacteria 1847
489 Ga0495624_0485526 3300046690 Bacteria 739
490 Ga0495600_0030439 3300046809 Bacteria 3496
491 Ga0495600_0044481 3300046809 Bacteria 2897
492 Ga0495600_0051012 3300046809 Bacteria 2700
493 Ga0495600_0065499 3300046809 Bacteria 2375
494 Ga0495600_0324947 3300046809 Bacteria 967
495 Ga0495600_0724139 3300046809 Bacteria 597
496 Ga0495581_0051991 3300047315 Bacteria 2366
497 Ga0495604_0000121 3300047317 Bacteria 65991
498 Ga0495604_0019477 3300047317 Bacteria 5431
499 Ga0495604_0023212 3300047317 Bacteria 4950
500 Ga0495604_0237587 3300047317 Bacteria 1247
501 Ga0495674_0056198 3300047319 Bacteria 3448
502 Ga0495674_0115068 3300047319 Bacteria 2277
503 Ga0495674_0862777 3300047319 Bacteria 701
504 Ga0495674_0885082 3300047319 Bacteria 690
505 Ga0495672_0394597 3300047320 Bacteria 634
506 Ga0495676_0023733 3300047321 Bacteria 5318
507 Ga0495676_0320891 3300047321 Bacteria 1041
508 Ga0495680_0000054 3300047322 Bacteria 93244
509 Ga0495680_0008382 3300047322 Bacteria 9400
510 Ga0495680_0041121 3300047322 Bacteria 3676
511 Ga0495680_0093176 3300047322 Bacteria 2255
512 Ga0495680_0450370 3300047322 Bacteria 881
513 Ga0495675_0000346 3300047444 Bacteria 32587
514 Ga0495675_0010975 3300047444 Bacteria 5678
515 Ga0495675_0044283 3300047444 Bacteria 2835
516 Ga0495675_0072674 3300047444 Bacteria 2170
517 Ga0495684_0020047 3300047471 Bacteria 5151
518 Ga0495684_0184075 3300047471 Bacteria 1547
519 Ga0495684_0244152 3300047471 Bacteria 1309
520 Ga0495684_0717379 3300047471 Bacteria 661
521 Ga0495593_0015873 3300047673 Bacteria 4255
522 Ga0495602_0000083 3300048088 Bacteria 93242
523 Ga0495602_0065498 3300048088 Bacteria 3136
524 Ga0495602_0072856 3300048088 Bacteria 2926
525 Ga0495602_0258709 3300048088 Bacteria 1292
526 Ga0495614_0059791 3300048089 Bacteria 1637
527 Ga0495614_0187102 3300048089 Bacteria 933
528 Ga0496100_0041690 3300048903 Bacteria 2928
529 Ga0496100_0119400 3300048903 Unclassified 1842
530 Ga0496100_0340247 3300048903 Bacteria 1131
531 Ga0496100_0805666 3300048903 Bacteria 736
532 Ga0496101_0028100 3300048904 Bacteria 3924
533 Ga0496101_0379396 3300048904 Bacteria 1112
534 Ga0496101_0557165 3300048904 Bacteria 906
535 Ga0496101_0873774 3300048904 Bacteria 708
536 Ga0496102_0076533 3300048905 Bacteria 3078
537 Ga0496102_0435305 3300048905 Bacteria 1231
538 Ga0496102_0778067 3300048905 Bacteria 880
539 Ga0496102_0812104 3300048905 Bacteria 857
540 Ga0496102_0829667 3300048905 Bacteria 847
541 Ga0496102_1061769 3300048905 Unclassified 730
542 Ga0496103_0606656 3300048906 Bacteria 697
543 Ga0496104_0000804 3300048907 Bacteria 27002
544 Ga0496104_0000853 3300048907 Bacteria 26359
545 Ga0496104_0248266 3300048907 Bacteria 1692
546 Ga0496104_0774636 3300048907 Bacteria 866
547 Ga0496105_0000546 3300048908 Bacteria 24815
548 Ga0496105_0001245 3300048908 Bacteria 17776
549 Ga0496105_0006415 3300048908 Bacteria 9043
550 Ga0496105_0010038 3300048908 Bacteria 7431
551 Ga0496106_1061990 3300048909 Bacteria 635
552 Ga0496107_0041664 3300048910 Bacteria 3298
553 Ga0496108_0005112 3300048911 Bacteria 10603
554 Ga0496108_0067554 3300048911 Bacteria 3015
555 Ga0496108_0081459 3300048911 Bacteria 2743
556 Ga0496108_0081617 3300048911 Bacteria 2740
557 Ga0496108_0565417 3300048911 Bacteria 992
558 Ga0496109_0000564 3300048912 Bacteria 30941
