F474960
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 340 | 682 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100016195|Ga0070671_1000161952 |
| Length | 223 |
| Sequence | MEPLKRRGDSIGAMIRPAKAPRHFSMIRGFHLADFFTLANAACGMGAIFLAMIHVGSHAASHFYAAAAMAPAALLFDVLDGRIARWRREHSALGRELDSLADVISFGVAPATLAYAAGLRGGWDMIALIYFVCCGVSRLARYNVTADDLSAGSGKVSYFEGTPIPTTVLLTAVLAFAAWRGRLDENIFGGMWMLGPWQIHPLVLLFVASGTLMVSKTLRIPKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 89 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 228 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 229 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 230 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 231 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 234 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 280 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 281 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 283 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 284 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 286 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 301 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 304 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 307 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 309 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 311 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 315 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 318 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 319 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 320 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 321 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 323 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 326 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 0.44 |
| Rhizoplane | 3.37 |
| Rhizosphere | 92.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1003387 | 3300001976 | Bacteria | 2098 |
| 2 | JGI24034J26672_10023104 | 3300002239 | Bacteria | 986 |
| 3 | rootH1_10009155 | 3300003323 | Bacteria | 18521 |
| 4 | Ga0055526_1004475 | 3300003771 | Bacteria | 8379 |
| 5 | Ga0055540_1013809 | 3300003792 | Bacteria | 2445 |
| 6 | Ga0058861_10054973 | 3300004800 | Bacteria | 2128 |
| 7 | Ga0065712_10075717 | 3300005290 | Bacteria | 3802 |
| 8 | Ga0065715_10488263 | 3300005293 | Bacteria | 791 |
| 9 | Ga0065707_10090900 | 3300005295 | Bacteria | 4027 |
| 10 | Ga0070676_10003923 | 3300005328 | Bacteria | 7807 |
| 11 | Ga0070676_10039107 | 3300005328 | Bacteria | 2742 |
| 12 | Ga0070676_10076191 | 3300005328 | Bacteria | 2024 |
| 13 | Ga0070683_100050405 | 3300005329 | Bacteria | 3854 |
| 14 | Ga0070690_100054133 | 3300005330 | Bacteria | 2569 |
| 15 | Ga0070690_100086712 | 3300005330 | Bacteria | 2055 |
| 16 | Ga0070670_100000604 | 3300005331 | Bacteria | 28187 |
| 17 | Ga0070670_100029853 | 3300005331 | Bacteria | 4696 |
| 18 | Ga0070670_100294175 | 3300005331 | Bacteria | 1419 |
| 19 | Ga0070670_100377568 | 3300005331 | Bacteria | 1248 |
| 20 | Ga0070670_100768633 | 3300005331 | Bacteria | 869 |
| 21 | Ga0070677_10216060 | 3300005333 | Bacteria | 934 |
| 22 | Ga0068869_100001219 | 3300005334 | Bacteria | 15131 |
| 23 | Ga0068869_100011586 | 3300005334 | Bacteria | 5789 |
| 24 | Ga0068869_100055916 | 3300005334 | Bacteria | 2877 |
| 25 | Ga0068869_100100543 | 3300005334 | Bacteria | 2187 |
| 26 | Ga0068869_100200787 | 3300005334 | Bacteria | 1572 |
| 27 | Ga0070666_10094671 | 3300005335 | Bacteria | 2055 |
| 28 | Ga0070666_10256842 | 3300005335 | Bacteria | 1238 |
| 29 | Ga0070680_100078774 | 3300005336 | Unclassified | 2715 |
