F474996

General Info

Members Datasets Scaffolds Average Seq Length
683 298 1366 130

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0088689|Ga0466966_0088689_766_1239
Length 157
Sequence VAGQKPDLTAEKTSRIDLAGRAMIGAEMISITTKSPYALSALVELHHHGDRGPVPIAELARRREIPVQFLEQLFATLRRAGVLRSQRGVKGGYSFARPSGDITVLELVELLDGPVGADATGVFAEAAQAARNVLSQSTVAEIAEAESRAAGAPMYHI

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
270 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
271 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 11.42
Rhizosphere 78.77
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0088689 3300044684 Bacteria 1922
2 JGI24746J21847_1000138 3300001977 Bacteria 9015
3 JGI24751J29686_10018548 3300002459 Bacteria 1439
4 JGI25404J52841_10005552 3300003659 Unclassified 2605
5 Ga0070683_100034922 3300005329 Bacteria 4596
6 Ga0070683_100461969 3300005329 Bacteria 1212
7 Ga0070690_100260535 3300005330 Viruses 1230
8 Ga0068869_100374102 3300005334 Bacteria 1166
9 Ga0070682_100373607 3300005337 Bacteria 1070
10 Ga0070682_101095038 3300005337 Bacteria 667
11 Ga0068868_100000520 3300005338 Bacteria 25795
12 Ga0068868_100074230 3300005338 Bacteria 2716
13 Ga0068868_100732620 3300005338 Bacteria 887
14 Ga0070660_100019278 3300005339 Bacteria 4995
15 Ga0070660_100190990 3300005339 Bacteria 1659
16 Ga0070660_100270443 3300005339 Bacteria 1389
17 Ga0070687_100791897 3300005343 Bacteria 671
18 Ga0070661_100518225 3300005344 Bacteria 956
19 Ga0070692_10681437 3300005345 Bacteria 689
20 Ga0070668_100043095 3300005347 Bacteria 3460
21 Ga0070668_101039944 3300005347 Viruses 737
22 Ga0070668_101251222 3300005347 Bacteria 674
23 Ga0070669_100005455 3300005353 Bacteria 9178
24 Ga0070674_101689914 3300005356 Viruses 572
25 Ga0070673_100005029 3300005364 Bacteria 8437
26 Ga0070673_101723753 3300005364 Bacteria 593
27 Ga0070659_100005337 3300005366 Bacteria 9220
28 Ga0070659_101098576 3300005366 Bacteria 701
29 Ga0070709_10314365 3300005434 Bacteria 1148
30 Ga0070714_100036298 3300005435 Bacteria 4133
31 Ga0070714_100113388 3300005435 Bacteria 2404
32 Ga0070714_100336012 3300005435 Bacteria 1416
33 Ga0070714_101547461 3300005435 Unclassified 648
34 Ga0070713_100118034 3300005436 Bacteria 2322
35 Ga0070710_10055273 3300005437 Bacteria 2243
36 Ga0070710_10853985 3300005437 Bacteria 654
37 Ga0070701_10327453 3300005438 Bacteria 950
38 Ga0070711_100254314 3300005439 Bacteria 1379
39 Ga0070711_100370880 3300005439 Bacteria 1155
40 Ga0070694_100057857 3300005444 Bacteria 2636
41 Ga0070694_101072319 3300005444 Bacteria 671
42 Ga0070662_100418864 3300005457 Bacteria 1108
43 Ga0070681_10482778 3300005458 Bacteria 1152
44 Ga0070679_100537428 3300005530 Bacteria 1113
45 Ga0070679_101154276 3300005530 Bacteria 720
46 Ga0070684_100361592 3300005535 Bacteria 1336
47 Ga0070672_100000006 3300005543 Bacteria 117060
48 Ga0070672_100661310 3300005543 Bacteria 913
49 Ga0070686_100032588 3300005544 Bacteria 3196
50 Ga0070686_100238476 3300005544 Bacteria 1323
51 Ga0070686_100261313 3300005544 Bacteria 1269
52 Ga0070686_100755777 3300005544 Bacteria 780
53 Ga0070693_100381524 3300005547 Bacteria 972
54 Ga0070665_100001866 3300005548 Bacteria 23912
55 Ga0070665_100008395 3300005548 Bacteria 10448
56 Ga0070665_100033959 3300005548 Bacteria 5131
57 Ga0070665_101527013 3300005548 Bacteria 676
58 Ga0070704_100006370 3300005549 Bacteria 6955
59 Ga0068855_100380075 3300005563 Bacteria 1551
60 Ga0070664_100614610 3300005564 Bacteria 1008
61 Ga0068854_100452145 3300005578 Bacteria 1073
62 Ga0068856_100018879 3300005614 Bacteria 6686
63 Ga0068856_100756211 3300005614 Bacteria 992
64 Ga0068856_100858202 3300005614 Bacteria 927
65 Ga0068856_101015437 3300005614 Unclassified 848
66 Ga0070702_100037364 3300005615 Bacteria 2697
67 Ga0070702_100656846 3300005615 Bacteria 794
68 Ga0068859_100396824 3300005617 Viruses 1475
69 Ga0068864_100658842 3300005618 Bacteria 1020
70 Ga0068866_11381218 3300005718 Viruses 514
71 Ga0068861_101125445 3300005719 Bacteria 756
72 Ga0068861_102552591 3300005719 Bacteria 515
73 Ga0068851_10009301 3300005834 Bacteria 4563
74 Ga0068870_10167574 3300005840 Bacteria 1308
75 Ga0068858_100379027 3300005842 Bacteria 1357
76 Ga0068862_101594096 3300005844 Bacteria 660
77 Ga0081455_10050913 3300005937 Bacteria 3556
78 Ga0081455_10097270 3300005937 Bacteria 2372
79 Ga0081455_10163737 3300005937 Bacteria 1702
80 Ga0081455_10610035 3300005937 Bacteria 710
81 Ga0081538_10002861 3300005981 Bacteria 16508
82 Ga0081538_10051607 3300005981 Bacteria 2467
83 Ga0081538_10053388 3300005981 Bacteria 2403
84 Ga0081538_10119889 3300005981 Bacteria 1267
85 Ga0081538_10260096 3300005981 Bacteria 656
86 Ga0070717_10000059 3300006028 Bacteria 92958
87 Ga0070717_10251639 3300006028 Bacteria 1561
88 Ga0070717_10468574 3300006028 Bacteria 1137
89 Ga0075365_10000158 3300006038 Bacteria 21451
90 Ga0075365_10002071 3300006038 Bacteria 9569
91 Ga0075364_10114989 3300006051 Bacteria 1798
92 Ga0075364_10310660 3300006051 Bacteria 1073
93 Ga0070716_100795508 3300006173 Bacteria 732
94 Ga0070716_100799390 3300006173 Viruses 730
95 Ga0070712_100026084 3300006175 Bacteria 3889
96 Ga0070712_100054799 3300006175 Bacteria 2789
97 Ga0075428_100133518 3300006844 Bacteria 2699
98 Ga0075428_100480278 3300006844 Bacteria 1330
99 Ga0075428_101101227 3300006844 Bacteria 839
100 Ga0075430_100011782 3300006846 Bacteria 7443
101 Ga0075430_100630442 3300006846 Bacteria 884
102 Ga0075433_10272394 3300006852 Bacteria 1500
103 Ga0075434_100031586 3300006871 Bacteria 5221
104 Ga0068865_100712640 3300006881 Bacteria 859
105 Ga0097620_100396878 3300006931 Viruses 1475
106 Ga0075435_100474412 3300007076 Bacteria 1080
107 Ga0105240_10064000 3300009093 Bacteria 4571
108 Ga0111539_10042881 3300009094 Bacteria 5429
109 Ga0105245_10011975 3300009098 Bacteria 7541
110 Ga0105245_10270474 3300009098 Bacteria 1657
111 Ga0105245_10797700 3300009098 Unclassified 982
112 Ga0105245_10848675 3300009098 Bacteria 953
113 Ga0105247_10018428 3300009101 Bacteria 4187
114 Ga0114129_10303054 3300009147 Bacteria 2129
115 Ga0114129_10553480 3300009147 Unclassified 1496
116 Ga0114129_10784278 3300009147 Bacteria 1217
117 Ga0114129_11415415 3300009147 Bacteria 857
118 Ga0114129_11942596 3300009147 Bacteria 713
119 Ga0114129_13161450 3300009147 Bacteria 537
120 Ga0105243_11078567 3300009148 Unclassified 810