559 Ga0496109_0147849 3300048912 Bacteria 2199
560 Ga0496109_0177386 3300048912 Bacteria 2000
561 Ga0496109_0216968 3300048912 Bacteria 1799
562 Ga0496109_0290834 3300048912 Bacteria 1540
563 Ga0496109_0331666 3300048912 Bacteria 1436
564 Ga0496109_0346822 3300048912 Bacteria 1402
565 Ga0496109_0842354 3300048912 Bacteria 855
566 Ga0496109_1397139 3300048912 Bacteria 635
567 Ga0496110_0123530 3300048913 Bacteria 2334
568 Ga0496110_0124762 3300048913 Unclassified 2322
569 Ga0496110_0140349 3300048913 Bacteria 2185
570 Ga0496110_0175133 3300048913 Bacteria 1947
571 Ga0496110_0175376 3300048913 Bacteria 1946
572 Ga0496110_1073376 3300048913 Bacteria 713
573 Ga0496110_1618654 3300048913 Bacteria 558
574 Ga0496111_0000683 3300048914 Bacteria 17861
575 Ga0496112_0000898 3300048915 Bacteria 21435
576 Ga0496112_0113522 3300048915 Bacteria 2680
577 Ga0496112_0144405 3300048915 Bacteria 2348
578 Ga0496112_0253177 3300048915 Bacteria 1712
579 Ga0496112_0975386 3300048915 Unclassified 768
580 Ga0496113_0063551 3300048916 Bacteria 2790
581 Ga0496113_0148076 3300048916 Bacteria 1851
582 Ga0496113_0238131 3300048916 Bacteria 1452
583 Ga0496113_1038435 3300048916 Bacteria 644
584 Ga0496114_0000763 3300048917 Bacteria 24039
585 Ga0496114_0159321 3300048917 Bacteria 1961
586 Ga0496114_0182689 3300048917 Bacteria 1832
587 Ga0496114_0233123 3300048917 Unclassified 1618
588 Ga0496114_0255951 3300048917 Bacteria 1541
589 Ga0496114_0290206 3300048917 Unclassified 1443
590 Ga0496114_0466051 3300048917 Bacteria 1118
591 Ga0496114_0903567 3300048917 Bacteria 764
592 Ga0496114_1018496 3300048917 Bacteria 712
593 Ga0496115_0045687 3300048918 Bacteria 3497
594 Ga0496115_0099025 3300048918 Bacteria 2388
595 Ga0496118_0461186 3300048921 Unclassified 642
596 Ga0496120_0014507 3300048923 Bacteria 5249
597 Ga0501031_0000818 3300049568 Bacteria 18716
598 Ga0501031_0011134 3300049568 Bacteria 5861
599 Ga0501031_1021216 3300049568 Bacteria 528
600 Ga0501032_0000978 3300049569 Bacteria 23112
601 Ga0501032_0012449 3300049569 Bacteria 6078
602 Ga0501032_0168353 3300049569 Bacteria 1437
603 Ga0501032_0473636 3300049569 Bacteria 801
604 Ga0501033_0001418 3300049570 Bacteria 21283
605 Ga0501033_0011843 3300049570 Bacteria 6667
606 Ga0501034_0003564 3300049571 Bacteria 17672
607 Ga0501034_0017200 3300049571 Bacteria 7417
608 Ga0501034_1527960 3300049571 Bacteria 541
609 Ga0501036_0010755 3300049572 Bacteria 7565
610 Ga0501036_0039610 3300049572 Bacteria 3987
611 Ga0501036_0676956 3300049572 Bacteria 853
612 Ga0501037_0002882 3300049573 Bacteria 12471
613 Ga0501037_0008604 3300049573 Bacteria 7485
614 Ga0501037_0032786 3300049573 Bacteria 3837
615 Ga0501037_0089054 3300049573 Bacteria 2234
616 Ga0501038_0000501 3300049574 Bacteria 34383
617 Ga0501038_0013575 3300049574 Bacteria 7422
618 Ga0501038_0113494 3300049574 Bacteria 2242
619 Ga0501039_0004987 3300049575 Bacteria 10073
620 Ga0501039_0005351 3300049575 Bacteria 9709
621 Ga0501039_0394154 3300049575 Bacteria 1087
622 Ga0501042_0052390 3300049578 Bacteria 2911
623 Ga0501043_0001130 3300049579 Bacteria 23419
624 Ga0501043_0031070 3300049579 Bacteria 4200
625 Ga0501043_0215715 3300049579 Bacteria 1486
626 Ga0501046_0002038 3300049580 Bacteria 19203
627 Ga0501046_0004866 3300049580 Bacteria 12100