| 30 | Ga0070680_100102715 | 3300005336 | Bacteria | 2374 |
| 31 | Ga0070680_100142754 | 3300005336 | Bacteria | 2008 |
| 32 | Ga0070680_100155563 | 3300005336 | Bacteria | 1920 |
| 33 | Ga0070682_100439851 | 3300005337 | Bacteria | 996 |
| 34 | Ga0068868_100058625 | 3300005338 | Bacteria | 3043 |
| 35 | Ga0068868_100211162 | 3300005338 | Bacteria | 1622 |
| 36 | Ga0070660_100042423 | 3300005339 | Bacteria | 3472 |
| 37 | Ga0070689_100000594 | 3300005340 | Bacteria | 21856 |
| 38 | Ga0070689_100291286 | 3300005340 | Bacteria | 1357 |
| 39 | Ga0070689_100395205 | 3300005340 | Bacteria | 1167 |
| 40 | Ga0070691_10155946 | 3300005341 | Bacteria | 1174 |
| 41 | Ga0070691_10164594 | 3300005341 | Bacteria | 1145 |
| 42 | Ga0070687_100062226 | 3300005343 | Bacteria | 1975 |
| 43 | Ga0070687_100079654 | 3300005343 | Bacteria | 1784 |
| 44 | Ga0070687_100109105 | 3300005343 | Bacteria | 1563 |
| 45 | Ga0070687_100298592 | 3300005343 | Bacteria | 1021 |
| 46 | Ga0070661_100087149 | 3300005344 | Bacteria | 2309 |
| 47 | Ga0070668_100005159 | 3300005347 | Bacteria | 9689 |
| 48 | Ga0070668_100012530 | 3300005347 | Bacteria | 6315 |
| 49 | Ga0070668_100139844 | 3300005347 | Bacteria | 1950 |
| 50 | Ga0070669_100004561 | 3300005353 | Bacteria | 9996 |
| 51 | Ga0070669_100006331 | 3300005353 | Bacteria | 8534 |
| 52 | Ga0070669_100134960 | 3300005353 | Bacteria | 1897 |
| 53 | Ga0070669_100282904 | 3300005353 | Bacteria | 1329 |
| 54 | Ga0070669_100481719 | 3300005353 | Bacteria | 1027 |
| 55 | Ga0070675_100006929 | 3300005354 | Bacteria | 8703 |
| 56 | Ga0070675_100014015 | 3300005354 | Bacteria | 6313 |
| 57 | Ga0070675_100018866 | 3300005354 | Bacteria | 5492 |
| 58 | Ga0070675_100083893 | 3300005354 | Bacteria | 2660 |
| 59 | Ga0070675_100104335 | 3300005354 | Bacteria | 2391 |
| 60 | Ga0070675_100763391 | 3300005354 | Bacteria | 883 |
| 61 | Ga0070671_100016195 | 3300005355 | Bacteria | 6029 |
| 62 | Ga0070671_100055638 | 3300005355 | Bacteria | 3291 |
| 63 | Ga0070671_100064503 | 3300005355 | Bacteria | 3050 |
| 64 | Ga0070671_100646259 | 3300005355 | Bacteria | 916 |
| 65 | Ga0070674_100083440 | 3300005356 | Bacteria | 2288 |
| 66 | Ga0070674_100399624 | 3300005356 | Bacteria | 1122 |
| 67 | Ga0070674_100729456 | 3300005356 | Bacteria | 850 |
| 68 | Ga0070673_100004218 | 3300005364 | Bacteria | 9071 |
| 69 | Ga0070673_100006929 | 3300005364 | Bacteria | 7414 |
| 70 | Ga0070673_100043974 | 3300005364 | Bacteria | 3456 |
| 71 | Ga0070673_100130428 | 3300005364 | Bacteria | 2108 |
| 72 | Ga0070673_100303350 | 3300005364 | Bacteria | 1406 |
| 73 | Ga0070688_100053437 | 3300005365 | Bacteria | 2527 |
| 74 | Ga0070688_100145258 | 3300005365 | Bacteria | 1615 |
| 75 | Ga0070688_100480134 | 3300005365 | Bacteria | 934 |
| 76 | Ga0070659_100012718 | 3300005366 | Bacteria | 6246 |
| 77 | Ga0070659_100214244 | 3300005366 | Bacteria | 1588 |
| 78 | Ga0070659_100288786 | 3300005366 | Bacteria | 1366 |
| 79 | Ga0070667_100011931 | 3300005367 | Bacteria | 7189 |
| 80 | Ga0070667_100140314 | 3300005367 | Bacteria | 2116 |
| 81 | Ga0070667_100255851 | 3300005367 | Bacteria | 1566 |
| 82 | Ga0070667_100307065 | 3300005367 | Bacteria | 1429 |
| 83 | Ga0070667_100549376 | 3300005367 | Bacteria | 1061 |
| 84 | Ga0070701_10042281 | 3300005438 | Bacteria | 2326 |
| 85 | Ga0070701_10232516 | 3300005438 | Bacteria | 1105 |
| 86 | Ga0070700_100000367 | 3300005441 | Bacteria | 23131 |
| 87 | Ga0070700_100005117 | 3300005441 | Bacteria | 6919 |
| 88 | Ga0070700_100028528 | 3300005441 | Bacteria | 3321 |
| 89 | Ga0070700_100057948 | 3300005441 | Bacteria | 2432 |