121 Ga0105243_11186303 3300009148 Bacteria 776
122 Ga0105242_11217990 3300009176 Bacteria 773
123 Ga0105248_10710402 3300009177 Bacteria 1134
124 Ga0105248_11493229 3300009177 Bacteria 765
125 Ga0105238_10172387 3300009551 Bacteria 2140
126 Ga0105238_12281196 3300009551 Bacteria 576
127 Ga0105249_10747897 3300009553 Bacteria 1040
128 Ga0105239_10582548 3300010375 Bacteria 1275
129 Ga0105239_11270446 3300010375 Bacteria 849
130 Ga0157369_11189321 3300013105 Bacteria 778
131 Ga0157369_11990158 3300013105 Bacteria 589
132 Ga0157374_10217168 3300013296 Viruses 1876
133 Ga0157378_10073920 3300013297 Bacteria 3066
134 Ga0157378_13272634 3300013297 Unclassified 503
135 Ga0157372_11131288 3300013307 Bacteria 905
136 Ga0157375_10049442 3300013308 Bacteria 4120
137 Ga0157375_10396991 3300013308 Bacteria 1546
138 Ga0157375_10834770 3300013308 Bacteria 1069
139 Ga0157375_11230132 3300013308 Bacteria 879
140 Ga0163163_10386323 3300014325 Bacteria 1457
141 Ga0163163_11973940 3300014325 Bacteria 643
142 Ga0157380_11251118 3300014326 Bacteria 788
143 Ga0157379_10110920 3300014968 Bacteria 2464
144 Ga0157379_11813541 3300014968 Bacteria 600
145 Ga0206353_10847558 3300020082 Bacteria 665
146 Ga0213873_10122001 3300021358 Bacteria 766
147 Ga0213873_10124902 3300021358 Bacteria 758
148 Ga0213874_10006438 3300021377 Bacteria 2778
149 Ga0213874_10060970 3300021377 Bacteria 1181
150 Ga0213874_10084380 3300021377 Bacteria 1034
151 Ga0213874_10313059 3300021377 Bacteria 593
152 Ga0213876_10011033 3300021384 Bacteria 4838
153 Ga0213876_10019513 3300021384 Bacteria 3582
154 Ga0213876_10034343 3300021384 Bacteria 2674
155 Ga0213876_10065915 3300021384 Bacteria 1911
156 Ga0213876_10330837 3300021384 Bacteria 810
157 Ga0213876_10552621 3300021384 Bacteria 613
158 Ga0213875_10000106 3300021388 Bacteria 95400
159 Ga0213875_10024780 3300021388 Bacteria 2860
160 Ga0213875_10043050 3300021388 Bacteria 2120
161 Ga0213875_10144759 3300021388 Bacteria 1113
162 Ga0213875_10171521 3300021388 Bacteria 1019
163 Ga0213875_10288005 3300021388 Bacteria 776
164 Ga0213875_10555631 3300021388 Bacteria 553
165 Ga0213875_10576428 3300021388 Bacteria 543
166 Ga0207656_10005231 3300025321 Bacteria 4569
167 Ga0207692_10026278 3300025898 Bacteria 2729
168 Ga0207692_10795363 3300025898 Bacteria 618
169 Ga0207642_11054202 3300025899 Unclassified 525
170 Ga0207688_10047287 3300025901 Bacteria 2403
171 Ga0207688_10646089 3300025901 Bacteria 668
172 Ga0207685_10479813 3300025905 Bacteria 651
173 Ga0207654_10587763 3300025911 Unclassified 794
174 Ga0207707_10516203 3300025912 Bacteria 1018
175 Ga0207695_10046537 3300025913 Bacteria 4598
176 Ga0207671_10790563 3300025914 Unclassified 753
177 Ga0207693_10105121 3300025915 Bacteria 2214
178 Ga0207693_10119076 3300025915 Bacteria 2073
179 Ga0207693_10129091 3300025915 Bacteria 1987
180 Ga0207663_10101267 3300025916 Bacteria 1935
181 Ga0207663_10167199 3300025916 Bacteria 1559
182 Ga0207663_10305879 3300025916 Bacteria 1189
183 Ga0207660_10734789 3300025917 Bacteria 805
184 Ga0207660_11401199 3300025917 Bacteria 566
185 Ga0207662_11182603 3300025918 Bacteria 544
186 Ga0207657_10030488 3300025919 Bacteria 4895
187 Ga0207657_10137856 3300025919 Unclassified 1995
188 Ga0207657_10520514 3300025919 Bacteria 931
189 Ga0207649_11021732 3300025920 Bacteria 651
190 Ga0207652_10103593 3300025921 Bacteria 2516
191 Ga0207681_10002889 3300025923 Bacteria 10860
192 Ga0207681_10053420 3300025923 Bacteria 2743
193 Ga0207650_10879714 3300025925 Bacteria 760
194 Ga0207687_10303954 3300025927 Viruses 1286
195 Ga0207687_10871604 3300025927 Bacteria 770
196 Ga0207700_10672099 3300025928 Bacteria 924
197 Ga0207700_10772794 3300025928 Bacteria 859
198 Ga0207664_10014054 3300025929 Bacteria 5773
199 Ga0207664_10065744 3300025929 Bacteria 2904
200 Ga0207664_10078573 3300025929 Bacteria 2676
201 Ga0207664_10344595 3300025929 Bacteria 1318
202 Ga0207690_10003023 3300025932 Bacteria 10121
203 Ga0207706_10877268 3300025933 Bacteria 759
204 Ga0207686_10154047 3300025934 Bacteria 1603
205 Ga0207686_10663453 3300025934 Bacteria 826
206 Ga0207709_10008379 3300025935 Bacteria 5719
207 Ga0207709_11608832 3300025935 Viruses 540
208 Ga0207665_10093192 3300025939 Bacteria 2091
209 Ga0207665_10517341 3300025939 Unclassified 924
210 Ga0207665_10694215 3300025939 Bacteria 800
211 Ga0207691_10000025 3300025940 Bacteria 129424
212 Ga0207691_10522045 3300025940 Bacteria 1008
213 Ga0207679_10747751 3300025945 Bacteria 889
214 Ga0207667_10421053 3300025949 Unclassified 1359
215 Ga0207651_10002519 3300025960 Bacteria 8744
216 Ga0207651_10482047 3300025960 Bacteria 1069
217 Ga0207668_10594542 3300025972 Viruses 963
218 Ga0207640_11249881 3300025981 Bacteria 662
219 Ga0207640_11719644 3300025981 Bacteria 566
220 Ga0207677_10000588 3300026023 Bacteria 22552
221 Ga0207677_11350716 3300026023 Bacteria 655
222 Ga0207677_12048517 3300026023 Bacteria 532
223 Ga0207677_12081922 3300026023 Bacteria 528
224 Ga0207703_10572816 3300026035 Unclassified 1066
225 Ga0207678_10138332 3300026067 Bacteria 2078
226 Ga0207708_11505707 3300026075 Unclassified 591
227 Ga0207702_10111606 3300026078 Bacteria 2432
228 Ga0207702_10148760 3300026078 Bacteria 2128
229 Ga0207702_10882889 3300026078 Unclassified 886
230 Ga0207702_10920213 3300026078 Bacteria 867
231 Ga0207648_11185887 3300026089 Bacteria 717
232 Ga0207676_10646894 3300026095 Bacteria 1020
233 Ga0207675_101179971 3300026118 Bacteria 786
234 Ga0207675_101226394 3300026118 Bacteria 770
235 Ga0207683_10055920 3300026121 Bacteria 3461
236 Ga0207428_10181929 3300027907 Bacteria 1588
237 Ga0268266_10001339 3300028379 Bacteria 29819
238 Ga0268266_10014424 3300028379 Bacteria 6793
239 Ga0268266_10813414 3300028379 Bacteria 903
240 Ga0268265_10833613 3300028380 Bacteria 901
241 Ga0268265_11755244 3300028380 Unclassified 627
242 Ga0265326_10000023 3300028558 Bacteria 113142
243 Ga0265319_1001040 3300028563 Bacteria 17346
244 Ga0265319_1003583 3300028563 Bacteria 8047
245 Ga0265334_10000094 3300028573 Bacteria 63340
246 Ga0265318_10005856 3300028577 Bacteria 5720
247 Ga0265336_10011417 3300028666 Bacteria 3021
248 Ga0265338_10029093 3300028800 Bacteria 5489
249 Ga0265338_10067722 3300028800 Bacteria 3081
250 Ga0265338_10276200 3300028800 Bacteria 1229
251 Ga0265338_10501607 3300028800 Bacteria 854