628 Ga0501046_0028839 3300049580 Bacteria 4516
629 Ga0501047_0006489 3300049581 Bacteria 11008
630 Ga0501047_0023766 3300049581 Bacteria 5884
631 Ga0501047_1201407 3300049581 Bacteria 572
632 Ga0501048_0000474 3300049582 Bacteria 28128
633 Ga0501048_0007929 3300049582 Bacteria 8044
634 Ga0501067_0029067 3300049583 Bacteria 3064
635 Ga0501067_0166411 3300049583 Bacteria 1228
636 Ga0501068_0070837 3300049584 Bacteria 2127
637 Ga0501068_0201700 3300049584 Bacteria 1261
638 Ga0501069_0014299 3300049585 Bacteria 4241
639 Ga0501070_0001907 3300049586 Bacteria 18439
640 Ga0501070_0011322 3300049586 Bacteria 7537
641 Ga0501070_0225520 3300049586 Bacteria 1536
642 Ga0501070_1354410 3300049586 Bacteria 542
643 Ga0501072_0854295 3300049588 Bacteria 712
644 Ga0501073_0007439 3300049589 Bacteria 8140
645 Ga0501074_0014483 3300049590 Bacteria 5738
646 Ga0501074_0082553 3300049590 Bacteria 2304
647 Ga0501080_0002944 3300049742 Bacteria 14965
648 Ga0501083_0001473 3300049744 Bacteria 16087
649 Ga0501035_0002308 3300049822 Bacteria 18823
650 Ga0501035_0004669 3300049822 Bacteria 13005
651 Ga0501044_0016708 3300049823 Bacteria 7878
652 Ga0501044_0045026 3300049823 Bacteria 4575
653 Ga0501044_0356011 3300049823 Bacteria 1382
654 Ga0501045_0023437 3300049824 Bacteria 4425
655 Ga0501045_0386204 3300049824 Bacteria 1042
656 nmdc:mga0rr50_23983_c1 3300050513 Bacteria 4219
657 Ga0495601_0009537 3300053077 Bacteria 5747
658 Ga0495601_0036879 3300053077 Bacteria 3055
659 Ga0495601_0091862 3300053077 Bacteria 1954
660 Ga0495601_0516622 3300053077 Bacteria 770
661 Ga0495601_0588530 3300053077 Bacteria 714
662 Ga0495612_0036041 3300053078 Bacteria 2007
663 Ga0495612_0064129 3300053078 Bacteria 1524
664 Ga0495595_0025398 3300053084 Bacteria 2625
665 Ga0495595_0028131 3300053084 Bacteria 2509
666 Ga0495595_0040959 3300053084 Bacteria 2118
667 Ga0495619_0108773 3300053085 Bacteria 1892
668 Ga0495619_0160348 3300053085 Bacteria 1553
669 Ga0495619_0209639 3300053085 Bacteria 1349
670 Ga0500556_0000204 3300053104 Bacteria 48558
671 Ga0500593_001484 3300053117 Bacteria 8442
672 Ga0500616_0000081 3300053153 Bacteria 199653
673 Ga0501084_0032552 3300054114 Bacteria 4361
674 Ga0587073_0041641 3300059492 Bacteria 1004
675 Ga0530510_1513615 3300061734 Bacteria 515
676 2676477495 2675903058 Bacteria 6822861
677 2819426916 2818991318 Bacteria 5266538
678 2827634752 2827628540 Bacteria 6858585
679 2858854772 2858848962 Bacteria 6963058
680 2858893017 2858888857 Bacteria 7060307
681 2880496921 2880495981 Bacteria 7340502
682 2946033574 2946033335 Bacteria 3835514
683 8054734501 8054727385 Bacteria 7558670
684 Ga0495628_0771279
685 JGI25404J52841_10003782
686 Ga0070683_100005393
687 Ga0070683_100021347
688 Ga0070683_100055211
689 Ga0070683_100580946
690 Ga0070680_100069290
691 Ga0070682_100180085
692 Ga0070660_100120063
693 Ga0070691_10006793
694 Ga0070661_100036685
695 Ga0070661_100048252
696 Ga0070668_100875321
697 Ga0070669_101431795
698 Ga0070675_100785942
699 Ga0070674_100239388
700 Ga0070688_100364174
701 Ga0070659_100366584
702 Ga0070659_101624777
703 Ga0070709_10080940
704 Ga0070709_10096958
705 Ga0070714_100001437
706 Ga0070714_100033972
707 Ga0070714_100073913
708 Ga0070714_100139755
709 Ga0070714_100286558
710 Ga0070714_100352097
711 Ga0070714_100878953