| 90 | Ga0070700_100101352 | 3300005441 | Bacteria | 1897 |
| 91 | Ga0070700_100105938 | 3300005441 | Bacteria | 1860 |
| 92 | Ga0070694_100207655 | 3300005444 | Bacteria | 1463 |
| 93 | Ga0070708_100299229 | 3300005445 | Unclassified | 1515 |
| 94 | Ga0070678_100264441 | 3300005456 | Bacteria | 1448 |
| 95 | Ga0070662_100101534 | 3300005457 | Bacteria | 2177 |
| 96 | Ga0070662_100113468 | 3300005457 | Bacteria | 2068 |
| 97 | Ga0070681_10027047 | 3300005458 | Bacteria | 5768 |
| 98 | Ga0070681_10036389 | 3300005458 | Unclassified | 4943 |
| 99 | Ga0068867_100001130 | 3300005459 | Bacteria | 18235 |
| 100 | Ga0068867_100009485 | 3300005459 | Bacteria | 6865 |
| 101 | Ga0068867_100010602 | 3300005459 | Bacteria | 6501 |
| 102 | Ga0068867_100011974 | 3300005459 | Bacteria | 6128 |
| 103 | Ga0068867_100173276 | 3300005459 | Bacteria | 1710 |
| 104 | Ga0068867_100185706 | 3300005459 | Bacteria | 1656 |
| 105 | Ga0070685_10041656 | 3300005466 | Bacteria | 2618 |
| 106 | Ga0070685_10573195 | 3300005466 | Bacteria | 809 |
| 107 | Ga0070706_100000846 | 3300005467 | Bacteria | 33705 |
| 108 | Ga0070706_100043457 | 3300005467 | Bacteria | 4152 |
| 109 | Ga0070706_101053980 | 3300005467 | Bacteria | 749 |
| 110 | Ga0070707_100000587 | 3300005468 | Bacteria | 36579 |
| 111 | Ga0070707_100041532 | 3300005468 | Bacteria | 4402 |
| 112 | Ga0070707_100086817 | 3300005468 | Bacteria | 3026 |
| 113 | Ga0070698_100009454 | 3300005471 | Bacteria | 10444 |
| 114 | Ga0070698_100091390 | 3300005471 | Bacteria | 3027 |
| 115 | Ga0070698_100626244 | 3300005471 | Bacteria | 1017 |
| 116 | Ga0070699_100080389 | 3300005518 | Bacteria | 2841 |
| 117 | Ga0070699_100235144 | 3300005518 | Bacteria | 1634 |
| 118 | Ga0070679_100109674 | 3300005530 | Bacteria | 2746 |
| 119 | Ga0070684_100079120 | 3300005535 | Bacteria | 2906 |
| 120 | Ga0070697_100019292 | 3300005536 | Bacteria | 5386 |
| 121 | Ga0070697_100230533 | 3300005536 | Bacteria | 1580 |
| 122 | Ga0068853_100001930 | 3300005539 | Bacteria | 15284 |
| 123 | Ga0070672_100027941 | 3300005543 | Bacteria | 4214 |
| 124 | Ga0070672_100032608 | 3300005543 | Bacteria | 3934 |
| 125 | Ga0070672_100114420 | 3300005543 | Bacteria | 2202 |
| 126 | Ga0070672_100170355 | 3300005543 | Bacteria | 1811 |
| 127 | Ga0070686_100010270 | 3300005544 | Bacteria | 5273 |
| 128 | Ga0070686_100087760 | 3300005544 | Bacteria | 2074 |
| 129 | Ga0070686_100130573 | 3300005544 | Bacteria | 1737 |
| 130 | Ga0070695_100027112 | 3300005545 | Bacteria | 3547 |
| 131 | Ga0070696_100609556 | 3300005546 | Bacteria | 881 |
| 132 | Ga0070665_100441509 | 3300005548 | Bacteria | 1311 |
| 133 | Ga0070665_100449257 | 3300005548 | Bacteria | 1298 |
| 134 | Ga0070665_100801535 | 3300005548 | Bacteria | 955 |
| 135 | Ga0070704_100095414 | 3300005549 | Bacteria | 2227 |
| 136 | Ga0070704_100413031 | 3300005549 | Bacteria | 1154 |
| 137 | Ga0070704_100486434 | 3300005549 | Bacteria | 1069 |
| 138 | Ga0068855_100011783 | 3300005563 | Bacteria | 10574 |
| 139 | Ga0068855_100102398 | 3300005563 | Bacteria | 3296 |
| 140 | Ga0068855_100107689 | 3300005563 | Bacteria | 3202 |
| 141 | Ga0068855_100118103 | 3300005563 | Bacteria | 3038 |
| 142 | Ga0068857_100003353 | 3300005577 | Bacteria | 13334 |
| 143 | Ga0068857_100008057 | 3300005577 | Bacteria | 9087 |
| 144 | Ga0068857_100303716 | 3300005577 | Bacteria | 1471 |
| 145 | Ga0068857_100321976 | 3300005577 | Bacteria | 1428 |
| 146 | Ga0068857_100522407 | 3300005577 | Bacteria | 1116 |
| 147 | Ga0068854_100255150 | 3300005578 | Bacteria | 1402 |
| 148 | Ga0068854_100313817 | 3300005578 | Bacteria | 1272 |