252 Ga0265324_10001935 3300029957 Bacteria 11108
253 Ga0265332_10380113 3300031238 Bacteria 583
254 Ga0265320_10035744 3300031240 Bacteria 2516
255 Ga0265320_10058750 3300031240 Bacteria 1840
256 Ga0265325_10185219 3300031241 Bacteria 968
257 Ga0265339_10366714 3300031249 Bacteria 677
258 Ga0265331_10508330 3300031250 Bacteria 542
259 Ga0265327_10023435 3300031251 Bacteria 3656
260 Ga0265316_10023231 3300031344 Bacteria 5213
261 Ga0265316_10189620 3300031344 Bacteria 1528
262 Ga0265316_10442493 3300031344 Bacteria 933
263 Ga0307408_100117441 3300031548 Bacteria 2055
264 Ga0265314_10030115 3300031711 Bacteria 4022
265 Ga0265314_10096510 3300031711 Bacteria 1912
266 Ga0307405_10075124 3300031731 Bacteria 2188
267 Ga0307413_10484487 3300031824 Bacteria 989
268 Ga0307410_10081269 3300031852 Bacteria 2276
269 Ga0307410_10423416 3300031852 Bacteria 1080
270 Ga0307410_10485675 3300031852 Bacteria 1014
271 Ga0326468_10034084 3300031889 Bacteria 692
272 Ga0307406_11105679 3300031901 Bacteria 684
273 Ga0307406_11971622 3300031901 Bacteria 521
274 Ga0307407_10003149 3300031903 Bacteria 6679
275 Ga0307407_11149511 3300031903 Bacteria 605
276 Ga0307409_100047814 3300031995 Bacteria 3251
277 Ga0307409_100326672 3300031995 Bacteria 1438
278 Ga0307409_100466757 3300031995 Bacteria 1222
279 Ga0307409_101335600 3300031995 Bacteria 742
280 Ga0307416_100003580 3300032002 Bacteria 9161
281 Ga0307416_100047928 3300032002 Bacteria 3386
282 Ga0307416_102785142 3300032002 Bacteria 585
283 Ga0307414_10388927 3300032004 Bacteria 1208
284 Ga0307414_10977472 3300032004 Bacteria 779
285 Ga0307414_11211415 3300032004 Bacteria 699
286 Ga0307414_11687401 3300032004 Bacteria 591
287 Ga0307415_100000324 3300032126 Bacteria 20699
288 Ga0307415_100250253 3300032126 Unclassified 1439
289 Ga0307415_100665735 3300032126 Bacteria 935
290 Ga0307415_102348439 3300032126 Bacteria 524
291 Ga0373944_0285159 3300035089 Unclassified 617
292 Ga0373956_0213875 3300035119 Bacteria 915
293 Ga0373956_0435051 3300035119 Bacteria 626
294 Ga0373957_0066286 3300035120 Bacteria 1406
295 Ga0373962_0314071 3300035242 Bacteria 559
296 Ga0316574_0061279 3300035398 Bacteria 2362
297 Ga0316574_0579299 3300035398 Bacteria 695
298 Ga0316574_0831369 3300035398 Bacteria 561
299 Ga0373924_0050114 3300035410 Bacteria 1729
300 Ga0373933_0014588 3300035724 Bacteria 4373
301 Ga0373933_0343047 3300035724 Bacteria 970
302 Ga0373947_0065426 3300035725 Bacteria 2218
303 Ga0373925_0855211 3300037068 Viruses 750
304 Ga0395900_0010749 3300037418 Bacteria 9363
305 Ga0395900_0143888 3300037418 Bacteria 2440
306 Ga0395900_0159569 3300037418 Bacteria 2301
307 Ga0395898_0000631 3300037466 Bacteria 64382
308 Ga0395898_0086657 3300037466 Bacteria 3018
309 Ga0395898_0989048 3300037466 Bacteria 777
310 Ga0395898_1148599 3300037466 Bacteria 709
311 Ga0436364_0250118 3300037853 Bacteria 1456
312 Ga0436364_0507893 3300037853 Bacteria 50699
313 Ga0436364_0737248 3300037853 Bacteria 154680
314 Ga0436364_1005245 3300037853 Bacteria 2020
315 Ga0436364_1052875 3300037853 Bacteria 9684
316 Ga0436364_1101297 3300037853 Bacteria 15265
317 Ga0436364_1102009 3300037853 Bacteria 2598
318 Ga0436364_1178904 3300037853 Bacteria 715
319 Ga0436364_1474896 3300037853 Bacteria 1894
320 Ga0436364_1515506 3300037853 Bacteria 4229
321 Ga0395901_0039194 3300038443 Bacteria 4903
322 Ga0395901_0235929 3300038443 Bacteria 1909
323 Ga0395901_0357338 3300038443 Bacteria 1507
324 Ga0395901_0756734 3300038443 Bacteria 964
325 Ga0395901_1645020 3300038443 Bacteria 595
326 Ga0395901_2090601 3300038443 Bacteria 511
327 Ga0436365_0068887 3300039437 Bacteria 2155
328 Ga0436365_0113281 3300039437 Bacteria 19851
329 Ga0436365_0313384 3300039437 Bacteria 15690
330 Ga0436365_0716929 3300039437 Bacteria 12555
331 Ga0436365_0800156 3300039437 Bacteria 643
332 Ga0436365_0958190 3300039437 Bacteria 4924
333 Ga0436365_1141778 3300039437 Bacteria 4909
334 Ga0436365_1192690 3300039437 Bacteria 1283
335 Ga0436365_1295859 3300039437 Bacteria 13419
336 Ga0436365_1882637 3300039437 Bacteria 12677
337 Ga0436363_0039289 3300039450 Bacteria 1218
338 Ga0436363_0360923 3300039450 Bacteria 13447
339 Ga0436363_0536742 3300039450 Bacteria 4323
340 Ga0436363_0601355 3300039450 Bacteria 3451
341 Ga0436363_0736430 3300039450 Bacteria 18930
342 Ga0436363_0789063 3300039450 Bacteria 1534
343 Ga0436363_0946888 3300039450 Bacteria 778
344 Ga0436363_1185869 3300039450 Unclassified 1541
345 Ga0436363_1291302 3300039450 Bacteria 746
346 Ga0436363_1672350 3300039450 Bacteria 2470
347 Ga0436362_0311779 3300039453 Bacteria 1527
348 Ga0436362_0628620 3300039453 Bacteria 579
349 Ga0436362_0850610 3300039453 Bacteria 1779
350 Ga0436362_1086560 3300039453 Bacteria 1790
351 Ga0436362_1271673 3300039453 Unclassified 639
352 Ga0451793_0193853 3300041452 Bacteria 743
353 Ga0451793_1392739 3300041452 Bacteria 644
354 Ga0451837_0935578 3300041494 Bacteria 953
355 Ga0451851_0314483 3300041507 Bacteria 716
356 Ga0451855_1418440 3300041511 Bacteria 621
357 Ga0451853_0494759 3300041512 Bacteria 1131
358 Ga0451853_1497085 3300041512 Bacteria 661
359 Ga0466969_0013812 3300044656 Bacteria 4252
360 Ga0466969_0056660 3300044656 Bacteria 1913
361 Ga0466969_0256212 3300044656 Bacteria 793
362 Ga0466969_0272283 3300044656 Bacteria 767
363 Ga0466965_0169910 3300044683 Bacteria 1147
364 Ga0466965_0239398 3300044683 Bacteria 971
365 Ga0466966_0097008 3300044684 Bacteria 1826
366 Ga0466966_0157960 3300044684 Bacteria 1381
367 Ga0466966_0455701 3300044684 Bacteria 769
368 Ga0466966_0574923 3300044684 Bacteria 678
369 Ga0466966_0832345 3300044684 Bacteria 556
370 Ga0466961_0017167 3300044693 Bacteria 4649
371 Ga0466961_0078623 3300044693 Bacteria 2089
372 Ga0466961_0192980 3300044693 Bacteria 1262
373 Ga0466961_0221551 3300044693 Bacteria 1166
374 Ga0466963_0006005 3300044694 Bacteria 7157
375 Ga0466963_0020264 3300044694 Bacteria 4182
376 Ga0466963_0055415 3300044694 Bacteria 2636
377 Ga0466963_0060879 3300044694 Bacteria 2522
378 Ga0466963_0101820 3300044694 Bacteria 1966
379 Ga0466963_0113332 3300044694 Bacteria 1862
380 Ga0466963_0255891 3300044694 Bacteria 1229
381 Ga0466963_0266995 3300044694 Bacteria 1202
382 Ga0466963_0328218 3300044694 Bacteria 1077
383 Ga0466964_0567311 3300044706 Unclassified 618
384 Ga0466964_0616217 3300044706 Bacteria 597
385 Ga0466971_0012773 3300044719 Bacteria 3683