712 Ga0070713_100000286
713 Ga0070713_100058288
714 Ga0070713_100071625
715 Ga0070713_100115163
716 Ga0070713_100116418
717 Ga0070713_100594447
718 Ga0070713_100888683
719 Ga0070713_102158319
720 Ga0070710_10029543
721 Ga0070710_10098962
722 Ga0070710_10184799
723 Ga0070701_10255188
724 Ga0070711_100018538
725 Ga0070711_100095715
726 Ga0070711_100200279
727 Ga0070705_100166346
728 Ga0070694_100044594
729 Ga0070694_100271529
730 Ga0070708_100000274
731 Ga0070708_100316797
732 Ga0070708_100389848
733 Ga0070708_100574619
734 Ga0070663_101975217
735 Ga0070681_10093222
736 Ga0070706_100011662
737 Ga0070706_100189864
738 Ga0070706_100292693
739 Ga0070706_101023268
740 Ga0070707_100024443
741 Ga0070707_100118160
742 Ga0070707_100186887
743 Ga0070707_100218182
744 Ga0070707_100554992
745 Ga0070707_100980410
746 Ga0070707_101445683
747 Ga0070698_100014396
748 Ga0070698_100017553
749 Ga0070698_100126953
750 Ga0070698_100128913
751 Ga0070698_100156240
752 Ga0070698_100182180
753 Ga0070698_101341625
754 Ga0070698_102133477
755 Ga0070699_100000462
756 Ga0070699_100005603
757 Ga0070699_100364329
758 Ga0070699_101399654
759 Ga0070679_100070794
760 Ga0070679_100256179
761 Ga0070684_100000509
762 Ga0070684_100011478
763 Ga0070684_100744829
764 Ga0070697_100000066
765 Ga0070697_100148834
766 Ga0070697_100571766
767 Ga0070697_101119128
768 Ga0070697_101598789
769 Ga0068853_100494557
770 Ga0070672_100318393
771 Ga0070672_102111667
772 Ga0070695_100095470
773 Ga0070695_100121999
774 Ga0070695_100935674
775 Ga0070696_100213742
776 Ga0070696_100722734
777 Ga0070696_101077176
778 Ga0070704_100090956
779 Ga0068855_100062969
780 Ga0070664_100184586
781 Ga0070664_100465596
782 Ga0070664_100633340
783 Ga0070664_101646996
784 Ga0070664_101923217
785 Ga0068857_100002126
786 Ga0068857_100048017
787 Ga0068857_100520689
788 Ga0068854_101827724
789 Ga0068856_100005240
790 Ga0068856_100049542
791 Ga0068856_100075252
792 Ga0068856_100211992
793 Ga0068852_100151209
794 Ga0068859_100302931
795 Ga0068859_101870311
796 Ga0068859_102034610
797 Ga0068864_100146009
798 Ga0068866_10430482
799 Ga0068861_100169638
800 Ga0068861_101208828
801 Ga0068870_10023318
802 Ga0068870_10316232
803 Ga0068870_11449798
804 Ga0068860_100155501
805 Ga0081540_1000171
806 Ga0070717_10152497
807 Ga0070717_10168312
808 Ga0070717_10381085
809 Ga0070717_11041001
810 Ga0075365_10109792
811 Ga0070715_10422775
812 Ga0070716_100037924
813 Ga0070716_100039016
814 Ga0070716_100044765
815 Ga0070716_100441106
816 Ga0070716_101116414
817 Ga0070712_100011245
818 Ga0070712_100093408
819 Ga0070712_100101296
820 Ga0070712_100348445
821 Ga0070712_101047872
822 Ga0070712_101154473
823 Ga0070712_101241736
824 Ga0097621_100195076
825 Ga0097621_102040862
826 Ga0068871_100297651
827 Ga0075434_101061722
828 Ga0097620_100302939
829 Ga0097620_101869990
830 Ga0097620_102034896
831 Ga0075435_100228888
832 Ga0099795_10042712
833 Ga0105245_10385211
834 Ga0105245_10474687
835 Ga0105245_10951224
836 Ga0105245_11576469
837 Ga0105247_10659598
838 Ga0105247_11692135
839 Ga0114129_12328438
840 Ga0114129_12690765
841 Ga0105241_10206022
842 Ga0105242_10189015
843 Ga0105242_12193553
844 Ga0105237_11554262
845 Ga0105238_12313288
846 Ga0105249_10195848
847 Ga0105239_10524623
848 Ga0105246_10719669
849 Ga0157370_10019427