| 149 | Ga0068856_100037185 | 3300005614 | Bacteria | 4776 |
| 150 | Ga0068856_100125323 | 3300005614 | Bacteria | 2572 |
| 151 | Ga0068856_100340697 | 3300005614 | Bacteria | 1517 |
| 152 | Ga0070702_100069776 | 3300005615 | Bacteria | 2072 |
| 153 | Ga0070702_100096073 | 3300005615 | Bacteria | 1808 |
| 154 | Ga0068852_100059661 | 3300005616 | Bacteria | 3309 |
| 155 | Ga0068859_100002178 | 3300005617 | Bacteria | 19895 |
| 156 | Ga0068859_100014884 | 3300005617 | Bacteria | 7810 |
| 157 | Ga0068859_100031453 | 3300005617 | Bacteria | 5330 |
| 158 | Ga0068859_100053334 | 3300005617 | Bacteria | 4067 |
| 159 | Ga0068859_100084020 | 3300005617 | Bacteria | 3228 |
| 160 | Ga0068859_100186622 | 3300005617 | Bacteria | 2157 |
| 161 | Ga0068864_100003861 | 3300005618 | Bacteria | 12345 |
| 162 | Ga0068864_100027295 | 3300005618 | Bacteria | 4820 |
| 163 | Ga0068864_100131896 | 3300005618 | Bacteria | 2245 |
| 164 | Ga0068864_100153290 | 3300005618 | Bacteria | 2089 |
| 165 | Ga0068866_10024646 | 3300005718 | Bacteria | 2818 |
| 166 | Ga0068866_10143228 | 3300005718 | Bacteria | 1375 |
| 167 | Ga0068861_100000843 | 3300005719 | Bacteria | 18576 |
| 168 | Ga0068861_100000932 | 3300005719 | Bacteria | 17784 |
| 169 | Ga0068861_100049010 | 3300005719 | Bacteria | 3196 |
| 170 | Ga0068861_100166995 | 3300005719 | Bacteria | 1820 |
| 171 | Ga0068861_100241805 | 3300005719 | Bacteria | 1536 |
| 172 | Ga0068851_10041909 | 3300005834 | Bacteria | 2303 |
| 173 | Ga0068870_10251292 | 3300005840 | Bacteria | 1096 |
| 174 | Ga0068863_100024480 | 3300005841 | Bacteria | 5757 |
| 175 | Ga0068863_100061807 | 3300005841 | Bacteria | 3542 |
| 176 | Ga0068863_100150511 | 3300005841 | Bacteria | 2227 |
| 177 | Ga0068863_100208293 | 3300005841 | Bacteria | 1882 |
| 178 | Ga0068858_100080516 | 3300005842 | Bacteria | 3026 |
| 179 | Ga0068858_100332947 | 3300005842 | Bacteria | 1452 |
| 180 | Ga0068860_100001499 | 3300005843 | Bacteria | 25181 |
| 181 | Ga0068860_100008189 | 3300005843 | Bacteria | 10405 |
| 182 | Ga0068860_100236638 | 3300005843 | Bacteria | 1775 |
| 183 | Ga0068860_100361199 | 3300005843 | Bacteria | 1431 |
| 184 | Ga0068862_100001468 | 3300005844 | Bacteria | 21680 |
| 185 | Ga0068862_100004126 | 3300005844 | Bacteria | 12308 |
| 186 | Ga0068862_100077379 | 3300005844 | Bacteria | 2880 |
| 187 | Ga0068862_100118728 | 3300005844 | Bacteria | 2328 |
| 188 | Ga0068862_100442481 | 3300005844 | Bacteria | 1224 |
| 189 | Ga0068862_100986743 | 3300005844 | Unclassified | 832 |
| 190 | Ga0075365_10008050 | 3300006038 | Bacteria | 5952 |
| 191 | Ga0075364_10249097 | 3300006051 | Bacteria | 1207 |
| 192 | Ga0075362_10035713 | 3300006177 | Bacteria | 2171 |
| 193 | Ga0075367_10000137 | 3300006178 | Bacteria | 21968 |
| 194 | Ga0075366_10001318 | 3300006195 | Bacteria | 12382 |
| 195 | Ga0075366_10111173 | 3300006195 | Bacteria | 1648 |
| 196 | Ga0097621_100018307 | 3300006237 | Bacteria | 5345 |
| 197 | Ga0097621_100079838 | 3300006237 | Bacteria | 2720 |
| 198 | Ga0097621_100387649 | 3300006237 | Bacteria | 1249 |
| 199 | Ga0068871_100080583 | 3300006358 | Bacteria | 2695 |
| 200 | Ga0068871_100168094 | 3300006358 | Bacteria | 1878 |
| 201 | Ga0068871_100318131 | 3300006358 | Bacteria | 1370 |
| 202 | Ga0075428_100000868 | 3300006844 | Bacteria | 31799 |
| 203 | Ga0075428_100090575 | 3300006844 | Bacteria | 3336 |
| 204 | Ga0075428_100671555 | 3300006844 | Bacteria | 1104 |
| 205 | Ga0075430_100005921 | 3300006846 | Bacteria | 10328 |
| 206 | Ga0075430_100058216 | 3300006846 | Bacteria | 3248 |
| 207 | Ga0075430_100095439 | 3300006846 | Bacteria | 2485 |