386 Ga0466971_0046609 3300044719 Bacteria 1948
387 Ga0466971_0084529 3300044719 Bacteria 1449
388 Ga0466971_0120313 3300044719 Bacteria 1215
389 Ga0466971_0293381 3300044719 Bacteria 780
390 Ga0466971_0610799 3300044719 Unclassified 544
391 Ga0466968_0083616 3300044735 Bacteria 1406
392 Ga0466968_0096526 3300044735 Bacteria 1316
393 Ga0466968_0382912 3300044735 Bacteria 687
394 Ga0466968_0711187 3300044735 Bacteria 513
395 Ga0466970_0050384 3300044765 Bacteria 2221
396 Ga0466970_0214361 3300044765 Bacteria 1073
397 Ga0466957_0001241 3300044842 Bacteria 13295
398 Ga0466957_0065156 3300044842 Bacteria 2243
399 Ga0466957_0159843 3300044842 Bacteria 1463
400 Ga0466959_0018132 3300045049 Bacteria 5165
401 Ga0466959_0020796 3300045049 Bacteria 4837
402 Ga0466959_0039655 3300045049 Bacteria 3481
403 Ga0466959_0059497 3300045049 Bacteria 2782
404 Ga0466959_0084072 3300045049 Bacteria 2291
405 Ga0466959_0190419 3300045049 Bacteria 1432
406 Ga0466959_0222458 3300045049 Bacteria 1309
407 Ga0466959_0358911 3300045049 Bacteria 993
408 Ga0466959_0647204 3300045049 Bacteria 710
409 Ga0466959_0993486 3300045049 Bacteria 559
410 Ga0466958_0003810 3300045836 Bacteria 7878
411 Ga0466958_0007175 3300045836 Bacteria 6110
412 Ga0466958_0024464 3300045836 Bacteria 3554
413 Ga0466958_0032444 3300045836 Bacteria 3107
414 Ga0466958_0085550 3300045836 Bacteria 1945
415 Ga0466958_0096644 3300045836 Bacteria 1832
416 Ga0466958_0208642 3300045836 Bacteria 1244
417 Ga0466958_0257764 3300045836 Bacteria 1116
418 Ga0466958_0357917 3300045836 Bacteria 940
419 Ga0466958_0751236 3300045836 Bacteria 636
420 Ga0466967_0037261 3300045976 Bacteria 4160
421 Ga0466967_0062085 3300045976 Bacteria 3316
422 Ga0466967_0075696 3300045976 Bacteria 3026
423 Ga0466967_0105085 3300045976 Bacteria 2587
424 Ga0466967_0159659 3300045976 Bacteria 2115
425 Ga0466967_0246555 3300045976 Bacteria 1705
426 Ga0466967_0300495 3300045976 Bacteria 1544
427 Ga0466967_0710168 3300045976 Bacteria 996
428 Ga0466967_0830432 3300045976 Bacteria 918
429 Ga0466967_1286660 3300045976 Bacteria 728
430 Ga0466967_2462954 3300045976 Bacteria 515
431 Ga0495592_0030943 3300046454 Bacteria 4048
432 Ga0495603_0242802 3300046455 Bacteria 1037
433 Ga0495629_0003726 3300046459 Bacteria 11487
434 Ga0495629_0434550 3300046459 Bacteria 890
435 Ga0495629_0591187 3300046459 Unclassified 743
436 Ga0495629_0770103 3300046459 Unclassified 636
437 Ga0495641_0051021 3300046461 Bacteria 1890
438 Ga0495641_0074257 3300046461 Unclassified 1525
439 Ga0495651_0004867 3300046462 Bacteria 10274
440 Ga0495653_0033045 3300046463 Bacteria 4102
441 Ga0495653_0463396 3300046463 Bacteria 795
442 Ga0495582_0226761 3300046473 Bacteria 1070
443 Ga0495662_0599298 3300046476 Bacteria 539
444 Ga0495664_0377501 3300046477 Bacteria 852
445 Ga0495606_0000108 3300046507 Bacteria 140473
446 Ga0495608_0003879 3300046511 Bacteria 10747
447 Ga0495608_0291674 3300046511 Bacteria 1011
448 Ga0495618_0046928 3300046514 Bacteria 2726
449 Ga0495618_0624058 3300046514 Bacteria 640
450 Ga0495628_0018094 3300046516 Bacteria 5844
451 Ga0495628_0021870 3300046516 Bacteria 5257
452 Ga0495632_0434407 3300046519 Bacteria 571
453 Ga0495637_0131131 3300046520 Unclassified 957
454 Ga0495652_0142751 3300046529 Bacteria 1881
455 Ga0495640_0247997 3300046533 Bacteria 1116
456 Ga0495640_0712522 3300046533 Bacteria 601
457 Ga0495587_0116744 3300046536 Bacteria 1530
458 Ga0495587_0145822 3300046536 Bacteria 1350
459 Ga0495645_0738642 3300046543 Bacteria 595
460 Ga0495667_0301478 3300046559 Bacteria 1015
461 Ga0495656_0704416 3300046615 Unclassified 543
462 Ga0495634_0048594 3300046642 Bacteria 2856
463 Ga0495635_0014024 3300046663 Bacteria 5608
464 Ga0495657_0011453 3300046675 Bacteria 6629
465 Ga0495599_0212601 3300046678 Bacteria 1185
466 Ga0495623_0062310 3300046679 Bacteria 2338
467 Ga0495646_0005200 3300046680 Bacteria 8208
468 Ga0495646_0277982 3300046680 Bacteria 890
469 Ga0495646_0504030 3300046680 Bacteria 621
470 Ga0495658_0296137 3300046683 Bacteria 1023
471 Ga0495613_0000481 3300046689 Bacteria 34000
472 Ga0495613_0019719 3300046689 Bacteria 5026
473 Ga0495613_0716604 3300046689 Bacteria 658
474 Ga0495600_0014323 3300046809 Bacteria 4996
475 Ga0495600_0171546 3300046809 Unclassified 1400
476 Ga0495660_0136749 3300046810 Unclassified 1224
477 Ga0495581_0353535 3300047315 Bacteria 858
478 Ga0495604_0000122 3300047317 Bacteria 65938
479 Ga0495604_0058912 3300047317 Bacteria 2947
480 Ga0495604_0160516 3300047317 Bacteria 1589
481 Ga0495604_0212401 3300047317 Bacteria 1336
482 Ga0495676_0374613 3300047321 Bacteria 948
483 Ga0495680_0007443 3300047322 Bacteria 10036
484 Ga0495680_0254816 3300047322 Bacteria 1243
485 Ga0495675_0131164 3300047444 Unclassified 1557
486 Ga0495675_0352930 3300047444 Bacteria 865
487 Ga0495673_0201885 3300047469 Bacteria 743
488 Ga0495684_0048223 3300047471 Bacteria 3257
489 Ga0495684_0717552 3300047471 Bacteria 661
490 Ga0495593_0103107 3300047673 Unclassified 1462
491 Ga0495593_0582602 3300047673 Bacteria 561
492 Ga0495602_0000166 3300048088 Bacteria 61220
493 Ga0495602_0077890 3300048088 Bacteria 2802
494 Ga0495614_0368817 3300048089 Bacteria 671
495 Ga0496100_0000550 3300048903 Bacteria 17789
496 Ga0496100_0012930 3300048903 Bacteria 4799
497 Ga0496100_0393541 3300048903 Bacteria 1054
498 Ga0496100_0682967 3300048903 Bacteria 801
499 Ga0496100_0932486 3300048903 Bacteria 682
500 Ga0496101_0000482 3300048904 Bacteria 25132
501 Ga0496102_0015555 3300048905 Bacteria 6629
502 Ga0496102_0146432 3300048905 Bacteria 2217
503 Ga0496102_0399822 3300048905 Bacteria 1292
504 Ga0496103_0006110 3300048906 Bacteria 7193
505 Ga0496103_0252877 3300048906 Bacteria 1134
506 Ga0496104_0000036 3300048907 Bacteria 180472
507 Ga0496104_0015670 3300048907 Bacteria 6875
508 Ga0496104_0033484 3300048907 Bacteria 4787
509 Ga0496104_0044152 3300048907 Bacteria 4188
510 Ga0496104_0142271 3300048907 Unclassified 2304
511 Ga0496104_0344654 3300048907 Bacteria 1403
512 Ga0496104_0426977 3300048907 Unclassified 1237
513 Ga0496104_0448806 3300048907 Bacteria 1201
514 Ga0496104_0697506 3300048907 Bacteria 923
515 Ga0496105_0001296 3300048908 Bacteria 17493
516 Ga0496105_0084316 3300048908 Bacteria 2625
517 Ga0496105_0137402 3300048908 Bacteria 2013
518 Ga0496105_0175753 3300048908 Bacteria 1754