850 Ga0157369_10006208
851 Ga0157369_10574716
852 Ga0163162_13066598
853 Ga0157372_10095283
854 Ga0157372_10649356
855 Ga0157375_11846201
856 Ga0157375_12072156
857 Ga0182008_10169650
858 Ga0157377_11444885
859 Ga0157377_11746775
860 Ga0157376_10300424
861 Ga0157376_11360474
862 Ga0157376_11625027
863 Ga0182006_1214162
864 Ga0206356_10439586
865 Ga0206354_10671847
866 Ga0206353_11740502
867 Ga0207653_10016844
868 Ga0207653_10140614
869 Ga0207692_10033668
870 Ga0207692_10074920
871 Ga0207688_10029581
872 Ga0207688_10249864
873 Ga0207680_10185821
874 Ga0207685_10008037
875 Ga0207699_10006744
876 Ga0207699_10027013
877 Ga0207699_10168367
878 Ga0207699_10359462
879 Ga0207643_10089068
880 Ga0207643_10715827
881 Ga0207705_10052590
882 Ga0207705_10150303
883 Ga0207705_10369260
884 Ga0207684_10004102
885 Ga0207684_10005909
886 Ga0207684_10189048
887 Ga0207684_10368208
888 Ga0207684_10686815
889 Ga0207707_10061387
890 Ga0207671_11030759
891 Ga0207693_10009068
892 Ga0207693_10160748
893 Ga0207693_10177530
894 Ga0207663_10017987
895 Ga0207663_10273339
896 Ga0207660_10098263
897 Ga0207662_10156940
898 Ga0207657_10001447
899 Ga0207657_10324153
900 Ga0207649_10252773
901 Ga0207649_10733770
902 Ga0207652_10138134
903 Ga0207652_10138426
904 Ga0207652_10201979
905 Ga0207646_10022896
906 Ga0207646_10024338
907 Ga0207646_10213065
908 Ga0207646_10303679
909 Ga0207646_10471437
910 Ga0207646_10755244
911 Ga0207694_10297121
912 Ga0207694_11325926
913 Ga0207659_10443682
914 Ga0207687_10330460
915 Ga0207687_11015725
916 Ga0207700_10003119
917 Ga0207700_10020216
918 Ga0207700_10153502
919 Ga0207700_10281731
920 Ga0207700_10316660
921 Ga0207700_10557800
922 Ga0207700_11091979
923 Ga0207664_10000986
924 Ga0207664_10004184
925 Ga0207664_10017423
926 Ga0207664_10025336
927 Ga0207664_10026847
928 Ga0207664_10052261
929 Ga0207664_10296481
930 Ga0207664_10301296
931 Ga0207664_10911977
932 Ga0207644_10353487
933 Ga0207690_10163739
934 Ga0207690_10404811
935 Ga0207686_11452800
936 Ga0207670_10322567
937 Ga0207704_10514800
938 Ga0207665_10058311
939 Ga0207665_10086156
940 Ga0207665_10133191
941 Ga0207661_10000793
942 Ga0207661_10026245
943 Ga0207661_10182192
944 Ga0207661_10381091
945 Ga0207661_11215973
946 Ga0207661_11378841
947 Ga0207679_10105376
948 Ga0207679_10287121
949 Ga0207679_10454692
950 Ga0207667_10077606
951 Ga0207667_10109180
952 Ga0207651_10744132
953 Ga0207712_10292050
954 Ga0207668_10352083
955 Ga0207668_10804932
956 Ga0207640_11778802
957 Ga0207658_11135342
958 Ga0207639_10233301
959 Ga0207639_11097737
960 Ga0207678_10011014
961 Ga0207702_10006333
962 Ga0207702_10125739
963 Ga0207702_10133944
964 Ga0207702_10192316
965 Ga0207702_10671742
966 Ga0207702_10735197
967 Ga0207641_10104440
968 Ga0207648_11026449
969 Ga0207676_10707987
970 Ga0207674_10003127
971 Ga0207674_10006750
972 Ga0207683_11479697
973 Ga0207698_10826607
974 Ga0207428_10279271
975 Ga0268266_11983386
976 Ga0268265_10925861
977 Ga0307513_10558210
978 Ga0307410_10088753
979 Ga0307409_100042694
980 Ga0307416_100707390
981 Ga0307414_11447615
982 Ga0307411_10637262
983 Ga0373930_0016066
984 Ga0373948_0007419
985 Ga0373959_0016278
986 Ga0373926_0058659
987 Ga0373926_0186848
988 Ga0373928_0232114
989 Ga0373929_0067888
990 Ga0373934_0000021
991 Ga0373934_0006828
992 Ga0373940_0070094