| 208 | Ga0075430_100097634 | 3300006846 | Bacteria | 2455 |
| 209 | Ga0075430_100213151 | 3300006846 | Bacteria | 1602 |
| 210 | Ga0075431_100003309 | 3300006847 | Bacteria | 15609 |
| 211 | Ga0075431_100013642 | 3300006847 | Bacteria | 8211 |
| 212 | Ga0075431_100056558 | 3300006847 | Bacteria | 4046 |
| 213 | Ga0075433_10142226 | 3300006852 | Bacteria | 2132 |
| 214 | Ga0075433_10380513 | 3300006852 | Bacteria | 1246 |
| 215 | Ga0075429_100000796 | 3300006880 | Bacteria | 24797 |
| 216 | Ga0075429_100007739 | 3300006880 | Bacteria | 9328 |
| 217 | Ga0075429_100017068 | 3300006880 | Bacteria | 6276 |
| 218 | Ga0075429_100797207 | 3300006880 | Bacteria | 827 |
| 219 | Ga0068865_100006209 | 3300006881 | Bacteria | 7283 |
| 220 | Ga0097620_100002178 | 3300006931 | Bacteria | 19895 |
| 221 | Ga0097620_100014883 | 3300006931 | Bacteria | 7810 |
| 222 | Ga0097620_100031453 | 3300006931 | Bacteria | 5330 |
| 223 | Ga0097620_100053330 | 3300006931 | Bacteria | 4067 |
| 224 | Ga0097620_100084021 | 3300006931 | Bacteria | 3228 |
| 225 | Ga0097620_100186618 | 3300006931 | Bacteria | 2157 |
| 226 | Ga0099824_1039530 | 3300006942 | Bacteria | 1202 |
| 227 | Ga0099823_1000003 | 3300006944 | Bacteria | 189058 |
| 228 | Ga0075435_100407323 | 3300007076 | Unclassified | 1170 |
| 229 | Ga0111539_10002695 | 3300009094 | Bacteria | 23526 |
| 230 | Ga0111539_10026457 | 3300009094 | Bacteria | 7092 |
| 231 | Ga0111539_10098895 | 3300009094 | Bacteria | 3426 |
| 232 | Ga0111539_10227395 | 3300009094 | Bacteria | 2173 |
| 233 | Ga0111539_10962797 | 3300009094 | Bacteria | 992 |
| 234 | Ga0105247_10410708 | 3300009101 | Bacteria | 967 |
| 235 | Ga0114129_10001859 | 3300009147 | Bacteria | 28771 |
| 236 | Ga0114129_10019694 | 3300009147 | Bacteria | 9605 |
| 237 | Ga0114129_10130914 | 3300009147 | Bacteria | 3446 |
| 238 | Ga0114129_10706265 | 3300009147 | Bacteria | 1295 |
| 239 | Ga0114129_10727170 | 3300009147 | Bacteria | 1273 |
| 240 | Ga0105243_10001846 | 3300009148 | Bacteria | 18113 |
| 241 | Ga0105243_10426877 | 3300009148 | Bacteria | 1238 |
| 242 | Ga0105243_10535292 | 3300009148 | Bacteria | 1116 |
| 243 | Ga0105241_10014623 | 3300009174 | Bacteria | 5746 |
| 244 | Ga0105241_10108152 | 3300009174 | Bacteria | 2222 |
| 245 | Ga0105242_11450534 | 3300009176 | Bacteria | 715 |
| 246 | Ga0105248_10011621 | 3300009177 | Bacteria | 9699 |
| 247 | Ga0105248_10028123 | 3300009177 | Bacteria | 6262 |
| 248 | Ga0105248_10425367 | 3300009177 | Bacteria | 1496 |
| 249 | Ga0105248_10745690 | 3300009177 | Bacteria | 1105 |
| 250 | Ga0105237_10101719 | 3300009545 | Bacteria | 2865 |
| 251 | Ga0105238_10011338 | 3300009551 | Bacteria | 8969 |
| 252 | Ga0105238_10017026 | 3300009551 | Bacteria | 7378 |
| 253 | Ga0105249_10003380 | 3300009553 | Bacteria | 13816 |
| 254 | Ga0105249_10143486 | 3300009553 | Bacteria | 2292 |
| 255 | Ga0105249_10333614 | 3300009553 | Bacteria | 1531 |
| 256 | Ga0105249_10694578 | 3300009553 | Bacteria | 1077 |
| 257 | Ga0105249_11306513 | 3300009553 | Unclassified | 797 |
| 258 | Ga0105249_11409970 | 3300009553 | Bacteria | 769 |
| 259 | Ga0105239_10100344 | 3300010375 | Bacteria | 3202 |
| 260 | Ga0105246_10098816 | 3300011119 | Bacteria | 2121 |
| 261 | Ga0105246_10305201 | 3300011119 | Bacteria | 1287 |
| 262 | Ga0105246_10497435 | 3300011119 | Bacteria | 1035 |
| 263 | Ga0157371_10196339 | 3300013102 | Bacteria | 1446 |
| 264 | Ga0157369_10047746 | 3300013105 | Bacteria | 4647 |
| 265 | Ga0157374_10094506 | 3300013296 | Bacteria | 2857 |
| 266 | Ga0157374_10167470 | 3300013296 | Bacteria | 2142 |
| 267 | Ga0163162_10017941 | 3300013306 | Bacteria | 6926 |