519 Ga0496105_0180944 3300048908 Bacteria 1726
520 Ga0496105_0194203 3300048908 Bacteria 1659
521 Ga0496105_0385700 3300048908 Bacteria 1114
522 Ga0496106_0001486 3300048909 Bacteria 17621
523 Ga0496106_0141739 3300048909 Bacteria 1891
524 Ga0496106_0634807 3300048909 Bacteria 854
525 Ga0496106_0769546 3300048909 Bacteria 765
526 Ga0496107_0048298 3300048910 Bacteria 3065
527 Ga0496107_0460355 3300048910 Bacteria 944
528 Ga0496108_0019473 3300048911 Bacteria 5573
529 Ga0496108_0020600 3300048911 Bacteria 5419
530 Ga0496108_0109350 3300048911 Bacteria 2362
531 Ga0496108_1283565 3300048911 Bacteria 616
532 Ga0496109_0016063 3300048912 Bacteria 6542
533 Ga0496109_0060304 3300048912 Bacteria 3467
534 Ga0496109_0075758 3300048912 Bacteria 3093
535 Ga0496109_0199188 3300048912 Bacteria 1882
536 Ga0496109_0226539 3300048912 Bacteria 1758
537 Ga0496109_1698342 3300048912 Bacteria 565
538 Ga0496110_0001701 3300048913 Bacteria 16176
539 Ga0496110_0002877 3300048913 Bacteria 13011
540 Ga0496110_0182516 3300048913 Bacteria 1905
541 Ga0496110_0322200 3300048913 Bacteria 1408
542 Ga0496110_0357776 3300048913 Unclassified 1330
543 Ga0496110_0523199 3300048913 Bacteria 1079
544 Ga0496111_0000350 3300048914 Bacteria 22852
545 Ga0496111_0029875 3300048914 Bacteria 3872
546 Ga0496111_0071035 3300048914 Bacteria 2533
547 Ga0496111_0440263 3300048914 Bacteria 962
548 Ga0496112_0020305 3300048915 Bacteria 6294
549 Ga0496112_0036220 3300048915 Bacteria 4812
550 Ga0496112_0039625 3300048915 Bacteria 4605
551 Ga0496112_0087300 3300048915 Bacteria 3086
552 Ga0496112_0235090 3300048915 Bacteria 1786
553 Ga0496112_0361120 3300048915 Bacteria 1394
554 Ga0496112_0782337 3300048915 Bacteria 879
555 Ga0496112_1398250 3300048915 Bacteria 614
556 Ga0496113_0000202 3300048916 Bacteria 27530
557 Ga0496113_0009415 3300048916 Bacteria 6407
558 Ga0496113_0041244 3300048916 Bacteria 3405
559 Ga0496113_0066935 3300048916 Bacteria 2722
560 Ga0496113_0077370 3300048916 Bacteria 2543
561 Ga0496113_0283602 3300048916 Bacteria 1325
562 Ga0496113_0408456 3300048916 Bacteria 1090
563 Ga0496113_0753086 3300048916 Unclassified 775
564 Ga0496114_0008571 3300048917 Bacteria 8102
565 Ga0496114_0297289 3300048917 Bacteria 1425
566 Ga0496114_0933630 3300048917 Bacteria 750
567 Ga0496114_0979270 3300048917 Bacteria 728
568 Ga0496115_0001473 3300048918 Bacteria 16899
569 Ga0496115_0301804 3300048918 Bacteria 1312
570 Ga0496115_0683612 3300048918 Bacteria 808
571 Ga0496121_0007203 3300048924 Bacteria 13471
572 Ga0496124_0618755 3300048927 Bacteria 701
573 Ga0501031_0237588 3300049568 Bacteria 1185
574 Ga0501031_0834288 3300049568 Unclassified 591
575 Ga0501032_0145375 3300049569 Bacteria 1561
576 Ga0501034_1622209 3300049571 Bacteria 520
577 Ga0501036_0074996 3300049572 Bacteria 2861
578 Ga0501036_0245087 3300049572 Bacteria 1502
579 Ga0501038_0130467 3300049574 Bacteria 2064
580 Ga0501038_0168211 3300049574 Bacteria 1777
581 Ga0501038_0456135 3300049574 Bacteria 982
582 Ga0501039_0087565 3300049575 Bacteria 2426
583 Ga0501039_0220759 3300049575 Bacteria 1490
584 Ga0501040_0058641 3300049576 Bacteria 2644
585 Ga0501040_0255059 3300049576 Unclassified 1251
586 Ga0501040_0614791 3300049576 Bacteria 785
587 Ga0501041_0123454 3300049577 Bacteria 1610
588 Ga0501042_0031139 3300049578 Bacteria 3775
589 Ga0501042_0034935 3300049578 Bacteria 3566
590 Ga0501042_0126318 3300049578 Bacteria 1842
591 Ga0501042_0174462 3300049578 Bacteria 1551
592 Ga0501042_0409076 3300049578 Unclassified 983
593 Ga0501046_0157947 3300049580 Bacteria 1707
594 Ga0501046_0601036 3300049580 Unclassified 781
595 Ga0501047_0014597 3300049581 Bacteria 7475
596 Ga0501048_0022909 3300049582 Bacteria 4566
597 Ga0501067_0037273 3300049583 Bacteria 2701
598 Ga0501067_0053078 3300049583 Bacteria 2246
599 Ga0501068_0188641 3300049584 Unclassified 1305
600 Ga0501068_0472486 3300049584 Bacteria 812
601 Ga0501068_0649045 3300049584 Bacteria 689
602 Ga0501070_0890167 3300049586 Bacteria 695
603 Ga0501071_0030177 3300049587 Bacteria 3833
604 Ga0501071_0348943 3300049587 Bacteria 1126
605 Ga0501071_0551916 3300049587 Bacteria 885
606 Ga0501072_0029142 3300049588 Bacteria 4310
607 Ga0501072_0036654 3300049588 Bacteria 3845
608 Ga0501072_0037453 3300049588 Bacteria 3804
609 Ga0501072_0040529 3300049588 Bacteria 3657
610 Ga0501072_0891341 3300049588 Bacteria 695
611 Ga0501074_0012758 3300049590 Bacteria 6109
612 Ga0501074_0346736 3300049590 Bacteria 1054
613 Ga0501075_0026861 3300049591 Bacteria 4240
614 Ga0501075_0079945 3300049591 Bacteria 2474
615 Ga0501075_0117916 3300049591 Bacteria 2018
616 Ga0501075_0212872 3300049591 Bacteria 1474
617 Ga0501076_0012426 3300049592 Bacteria 6364
618 Ga0501076_0662521 3300049592 Bacteria 861
619 Ga0501077_0034397 3300049593 Bacteria 3226
620 Ga0501077_0109420 3300049593 Bacteria 1751
621 Ga0501077_0652834 3300049593 Bacteria 676
622 Ga0501253_201272 3300049683 Bacteria 526
623 Ga0501257_238729 3300049686 Bacteria 535
624 Ga0501219_029039 3300049703 Bacteria 514
625 Ga0501079_0033846 3300049741 Bacteria 3932
626 Ga0501079_0034736 3300049741 Bacteria 3879
627 Ga0501079_0053336 3300049741 Bacteria 3119
628 Ga0501079_0882542 3300049741 Bacteria 704
629 Ga0501080_0812519 3300049742 Bacteria 819
630 Ga0501081_0015934 3300049743 Bacteria 4963
631 Ga0501081_0064433 3300049743 Bacteria 2545
632 Ga0501081_0395037 3300049743 Bacteria 1023
633 Ga0501083_0260658 3300049744 Bacteria 1128
634 Ga0501044_0390383 3300049823 Bacteria 1306
635 Ga0501044_1269808 3300049823 Bacteria 603
636 Ga0501045_0043287 3300049824 Bacteria 3278
637 Ga0501045_0386206 3300049824 Bacteria 1042
638 Ga0501045_0816390 3300049824 Unclassified 686
639 nmdc:mga00v17_14470_c1 3300050491 Bacteria 4403
640 nmdc:mga00v17_147508_c1 3300050491 Bacteria 1510
641 nmdc:mga0yw44_1730_c1 3300050492 Bacteria 8868
642 nmdc:mga0yw44_260608_c1 3300050492 Bacteria 1155
643 nmdc:mga0yw44_5273_c1 3300050492 Bacteria 6069
644 nmdc:mga06z11_636634_c1 3300050494 Viruses 649
645 nmdc:mga04h51_71594_c1 3300050495 Bacteria 1211
646 nmdc:mga05p37_294940_c1 3300050507 Bacteria 1929
647 nmdc:mga05p37_631203_c1 3300050507 Unclassified 1204
648 nmdc:mga0qj67_1002073_c1 3300050509 Bacteria 655
649 nmdc:mga0qj67_1160_c2 3300050509 Bacteria 7325
650 nmdc:mga06r32_1438896_c1 3300050510 Bacteria 630
651 nmdc:mga06r32_213078_c1 3300050510 Bacteria 1920