993 Ga0373949_0024138
994 Ga0373952_0170649
995 Ga0373923_0016071
996 Ga0373923_0034245
997 Ga0373923_0539027
998 Ga0373932_0252755
999 Ga0373932_0423375
1000 Ga0373939_0019357
1001 Ga0373945_0062214
1002 Ga0373953_0001230
1003 Ga0373953_0049891
1004 Ga0373953_0112494
1005 Ga0373954_0002755
1006 Ga0373954_0173025
1007 Ga0373954_0219299
1008 Ga0373956_0000073
1009 Ga0373956_0014378
1010 Ga0373956_0177128
1011 Ga0373957_0000110
1012 Ga0373957_0024169
1013 Ga0373943_0041453
1014 Ga0373946_0216949
1015 Ga0373955_0000125
1016 Ga0373955_0001874
1017 Ga0373942_0016843
1018 Ga0373962_0055967
1019 Ga0373924_0060042
1020 Ga0373931_0202489
1021 Ga0373935_0017286
1022 Ga0373935_0495400
1023 Ga0373927_0152684
1024 Ga0373933_0000366
1025 Ga0373933_0023485
1026 Ga0373933_0078263
1027 Ga0373933_0277177
1028 Ga0373933_0549577
1029 Ga0373947_0577817
1030 Ga0373937_0000169
1031 Ga0373937_0029491
1032 Ga0373937_0212526
1033 Ga0373937_0250037
1034 Ga0373925_0037556
1035 Ga0395899_0688112
1036 Ga0395900_0197472
1037 Ga0395898_0203310
1038 Ga0395898_0281811
1039 Ga0395905_0158448
1040 Ga0395905_0832995
1041 Ga0395901_0025177
1042 Ga0395901_0081949
1043 Ga0395901_0249073
1044 Ga0395901_0489977
1045 Ga0242420_006955
1046 Ga0451793_0340383
1047 Ga0451793_1106976
1048 Ga0451795_0318555
1049 Ga0451802_0748016
1050 Ga0451802_1480458
1051 Ga0451804_0154004
1052 Ga0451807_0809441
1053 Ga0451807_1225447
1054 Ga0451853_1935145
1055 Ga0466966_0010653
1056 Ga0466966_0405085
1057 Ga0466961_0425249
1058 Ga0466963_0026387
1059 Ga0466968_0042988
1060 Ga0466968_0607287
1061 Ga0466957_0263987
1062 Ga0466960_0013201
1063 Ga0466959_0343428
1064 Ga0466958_0595228
1065 Ga0466967_0693276
1066 Ga0466967_0900261
1067 Ga0466967_1713136
1068 Ga0466967_2439165
1069 Ga0495592_0000070
1070 Ga0495592_0003134
1071 Ga0495592_0014732
1072 Ga0495592_0234977
1073 Ga0495603_0067657
1074 Ga0495603_0499556
1075 Ga0495603_0559309
1076 Ga0495629_0030737
1077 Ga0495629_0039999
1078 Ga0495629_0618315
1079 Ga0495641_0020248
1080 Ga0495641_0313697
1081 Ga0495651_0000042
1082 Ga0495651_0003630
1083 Ga0495651_0012020
1084 Ga0495651_0049562
1085 Ga0495651_0190856
1086 Ga0495651_0730029
1087 Ga0495653_0001451
1088 Ga0495653_0026604
1089 Ga0495653_0160683
1090 Ga0495653_0226547
1091 Ga0495582_0016987
1092 Ga0495582_0227140
1093 Ga0495582_0728326
1094 Ga0495662_0011166
1095 Ga0495662_0067476
1096 Ga0495664_0070349
1097 Ga0495664_0101446
1098 Ga0495585_0104256
1099 Ga0495596_0127048
1100 Ga0495608_0000054
1101 Ga0495608_0002527
1102 Ga0495608_0038630
1103 Ga0495608_0104340
1104 Ga0495618_0044331
1105 Ga0495618_0199374
1106 Ga0495618_0246839
1107 Ga0495628_0000106
1108 Ga0495628_0015941
1109 Ga0495628_0035322
1110 Ga0495628_0046405
1111 Ga0495628_0601187
1112 Ga0495630_0022949
1113 Ga0495630_0090004
1114 Ga0495630_0494596
1115 Ga0495663_0230143
1116 Ga0495652_0000119
1117 Ga0495652_0051433
1118 Ga0495652_0054950
1119 Ga0495652_0268712
1120 Ga0495652_0312299
1121 Ga0495652_0329572
1122 Ga0495652_0810156
1123 Ga0495665_0030193
1124 Ga0495640_0014429
1125 Ga0495640_0132962
1126 Ga0495640_0175834
1127 Ga0495587_0000374
1128 Ga0495587_0008051
1129 Ga0495587_0017553
1130 Ga0495587_0048418
1131 Ga0495645_0026920
1132 Ga0495645_0090333
1133 Ga0495645_0104247
1134 Ga0495645_0180355
1135 Ga0495645_0270486