| 268 | Ga0163162_10107241 | 3300013306 | Bacteria | 2888 |
| 269 | Ga0163162_10462907 | 3300013306 | Bacteria | 1400 |
| 270 | Ga0163162_10749802 | 3300013306 | Bacteria | 1096 |
| 271 | Ga0163162_11575553 | 3300013306 | Bacteria | 749 |
| 272 | Ga0157372_10920345 | 3300013307 | Bacteria | 1014 |
| 273 | Ga0157375_10063699 | 3300013308 | Bacteria | 3669 |
| 274 | Ga0157375_10190221 | 3300013308 | Bacteria | 2207 |
| 275 | Ga0163163_10061531 | 3300014325 | Bacteria | 3720 |
| 276 | Ga0163163_10906038 | 3300014325 | Bacteria | 945 |
| 277 | Ga0157380_10018127 | 3300014326 | Bacteria | 5222 |
| 278 | Ga0157377_10190663 | 3300014745 | Bacteria | 1295 |
| 279 | Ga0157377_10219461 | 3300014745 | Bacteria | 1216 |
| 280 | Ga0157379_10254425 | 3300014968 | Bacteria | 1595 |
| 281 | Ga0157376_10073704 | 3300014969 | Bacteria | 2908 |
| 282 | Ga0163161_10135119 | 3300017792 | Bacteria | 1864 |
| 283 | Ga0163161_10299774 | 3300017792 | Bacteria | 1265 |
| 284 | Ga0206356_10399998 | 3300020070 | Bacteria | 1994 |
| 285 | Ga0209673_1013689 | 3300025273 | Bacteria | 3189 |
| 286 | Ga0207673_1002917 | 3300025290 | Bacteria | 1979 |
| 287 | Ga0209564_1000392 | 3300025295 | Bacteria | 78508 |
| 288 | Ga0209050_1001991 | 3300025298 | Bacteria | 19136 |
| 289 | Ga0209256_1000634 | 3300025299 | Bacteria | 47973 |
| 290 | Ga0209051_1001010 | 3300025303 | Bacteria | 27010 |
| 291 | Ga0209257_1001115 | 3300025304 | Bacteria | 34828 |
| 292 | Ga0207697_10011272 | 3300025315 | Bacteria | 3787 |
| 293 | Ga0207697_10023714 | 3300025315 | Bacteria | 2512 |
| 294 | Ga0207656_10043387 | 3300025321 | Bacteria | 1918 |
| 295 | Ga0207656_10065491 | 3300025321 | Bacteria | 1604 |
| 296 | Ga0207682_10001713 | 3300025893 | Bacteria | 10039 |
| 297 | Ga0207682_10007887 | 3300025893 | Bacteria | 4227 |
| 298 | Ga0207682_10020443 | 3300025893 | Bacteria | 2600 |
| 299 | Ga0207682_10191253 | 3300025893 | Bacteria | 938 |
| 300 | Ga0207642_10090307 | 3300025899 | Bacteria | 1511 |
| 301 | Ga0207688_10041449 | 3300025901 | Bacteria | 2561 |
| 302 | Ga0207688_10054690 | 3300025901 | Bacteria | 2240 |
| 303 | Ga0207688_10225475 | 3300025901 | Bacteria | 1130 |
| 304 | Ga0207680_10079468 | 3300025903 | Bacteria | 2057 |
| 305 | Ga0207645_10004033 | 3300025907 | Bacteria | 10944 |
| 306 | Ga0207645_10042424 | 3300025907 | Bacteria | 2910 |
| 307 | Ga0207645_10054179 | 3300025907 | Bacteria | 2562 |
| 308 | Ga0207643_10000819 | 3300025908 | Bacteria | 18894 |
| 309 | Ga0207643_10002644 | 3300025908 | Bacteria | 9697 |
| 310 | Ga0207643_10075000 | 3300025908 | Bacteria | 1951 |
| 311 | Ga0207643_10091593 | 3300025908 | Bacteria | 1773 |
| 312 | Ga0207684_10000363 | 3300025910 | Bacteria | 61249 |
| 313 | Ga0207684_10409763 | 3300025910 | Bacteria | 1165 |
| 314 | Ga0207654_10006976 | 3300025911 | Bacteria | 5692 |
| 315 | Ga0207707_10028670 | 3300025912 | Unclassified | 4865 |
| 316 | Ga0207707_10082358 | 3300025912 | Bacteria | 2810 |
| 317 | Ga0207695_10144075 | 3300025913 | Bacteria | 2328 |
| 318 | Ga0207671_10014674 | 3300025914 | Bacteria | 6180 |
| 319 | Ga0207671_10100964 | 3300025914 | Bacteria | 2185 |
| 320 | Ga0207663_10510540 | 3300025916 | Bacteria | 935 |
| 321 | Ga0207660_10261214 | 3300025917 | Bacteria | 1369 |
| 322 | Ga0207662_10000306 | 3300025918 | Bacteria | 22584 |
| 323 | Ga0207662_10009126 | 3300025918 | Bacteria | 5450 |
| 324 | Ga0207662_10010292 | 3300025918 | Bacteria | 5162 |
| 325 | Ga0207662_10184080 | 3300025918 | Bacteria | 1345 |
| 326 | Ga0207662_10226800 | 3300025918 | Bacteria | 1218 |