652 nmdc:mga08y16_1268510_c1 3300050511 Bacteria 705
653 nmdc:mga08y16_256305_c1 3300050511 Unclassified 1807
654 nmdc:mga0n895_87857_c1 3300050512 Bacteria 3107
655 nmdc:mga0rr50_272346_c1 3300050513 Unclassified 1411
656 nmdc:mga0a205_284648_c1 3300050515 Bacteria 1528
657 Ga0495601_0000034 3300053077 Bacteria 93719
658 Ga0495601_0215974 3300053077 Bacteria 1252
659 Ga0495612_0000024 3300053078 Bacteria 115718
660 Ga0495595_0002896 3300053084 Bacteria 6763
661 Ga0495595_0043540 3300053084 Bacteria 2059
662 Ga0495595_0188379 3300053084 Bacteria 1025
663 Ga0495619_0010562 3300053085 Bacteria 5810
664 Ga0495619_0018318 3300053085 Bacteria 4443
665 Ga0495619_0059486 3300053085 Unclassified 2538
666 Ga0495619_0959353 3300053085 Bacteria 573
667 Ga0500650_0112122 3300053098 Bacteria 1273
668 Ga0501084_0022375 3300054114 Bacteria 5274
669 Ga0501084_0082081 3300054114 Bacteria 2705
670 Ga0501084_0134742 3300054114 Unclassified 2079
671 Ga0501084_0495032 3300054114 Bacteria 1033
672 Ga0590074_047020 3300059423 Bacteria 785
673 Ga0501082_0021822 3300060353 Bacteria 5519
674 Ga0501082_0154432 3300060353 Bacteria 1994
675 Ga0501082_0679043 3300060353 Bacteria 901
676 Ga0466962_0006004 3300061719 Bacteria 5839
677 Ga0466962_0023577 3300061719 Bacteria 2957
678 Ga0466962_0087088 3300061719 Bacteria 1496
679 Ga0530510_0003840 3300061734 Bacteria 10355
680 Ga0530510_0612294 3300061734 Bacteria 828
681 Ga0530510_0753470 3300061734 Bacteria 742
682 Ga0530510_1348862 3300061734 Bacteria 547
683 Ga0530510_1389704 3300061734 Bacteria 539
684 Ga0466966_0088689
685 JGI24746J21847_1000138
686 JGI24751J29686_10018548
687 JGI25404J52841_10005552
688 Ga0070683_100034922
689 Ga0070683_100461969
690 Ga0070690_100260535
691 Ga0068869_100374102
692 Ga0070682_100373607
693 Ga0070682_101095038
694 Ga0068868_100000520
695 Ga0068868_100074230
696 Ga0068868_100732620
697 Ga0070660_100019278
698 Ga0070660_100190990
699 Ga0070660_100270443
700 Ga0070687_100791897
701 Ga0070661_100518225
702 Ga0070692_10681437
703 Ga0070668_100043095
704 Ga0070668_101039944
705 Ga0070668_101251222
706 Ga0070669_100005455
707 Ga0070674_101689914
708 Ga0070673_100005029
709 Ga0070673_101723753
710 Ga0070659_100005337
711 Ga0070659_101098576
712 Ga0070709_10314365
713 Ga0070714_100036298
714 Ga0070714_100113388
715 Ga0070714_100336012
716 Ga0070714_101547461
717 Ga0070713_100118034
718 Ga0070710_10055273
719 Ga0070710_10853985
720 Ga0070701_10327453
721 Ga0070711_100254314
722 Ga0070711_100370880
723 Ga0070694_100057857
724 Ga0070694_101072319
725 Ga0070662_100418864
726 Ga0070681_10482778
727 Ga0070679_100537428
728 Ga0070679_101154276
729 Ga0070684_100361592
730 Ga0070672_100000006
731 Ga0070672_100661310
732 Ga0070686_100032588
733 Ga0070686_100238476
734 Ga0070686_100261313
735 Ga0070686_100755777
736 Ga0070693_100381524
737 Ga0070665_100001866
738 Ga0070665_100008395
739 Ga0070665_100033959
740 Ga0070665_101527013
741 Ga0070704_100006370
742 Ga0068855_100380075
743 Ga0070664_100614610
744 Ga0068854_100452145
745 Ga0068856_100018879
746 Ga0068856_100756211
747 Ga0068856_100858202
748 Ga0068856_101015437
749 Ga0070702_100037364
750 Ga0070702_100656846
751 Ga0068859_100396824
752 Ga0068864_100658842
753 Ga0068866_11381218
754 Ga0068861_101125445
755 Ga0068861_102552591
756 Ga0068851_10009301
757 Ga0068870_10167574
758 Ga0068858_100379027
759 Ga0068862_101594096
760 Ga0081455_10050913
761 Ga0081455_10097270
762 Ga0081455_10163737
763 Ga0081455_10610035
764 Ga0081538_10002861
765 Ga0081538_10051607
766 Ga0081538_10053388
767 Ga0081538_10119889
768 Ga0081538_10260096
769 Ga0070717_10000059
770 Ga0070717_10251639
771 Ga0070717_10468574
772 Ga0075365_10000158
773 Ga0075365_10002071
774 Ga0075364_10114989
775 Ga0075364_10310660
776 Ga0070716_100795508
777 Ga0070716_100799390
778 Ga0070712_100026084
779 Ga0070712_100054799
780 Ga0075428_100133518
781 Ga0075428_100480278
782 Ga0075428_101101227
783 Ga0075430_100011782
784 Ga0075430_100630442
785 Ga0075433_10272394
786 Ga0075434_100031586
787 Ga0068865_100712640
788 Ga0097620_100396878
789 Ga0075435_100474412
790 Ga0105240_10064000
791 Ga0111539_10042881
792 Ga0105245_10011975
793 Ga0105245_10270474
794 Ga0105245_10797700
795 Ga0105245_10848675
796 Ga0105247_10018428
797 Ga0114129_10303054
798 Ga0114129_10553480
799 Ga0114129_10784278
800 Ga0114129_11415415
801 Ga0114129_11942596
802 Ga0114129_13161450
803 Ga0105243_11078567
804 Ga0105243_11186303
805 Ga0105242_11217990
806 Ga0105248_10710402
807 Ga0105248_11493229
808 Ga0105238_10172387
809 Ga0105238_12281196
810 Ga0105249_10747897
811 Ga0105239_10582548
812 Ga0105239_11270446
813 Ga0157369_11189321
814 Ga0157369_11990158
815 Ga0157374_10217168
816 Ga0157378_10073920
817 Ga0157378_13272634
818 Ga0157372_11131288
819 Ga0157375_10049442
820 Ga0157375_10396991
821 Ga0157375_10834770
822 Ga0157375_11230132
823 Ga0163163_10386323
824 Ga0163163_11973940
825 Ga0157380_11251118
826 Ga0157379_10110920
827 Ga0157379_11813541
828 Ga0206353_10847558
829 Ga0213873_10122001
830 Ga0213873_10124902
831 Ga0213874_10006438
832 Ga0213874_10060970
833 Ga0213874_10084380
834 Ga0213874_10313059
835 Ga0213876_10011033
836 Ga0213876_10019513
837 Ga0213876_10034343
838 Ga0213876_10065915
839 Ga0213876_10330837
840 Ga0213876_10552621
841 Ga0213875_10000106
842 Ga0213875_10024780
843 Ga0213875_10043050
844 Ga0213875_10144759
845 Ga0213875_10171521
846 Ga0213875_10288005
847 Ga0213875_10555631
848 Ga0213875_10576428
849 Ga0207656_10005231
850 Ga0207692_10026278
851 Ga0207692_10795363
852 Ga0207642_11054202
853 Ga0207688_10047287
854 Ga0207688_10646089
855 Ga0207685_10479813
856 Ga0207654_10587763
857 Ga0207707_10516203
858 Ga0207695_10046537
859 Ga0207671_10790563
860 Ga0207693_10105121
861 Ga0207693_10119076
862 Ga0207693_10129091
863 Ga0207663_10101267
864 Ga0207663_10167199
865 Ga0207663_10305879
866 Ga0207660_10734789
867 Ga0207660_11401199
868 Ga0207662_11182603
869 Ga0207657_10030488
870 Ga0207657_10137856
871 Ga0207657_10520514
872 Ga0207649_11021732
873 Ga0207652_10103593
874 Ga0207681_10002889
875 Ga0207681_10053420
876 Ga0207650_10879714
877 Ga0207687_10303954
878 Ga0207687_10871604
879 Ga0207700_10672099
880 Ga0207700_10772794
881 Ga0207664_10014054
882 Ga0207664_10065744
883 Ga0207664_10078573
884 Ga0207664_10344595
885 Ga0207690_10003023