1136 Ga0495645_0680857
1137 Ga0495667_0000114
1138 Ga0495667_0008763
1139 Ga0495667_0046045
1140 Ga0495667_0095608
1141 Ga0495634_0011961
1142 Ga0495634_0014099
1143 Ga0495634_0214650
1144 Ga0495625_0159175
1145 Ga0495635_0018710
1146 Ga0495635_0060808
1147 Ga0495588_0041764
1148 Ga0495657_0000067
1149 Ga0495657_0016641
1150 Ga0495657_0043884
1151 Ga0495657_0060403
1152 Ga0495657_0097554
1153 Ga0495657_0524684
1154 Ga0495599_0000042
1155 Ga0495599_0014633
1156 Ga0495599_0176207
1157 Ga0495599_0392079
1158 Ga0495623_0000522
1159 Ga0495623_0027933
1160 Ga0495623_0236141
1161 Ga0495646_0015534
1162 Ga0495646_0016721
1163 Ga0495658_0103571
1164 Ga0495658_0479646
1165 Ga0495669_0145372
1166 Ga0495613_0005882
1167 Ga0495613_0055982
1168 Ga0495613_0253111
1169 Ga0495613_0327794
1170 Ga0495624_0052665
1171 Ga0495624_0094122
1172 Ga0495624_0485526
1173 Ga0495600_0030439
1174 Ga0495600_0044481
1175 Ga0495600_0051012
1176 Ga0495600_0065499
1177 Ga0495600_0324947
1178 Ga0495600_0724139
1179 Ga0495581_0051991
1180 Ga0495604_0000121
1181 Ga0495604_0019477
1182 Ga0495604_0023212
1183 Ga0495604_0237587
1184 Ga0495674_0056198
1185 Ga0495674_0115068
1186 Ga0495674_0862777
1187 Ga0495674_0885082
1188 Ga0495672_0394597
1189 Ga0495676_0023733
1190 Ga0495676_0320891
1191 Ga0495680_0000054
1192 Ga0495680_0008382
1193 Ga0495680_0041121
1194 Ga0495680_0093176
1195 Ga0495680_0450370
1196 Ga0495675_0000346
1197 Ga0495675_0010975
1198 Ga0495675_0044283
1199 Ga0495675_0072674
1200 Ga0495684_0020047
1201 Ga0495684_0184075
1202 Ga0495684_0244152
1203 Ga0495684_0717379
1204 Ga0495593_0015873
1205 Ga0495602_0000083
1206 Ga0495602_0065498
1207 Ga0495602_0072856
1208 Ga0495602_0258709
1209 Ga0495614_0059791
1210 Ga0495614_0187102
1211 Ga0496100_0041690
1212 Ga0496100_0119400
1213 Ga0496100_0340247
1214 Ga0496100_0805666
1215 Ga0496101_0028100
1216 Ga0496101_0379396
1217 Ga0496101_0557165
1218 Ga0496101_0873774
1219 Ga0496102_0076533
1220 Ga0496102_0435305
1221 Ga0496102_0778067
1222 Ga0496102_0812104
1223 Ga0496102_0829667
1224 Ga0496102_1061769
1225 Ga0496103_0606656
1226 Ga0496104_0000804
1227 Ga0496104_0000853
1228 Ga0496104_0248266
1229 Ga0496104_0774636
1230 Ga0496105_0000546
1231 Ga0496105_0001245
1232 Ga0496105_0006415
1233 Ga0496105_0010038
1234 Ga0496106_1061990
1235 Ga0496107_0041664
1236 Ga0496108_0005112
1237 Ga0496108_0067554
1238 Ga0496108_0081459
1239 Ga0496108_0081617
1240 Ga0496108_0565417
1241 Ga0496109_0000564
1242 Ga0496109_0147849
1243 Ga0496109_0177386
1244 Ga0496109_0216968
1245 Ga0496109_0290834
1246 Ga0496109_0331666
1247 Ga0496109_0346822
1248 Ga0496109_0842354
1249 Ga0496109_1397139
1250 Ga0496110_0123530
1251 Ga0496110_0124762
1252 Ga0496110_0140349
1253 Ga0496110_0175133
1254 Ga0496110_0175376
1255 Ga0496110_1073376
1256 Ga0496110_1618654
1257 Ga0496111_0000683
1258 Ga0496112_0000898
1259 Ga0496112_0113522
1260 Ga0496112_0144405
1261 Ga0496112_0253177
1262 Ga0496112_0975386
1263 Ga0496113_0063551
1264 Ga0496113_0148076
1265 Ga0496113_0238131
1266 Ga0496113_1038435
1267 Ga0496114_0000763
1268 Ga0496114_0159321
1269 Ga0496114_0182689
1270 Ga0496114_0233123
1271 Ga0496114_0255951
1272 Ga0496114_0290206
1273 Ga0496114_0466051
1274 Ga0496114_0903567
1275 Ga0496114_1018496
1276 Ga0496115_0045687
1277 Ga0496115_0099025