| 327 | Ga0207657_10037765 | 3300025919 | Bacteria | 4308 |
| 328 | Ga0207657_10216810 | 3300025919 | Bacteria | 1534 |
| 329 | Ga0207649_10056444 | 3300025920 | Bacteria | 2452 |
| 330 | Ga0207649_10082814 | 3300025920 | Bacteria | 2081 |
| 331 | Ga0207649_10414870 | 3300025920 | Bacteria | 1010 |
| 332 | Ga0207652_10214540 | 3300025921 | Unclassified | 1733 |
| 333 | Ga0207646_10000295 | 3300025922 | Bacteria | 67699 |
| 334 | Ga0207646_10037324 | 3300025922 | Bacteria | 4381 |
| 335 | Ga0207681_10003926 | 3300025923 | Bacteria | 9221 |
| 336 | Ga0207681_10089043 | 3300025923 | Bacteria | 2199 |
| 337 | Ga0207681_10218381 | 3300025923 | Bacteria | 1473 |
| 338 | Ga0207681_10409619 | 3300025923 | Bacteria | 1096 |
| 339 | Ga0207694_10008187 | 3300025924 | Bacteria | 7901 |
| 340 | Ga0207694_10145071 | 3300025924 | Bacteria | 1910 |
| 341 | Ga0207650_10000719 | 3300025925 | Bacteria | 25725 |
| 342 | Ga0207650_10015878 | 3300025925 | Bacteria | 5253 |
| 343 | Ga0207650_10028142 | 3300025925 | Bacteria | 4027 |
| 344 | Ga0207659_10016048 | 3300025926 | Bacteria | 4867 |
| 345 | Ga0207659_10026352 | 3300025926 | Bacteria | 3921 |
| 346 | Ga0207659_10092384 | 3300025926 | Bacteria | 2262 |
| 347 | Ga0207659_10158284 | 3300025926 | Bacteria | 1775 |
| 348 | Ga0207687_10011546 | 3300025927 | Bacteria | 5773 |
| 349 | Ga0207644_10027544 | 3300025931 | Bacteria | 3927 |
| 350 | Ga0207644_10028415 | 3300025931 | Bacteria | 3871 |
| 351 | Ga0207644_10101239 | 3300025931 | Bacteria | 2164 |
| 352 | Ga0207644_10875290 | 3300025931 | Bacteria | 752 |
| 353 | Ga0207690_10038419 | 3300025932 | Bacteria | 3116 |
| 354 | Ga0207706_10002678 | 3300025933 | Bacteria | 17355 |
| 355 | Ga0207706_10053095 | 3300025933 | Bacteria | 3578 |
| 356 | Ga0207706_10144575 | 3300025933 | Bacteria | 2092 |
| 357 | Ga0207686_10602517 | 3300025934 | Bacteria | 865 |
| 358 | Ga0207709_10001128 | 3300025935 | Bacteria | 19505 |
| 359 | Ga0207709_10251133 | 3300025935 | Bacteria | 1292 |
| 360 | Ga0207709_10369010 | 3300025935 | Bacteria | 1089 |
| 361 | Ga0207670_10000013 | 3300025936 | Bacteria | 211834 |
| 362 | Ga0207670_10106436 | 3300025936 | Bacteria | 2012 |
| 363 | Ga0207670_10129343 | 3300025936 | Bacteria | 1847 |
| 364 | Ga0207670_10163334 | 3300025936 | Bacteria | 1664 |
| 365 | Ga0207669_10036069 | 3300025937 | Bacteria | 2821 |
| 366 | Ga0207669_10234753 | 3300025937 | Bacteria | 1355 |
| 367 | Ga0207704_10006479 | 3300025938 | Bacteria | 5462 |
| 368 | Ga0207704_10323604 | 3300025938 | Bacteria | 1190 |
| 369 | Ga0207691_10004713 | 3300025940 | Bacteria | 13198 |
| 370 | Ga0207691_10012663 | 3300025940 | Bacteria | 8078 |
| 371 | Ga0207691_10059940 | 3300025940 | Bacteria | 3460 |
| 372 | Ga0207691_10148542 | 3300025940 | Bacteria | 2062 |
| 373 | Ga0207691_10166626 | 3300025940 | Bacteria | 1930 |
| 374 | Ga0207711_10017421 | 3300025941 | Bacteria | 5969 |
| 375 | Ga0207711_10087233 | 3300025941 | Bacteria | 2737 |
| 376 | Ga0207711_10088805 | 3300025941 | Bacteria | 2714 |
| 377 | Ga0207711_10446923 | 3300025941 | Bacteria | 1203 |
| 378 | Ga0207689_10000028 | 3300025942 | Bacteria | 100652 |
| 379 | Ga0207689_10005590 | 3300025942 | Bacteria | 11205 |
| 380 | Ga0207689_10021316 | 3300025942 | Bacteria | 5448 |
| 381 | Ga0207689_10069578 | 3300025942 | Bacteria | 2892 |
| 382 | Ga0207689_10100694 | 3300025942 | Bacteria | 2373 |
| 383 | Ga0207661_10146077 | 3300025944 | Bacteria | 2040 |
| 384 | Ga0207661_10209201 | 3300025944 | Bacteria | 1718 |
| 385 | Ga0207679_10003930 | 3300025945 | Bacteria | 9232 |
| 386 | Ga0207679_10114739 | 3300025945 | Bacteria | 2133 |