886 Ga0207706_10877268
887 Ga0207686_10154047
888 Ga0207686_10663453
889 Ga0207709_10008379
890 Ga0207709_11608832
891 Ga0207665_10093192
892 Ga0207665_10517341
893 Ga0207665_10694215
894 Ga0207691_10000025
895 Ga0207691_10522045
896 Ga0207679_10747751
897 Ga0207667_10421053
898 Ga0207651_10002519
899 Ga0207651_10482047
900 Ga0207668_10594542
901 Ga0207640_11249881
902 Ga0207640_11719644
903 Ga0207677_10000588
904 Ga0207677_11350716
905 Ga0207677_12048517
906 Ga0207677_12081922
907 Ga0207703_10572816
908 Ga0207678_10138332
909 Ga0207708_11505707
910 Ga0207702_10111606
911 Ga0207702_10148760
912 Ga0207702_10882889
913 Ga0207702_10920213
914 Ga0207648_11185887
915 Ga0207676_10646894
916 Ga0207675_101179971
917 Ga0207675_101226394
918 Ga0207683_10055920
919 Ga0207428_10181929
920 Ga0268266_10001339
921 Ga0268266_10014424
922 Ga0268266_10813414
923 Ga0268265_10833613
924 Ga0268265_11755244
925 Ga0265326_10000023
926 Ga0265319_1001040
927 Ga0265319_1003583
928 Ga0265334_10000094
929 Ga0265318_10005856
930 Ga0265336_10011417
931 Ga0265338_10029093
932 Ga0265338_10067722
933 Ga0265338_10276200
934 Ga0265338_10501607
935 Ga0265324_10001935
936 Ga0265332_10380113
937 Ga0265320_10035744
938 Ga0265320_10058750
939 Ga0265325_10185219
940 Ga0265339_10366714
941 Ga0265331_10508330
942 Ga0265327_10023435
943 Ga0265316_10023231
944 Ga0265316_10189620
945 Ga0265316_10442493
946 Ga0307408_100117441
947 Ga0265314_10030115
948 Ga0265314_10096510
949 Ga0307405_10075124
950 Ga0307413_10484487
951 Ga0307410_10081269
952 Ga0307410_10423416
953 Ga0307410_10485675
954 Ga0326468_10034084
955 Ga0307406_11105679
956 Ga0307406_11971622
957 Ga0307407_10003149
958 Ga0307407_11149511
959 Ga0307409_100047814
960 Ga0307409_100326672
961 Ga0307409_100466757
962 Ga0307409_101335600
963 Ga0307416_100003580
964 Ga0307416_100047928
965 Ga0307416_102785142
966 Ga0307414_10388927
967 Ga0307414_10977472
968 Ga0307414_11211415
969 Ga0307414_11687401
970 Ga0307415_100000324
971 Ga0307415_100250253
972 Ga0307415_100665735
973 Ga0307415_102348439
974 Ga0373944_0285159
975 Ga0373956_0213875
976 Ga0373956_0435051
977 Ga0373957_0066286
978 Ga0373962_0314071
979 Ga0316574_0061279
980 Ga0316574_0579299
981 Ga0316574_0831369
982 Ga0373924_0050114
983 Ga0373933_0014588
984 Ga0373933_0343047
985 Ga0373947_0065426
986 Ga0373925_0855211
987 Ga0395900_0010749
988 Ga0395900_0143888
989 Ga0395900_0159569
990 Ga0395898_0000631
991 Ga0395898_0086657
992 Ga0395898_0989048
993 Ga0395898_1148599
994 Ga0436364_0250118
995 Ga0436364_0507893
996 Ga0436364_0737248
997 Ga0436364_1005245
998 Ga0436364_1052875
999 Ga0436364_1101297
1000 Ga0436364_1102009
1001 Ga0436364_1178904
1002 Ga0436364_1474896
1003 Ga0436364_1515506
1004 Ga0395901_0039194
1005 Ga0395901_0235929
1006 Ga0395901_0357338
1007 Ga0395901_0756734
1008 Ga0395901_1645020
1009 Ga0395901_2090601
1010 Ga0436365_0068887
1011 Ga0436365_0113281
1012 Ga0436365_0313384
1013 Ga0436365_0716929
1014 Ga0436365_0800156
1015 Ga0436365_0958190
1016 Ga0436365_1141778
1017 Ga0436365_1192690
1018 Ga0436365_1295859
1019 Ga0436365_1882637
1020 Ga0436363_0039289
1021 Ga0436363_0360923
1022 Ga0436363_0536742
1023 Ga0436363_0601355
1024 Ga0436363_0736430
1025 Ga0436363_0789063
1026 Ga0436363_0946888
1027 Ga0436363_1185869
1028 Ga0436363_1291302
1029 Ga0436363_1672350
1030 Ga0436362_0311779
1031 Ga0436362_0628620
1032 Ga0436362_0850610
1033 Ga0436362_1086560
1034 Ga0436362_1271673
1035 Ga0451793_0193853
1036 Ga0451793_1392739
1037 Ga0451837_0935578
1038 Ga0451851_0314483
1039 Ga0451855_1418440
1040 Ga0451853_0494759
1041 Ga0451853_1497085
1042 Ga0466969_0013812
1043 Ga0466969_0056660
1044 Ga0466969_0256212
1045 Ga0466969_0272283
1046 Ga0466965_0169910
1047 Ga0466965_0239398
1048 Ga0466966_0097008
1049 Ga0466966_0157960
1050 Ga0466966_0455701
1051 Ga0466966_0574923
1052 Ga0466966_0832345
1053 Ga0466961_0017167
1054 Ga0466961_0078623
1055 Ga0466961_0192980
1056 Ga0466961_0221551
1057 Ga0466963_0006005
1058 Ga0466963_0020264
1059 Ga0466963_0055415
1060 Ga0466963_0060879
1061 Ga0466963_0101820
1062 Ga0466963_0113332
1063 Ga0466963_0255891
1064 Ga0466963_0266995
1065 Ga0466963_0328218
1066 Ga0466964_0567311
1067 Ga0466964_0616217
1068 Ga0466971_0012773
1069 Ga0466971_0046609
1070 Ga0466971_0084529
1071 Ga0466971_0120313
1072 Ga0466971_0293381
1073 Ga0466971_0610799
1074 Ga0466968_0083616
1075 Ga0466968_0096526
1076 Ga0466968_0382912
1077 Ga0466968_0711187
1078 Ga0466970_0050384
1079 Ga0466970_0214361
1080 Ga0466957_0001241
1081 Ga0466957_0065156
1082 Ga0466957_0159843
1083 Ga0466959_0018132
1084 Ga0466959_0020796
1085 Ga0466959_0039655
1086 Ga0466959_0059497
1087 Ga0466959_0084072
1088 Ga0466959_0190419
1089 Ga0466959_0222458
1090 Ga0466959_0358911
1091 Ga0466959_0647204
1092 Ga0466959_0993486
1093 Ga0466958_0003810
1094 Ga0466958_0007175
1095 Ga0466958_0024464
1096 Ga0466958_0032444
1097 Ga0466958_0085550
1098 Ga0466958_0096644
1099 Ga0466958_0208642
1100 Ga0466958_0257764
1101 Ga0466958_0357917
1102 Ga0466958_0751236
1103 Ga0466967_0037261
1104 Ga0466967_0062085
1105 Ga0466967_0075696
1106 Ga0466967_0105085
1107 Ga0466967_0159659
1108 Ga0466967_0246555
1109 Ga0466967_0300495
1110 Ga0466967_0710168
1111 Ga0466967_0830432
1112 Ga0466967_1286660
1113 Ga0466967_2462954
1114 Ga0495592_0030943
1115 Ga0495603_0242802
1116 Ga0495629_0003726
1117 Ga0495629_0434550
1118 Ga0495629_0591187
1119 Ga0495629_0770103
1120 Ga0495641_0051021
1121 Ga0495641_0074257
1122 Ga0495651_0004867
1123 Ga0495653_0033045
1124 Ga0495653_0463396
1125 Ga0495582_0226761
1126 Ga0495662_0599298
1127 Ga0495664_0377501
1128 Ga0495606_0000108
1129 Ga0495608_0003879
1130 Ga0495608_0291674
1131 Ga0495618_0046928
1132 Ga0495618_0624058
1133 Ga0495628_0018094
1134 Ga0495628_0021870
1135 Ga0495632_0434407
1136 Ga0495637_0131131
1137 Ga0495652_0142751
1138 Ga0495640_0247997
1139 Ga0495640_0712522
1140 Ga0495587_0116744
1141 Ga0495587_0145822
1142 Ga0495645_0738642
1143 Ga0495667_0301478
1144 Ga0495656_0704416
1145 Ga0495634_0048594
1146 Ga0495635_0014024
1147 Ga0495657_0011453
1148 Ga0495599_0212601
1149 Ga0495623_0062310
1150 Ga0495646_0005200
1151 Ga0495646_0277982
1152 Ga0495646_0504030
1153 Ga0495658_0296137
1154 Ga0495613_0000481
1155 Ga0495613_0019719
1156 Ga0495613_0716604
1157 Ga0495600_0014323
1158 Ga0495600_0171546
1159 Ga0495660_0136749
1160 Ga0495581_0353535