1278 Ga0496118_0461186
1279 Ga0496120_0014507
1280 Ga0501031_0000818
1281 Ga0501031_0011134
1282 Ga0501031_1021216
1283 Ga0501032_0000978
1284 Ga0501032_0012449
1285 Ga0501032_0168353
1286 Ga0501032_0473636
1287 Ga0501033_0001418
1288 Ga0501033_0011843
1289 Ga0501034_0003564
1290 Ga0501034_0017200
1291 Ga0501034_1527960
1292 Ga0501036_0010755
1293 Ga0501036_0039610
1294 Ga0501036_0676956
1295 Ga0501037_0002882
1296 Ga0501037_0008604
1297 Ga0501037_0032786
1298 Ga0501037_0089054
1299 Ga0501038_0000501
1300 Ga0501038_0013575
1301 Ga0501038_0113494
1302 Ga0501039_0004987
1303 Ga0501039_0005351
1304 Ga0501039_0394154
1305 Ga0501042_0052390
1306 Ga0501043_0001130
1307 Ga0501043_0031070
1308 Ga0501043_0215715
1309 Ga0501046_0002038
1310 Ga0501046_0004866
1311 Ga0501046_0028839
1312 Ga0501047_0006489
1313 Ga0501047_0023766
1314 Ga0501047_1201407
1315 Ga0501048_0000474
1316 Ga0501048_0007929
1317 Ga0501067_0029067
1318 Ga0501067_0166411
1319 Ga0501068_0070837
1320 Ga0501068_0201700
1321 Ga0501069_0014299
1322 Ga0501070_0001907
1323 Ga0501070_0011322
1324 Ga0501070_0225520
1325 Ga0501070_1354410
1326 Ga0501072_0854295
1327 Ga0501073_0007439
1328 Ga0501074_0014483
1329 Ga0501074_0082553
1330 Ga0501080_0002944
1331 Ga0501083_0001473
1332 Ga0501035_0002308
1333 Ga0501035_0004669
1334 Ga0501044_0016708
1335 Ga0501044_0045026
1336 Ga0501044_0356011
1337 Ga0501045_0023437
1338 Ga0501045_0386204
1339 nmdc:mga0rr50_23983_c1
1340 Ga0495601_0009537
1341 Ga0495601_0036879
1342 Ga0495601_0091862
1343 Ga0495601_0516622
1344 Ga0495601_0588530
1345 Ga0495612_0036041
1346 Ga0495612_0064129
1347 Ga0495595_0025398
1348 Ga0495595_0028131
1349 Ga0495595_0040959
1350 Ga0495619_0108773
1351 Ga0495619_0160348
1352 Ga0495619_0209639
1353 Ga0500556_0000204
1354 Ga0500593_001484
1355 Ga0500616_0000081
1356 Ga0501084_0032552
1357 Ga0587073_0041641
1358 Ga0530510_1513615
1359 2676477495
1360 2819426916
1361 2827634752
1362 2858854772
1363 2858893017
1364 2880496921
1365 2946033574
1366 8054734501

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

8

52

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

5

51

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9431 2 58
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9399 2 61
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9388 3 52
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9258 3 52
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9251 8 53
ID Description Score Start End Superfamily
af_O53838_4_115_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9818 2 52 1.10.10.10
af_P9WMI9_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9588 2 52 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9582 2 51 1.10.10.10
af_Q4DPL3_4_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9493 9 54 1.10.10.10
af_Q58184_329_408_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9459 6 52 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A542ZEQ3-F1-model_v4 ArsR family transcriptional regulator 0.9757 3 62 GO:0003700
AF-A0A4Q8ADR8-F1-model_v4 ArsR family transcriptional regulator 0.9721 2 69 GO:0003700
AF-A0A4R1P4G4-F1-model_v4 deleted 0.9695 2 82
AF-A0A3S9EKF9-F1-model_v4 ArsR family transcriptional regulator 0.9671 2 78 GO:0003700
AF-A0A2V5DNL0-F1-model_v4 deleted 0.9641 2 67

Map