1161 Ga0495604_0000122
1162 Ga0495604_0058912
1163 Ga0495604_0160516
1164 Ga0495604_0212401
1165 Ga0495676_0374613
1166 Ga0495680_0007443
1167 Ga0495680_0254816
1168 Ga0495675_0131164
1169 Ga0495675_0352930
1170 Ga0495673_0201885
1171 Ga0495684_0048223
1172 Ga0495684_0717552
1173 Ga0495593_0103107
1174 Ga0495593_0582602
1175 Ga0495602_0000166
1176 Ga0495602_0077890
1177 Ga0495614_0368817
1178 Ga0496100_0000550
1179 Ga0496100_0012930
1180 Ga0496100_0393541
1181 Ga0496100_0682967
1182 Ga0496100_0932486
1183 Ga0496101_0000482
1184 Ga0496102_0015555
1185 Ga0496102_0146432
1186 Ga0496102_0399822
1187 Ga0496103_0006110
1188 Ga0496103_0252877
1189 Ga0496104_0000036
1190 Ga0496104_0015670
1191 Ga0496104_0033484
1192 Ga0496104_0044152
1193 Ga0496104_0142271
1194 Ga0496104_0344654
1195 Ga0496104_0426977
1196 Ga0496104_0448806
1197 Ga0496104_0697506
1198 Ga0496105_0001296
1199 Ga0496105_0084316
1200 Ga0496105_0137402
1201 Ga0496105_0175753
1202 Ga0496105_0180944
1203 Ga0496105_0194203
1204 Ga0496105_0385700
1205 Ga0496106_0001486
1206 Ga0496106_0141739
1207 Ga0496106_0634807
1208 Ga0496106_0769546
1209 Ga0496107_0048298
1210 Ga0496107_0460355
1211 Ga0496108_0019473
1212 Ga0496108_0020600
1213 Ga0496108_0109350
1214 Ga0496108_1283565
1215 Ga0496109_0016063
1216 Ga0496109_0060304
1217 Ga0496109_0075758
1218 Ga0496109_0199188
1219 Ga0496109_0226539
1220 Ga0496109_1698342
1221 Ga0496110_0001701
1222 Ga0496110_0002877
1223 Ga0496110_0182516
1224 Ga0496110_0322200
1225 Ga0496110_0357776
1226 Ga0496110_0523199
1227 Ga0496111_0000350
1228 Ga0496111_0029875
1229 Ga0496111_0071035
1230 Ga0496111_0440263
1231 Ga0496112_0020305
1232 Ga0496112_0036220
1233 Ga0496112_0039625
1234 Ga0496112_0087300
1235 Ga0496112_0235090
1236 Ga0496112_0361120
1237 Ga0496112_0782337
1238 Ga0496112_1398250
1239 Ga0496113_0000202
1240 Ga0496113_0009415
1241 Ga0496113_0041244
1242 Ga0496113_0066935
1243 Ga0496113_0077370
1244 Ga0496113_0283602
1245 Ga0496113_0408456
1246 Ga0496113_0753086
1247 Ga0496114_0008571
1248 Ga0496114_0297289
1249 Ga0496114_0933630
1250 Ga0496114_0979270
1251 Ga0496115_0001473
1252 Ga0496115_0301804
1253 Ga0496115_0683612
1254 Ga0496121_0007203
1255 Ga0496124_0618755
1256 Ga0501031_0237588
1257 Ga0501031_0834288
1258 Ga0501032_0145375
1259 Ga0501034_1622209
1260 Ga0501036_0074996
1261 Ga0501036_0245087
1262 Ga0501038_0130467
1263 Ga0501038_0168211
1264 Ga0501038_0456135
1265 Ga0501039_0087565
1266 Ga0501039_0220759
1267 Ga0501040_0058641
1268 Ga0501040_0255059
1269 Ga0501040_0614791
1270 Ga0501041_0123454
1271 Ga0501042_0031139
1272 Ga0501042_0034935
1273 Ga0501042_0126318
1274 Ga0501042_0174462
1275 Ga0501042_0409076
1276 Ga0501046_0157947
1277 Ga0501046_0601036
1278 Ga0501047_0014597
1279 Ga0501048_0022909
1280 Ga0501067_0037273
1281 Ga0501067_0053078
1282 Ga0501068_0188641
1283 Ga0501068_0472486
1284 Ga0501068_0649045
1285 Ga0501070_0890167
1286 Ga0501071_0030177
1287 Ga0501071_0348943
1288 Ga0501071_0551916
1289 Ga0501072_0029142
1290 Ga0501072_0036654
1291 Ga0501072_0037453
1292 Ga0501072_0040529
1293 Ga0501072_0891341
1294 Ga0501074_0012758
1295 Ga0501074_0346736
1296 Ga0501075_0026861
1297 Ga0501075_0079945
1298 Ga0501075_0117916
1299 Ga0501075_0212872
1300 Ga0501076_0012426
1301 Ga0501076_0662521
1302 Ga0501077_0034397
1303 Ga0501077_0109420
1304 Ga0501077_0652834
1305 Ga0501253_201272
1306 Ga0501257_238729
1307 Ga0501219_029039
1308 Ga0501079_0033846
1309 Ga0501079_0034736
1310 Ga0501079_0053336
1311 Ga0501079_0882542
1312 Ga0501080_0812519
1313 Ga0501081_0015934
1314 Ga0501081_0064433
1315 Ga0501081_0395037
1316 Ga0501083_0260658
1317 Ga0501044_0390383
1318 Ga0501044_1269808
1319 Ga0501045_0043287
1320 Ga0501045_0386206
1321 Ga0501045_0816390
1322 nmdc:mga00v17_14470_c1
1323 nmdc:mga00v17_147508_c1
1324 nmdc:mga0yw44_1730_c1
1325 nmdc:mga0yw44_260608_c1
1326 nmdc:mga0yw44_5273_c1
1327 nmdc:mga06z11_636634_c1
1328 nmdc:mga04h51_71594_c1
1329 nmdc:mga05p37_294940_c1
1330 nmdc:mga05p37_631203_c1
1331 nmdc:mga0qj67_1002073_c1
1332 nmdc:mga0qj67_1160_c2
1333 nmdc:mga06r32_1438896_c1
1334 nmdc:mga06r32_213078_c1
1335 nmdc:mga08y16_1268510_c1
1336 nmdc:mga08y16_256305_c1
1337 nmdc:mga0n895_87857_c1
1338 nmdc:mga0rr50_272346_c1
1339 nmdc:mga0a205_284648_c1
1340 Ga0495601_0000034
1341 Ga0495601_0215974
1342 Ga0495612_0000024
1343 Ga0495595_0002896
1344 Ga0495595_0043540
1345 Ga0495595_0188379
1346 Ga0495619_0010562
1347 Ga0495619_0018318
1348 Ga0495619_0059486
1349 Ga0495619_0959353
1350 Ga0500650_0112122
1351 Ga0501084_0022375
1352 Ga0501084_0082081
1353 Ga0501084_0134742
1354 Ga0501084_0495032
1355 Ga0590074_047020
1356 Ga0501082_0021822
1357 Ga0501082_0154432
1358 Ga0501082_0679043
1359 Ga0466962_0006004
1360 Ga0466962_0023577
1361 Ga0466962_0087088
1362 Ga0530510_0003840
1363 Ga0530510_0612294
1364 Ga0530510_0753470
1365 Ga0530510_1348862
1366 Ga0530510_1389704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

31

145

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9268 5 67
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.912 26 69
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9035 26 69
2y75-assembly1.cif.gz_E the structure of cymr (yrzc) the global cysteine regulator of b. subtilis 0.9022 1 120
1r23-assembly1.cif.gz_A crystal structure of the cyanobacterial metallothionein repressor smtb in the zn1-form (one zn(ii) per dimer) 0.8952 11 69
ID Description Score Start End Superfamily
af_Q9SVG6_22_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9323 11 57 1.10.10.10
af_Q2RAU2_5_159_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9312 13 58 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 5 67 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.912 26 69 1.10.10.10
1r22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9101 11 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0LPA1-F1-model_v4 Rrf2 family transcriptional regulator 0.9749 1 117 GO:0003700
GO:0005829
AF-A0A538EA57-F1-model_v4 Rrf2 family transcriptional regulator 0.9539 1 121 GO:0003700
GO:0005829
AF-A0A7W0LPA1-F1-model_v4 Rrf2 family transcriptional regulator 0.951 1 117 GO:0003700
GO:0005829
AF-A0A538EA57-F1-model_v4 Rrf2 family transcriptional regulator 0.9386 1 121 GO:0003700
GO:0005829
AF-A0A522C4Q6-F1-model_v4 Rrf2 family transcriptional regulator 0.9341 1 94 GO:0003700
GO:0005829

Map