| 387 | Ga0207679_10430373 | 3300025945 | Bacteria | 1166 |
| 388 | Ga0207667_10007162 | 3300025949 | Bacteria | 13464 |
| 389 | Ga0207667_10052414 | 3300025949 | Bacteria | 4297 |
| 390 | Ga0207667_10069817 | 3300025949 | Bacteria | 3657 |
| 391 | Ga0207667_10155859 | 3300025949 | Bacteria | 2350 |
| 392 | Ga0207651_10069466 | 3300025960 | Bacteria | 2487 |
| 393 | Ga0207651_10447841 | 3300025960 | Bacteria | 1107 |
| 394 | Ga0207651_10800548 | 3300025960 | Bacteria | 835 |
| 395 | Ga0207712_10017823 | 3300025961 | Bacteria | 4618 |
| 396 | Ga0207712_10105366 | 3300025961 | Bacteria | 2104 |
| 397 | Ga0207712_10139452 | 3300025961 | Bacteria | 1859 |
| 398 | Ga0207668_10034095 | 3300025972 | Bacteria | 3378 |
| 399 | Ga0207640_10048338 | 3300025981 | Bacteria | 2749 |
| 400 | Ga0207640_10473241 | 3300025981 | Bacteria | 1037 |
| 401 | Ga0207658_10060269 | 3300025986 | Bacteria | 2831 |
| 402 | Ga0207658_10109112 | 3300025986 | Bacteria | 2184 |
| 403 | Ga0207658_10247193 | 3300025986 | Bacteria | 1514 |
| 404 | Ga0207658_10286707 | 3300025986 | Bacteria | 1413 |
| 405 | Ga0207677_10089943 | 3300026023 | Bacteria | 2230 |
| 406 | Ga0207677_10114488 | 3300026023 | Bacteria | 2015 |
| 407 | Ga0207677_10176760 | 3300026023 | Bacteria | 1675 |
| 408 | Ga0207703_10001188 | 3300026035 | Bacteria | 24487 |
| 409 | Ga0207703_10064744 | 3300026035 | Bacteria | 3001 |
| 410 | Ga0207703_10088963 | 3300026035 | Bacteria | 2593 |
| 411 | Ga0207703_10147891 | 3300026035 | Bacteria | 2045 |
| 412 | Ga0207639_10002176 | 3300026041 | Bacteria | 13192 |
| 413 | Ga0207708_10005815 | 3300026075 | Bacteria | 9124 |
| 414 | Ga0207708_10006203 | 3300026075 | Bacteria | 8861 |
| 415 | Ga0207708_10056929 | 3300026075 | Bacteria | 2982 |
| 416 | Ga0207702_10009516 | 3300026078 | Bacteria | 8160 |
| 417 | Ga0207702_10439099 | 3300026078 | Bacteria | 1265 |
| 418 | Ga0207702_10676646 | 3300026078 | Bacteria | 1016 |
| 419 | Ga0207641_10005314 | 3300026088 | Bacteria | 10999 |
| 420 | Ga0207641_10010772 | 3300026088 | Bacteria | 7497 |
| 421 | Ga0207641_10073120 | 3300026088 | Bacteria | 2954 |
| 422 | Ga0207641_10552492 | 3300026088 | Bacteria | 1123 |
| 423 | Ga0207641_10566156 | 3300026088 | Bacteria | 1109 |
| 424 | Ga0207648_10003835 | 3300026089 | Bacteria | 15703 |
| 425 | Ga0207648_10006020 | 3300026089 | Bacteria | 12099 |
| 426 | Ga0207648_10006745 | 3300026089 | Bacteria | 11387 |
| 427 | Ga0207648_10011832 | 3300026089 | Bacteria | 8200 |
| 428 | Ga0207648_10084221 | 3300026089 | Bacteria | 2773 |
| 429 | Ga0207676_10000410 | 3300026095 | Bacteria | 36252 |
| 430 | Ga0207676_10002118 | 3300026095 | Bacteria | 14373 |
| 431 | Ga0207676_10015805 | 3300026095 | Bacteria | 5457 |
| 432 | Ga0207676_10074039 | 3300026095 | Bacteria | 2742 |
| 433 | Ga0207676_10350346 | 3300026095 | Bacteria | 1365 |
| 434 | Ga0207674_10002867 | 3300026116 | Bacteria | 21414 |
| 435 | Ga0207674_10007003 | 3300026116 | Bacteria | 13180 |
| 436 | Ga0207674_10012997 | 3300026116 | Bacteria | 9278 |
| 437 | Ga0207674_10065812 | 3300026116 | Bacteria | 3653 |
| 438 | Ga0207674_10103706 | 3300026116 | Bacteria | 2823 |
| 439 | Ga0207674_10231108 | 3300026116 | Bacteria | 1797 |
| 440 | Ga0207674_10263992 | 3300026116 | Bacteria | 1669 |
| 441 | Ga0207674_10299029 | 3300026116 | Bacteria | 1558 |
| 442 | Ga0207675_100000558 | 3300026118 | Bacteria | 36410 |
| 443 | Ga0207675_100001808 | 3300026118 | Bacteria | 21432 |
| 444 | Ga0207675_100002279 | 3300026118 | Bacteria | 19062 |
| 445 | Ga0207675_100028938 | 3300026118 | Bacteria | 5162 |
| 446 | Ga0207675_100059525 | 3300026118 | Bacteria | 3564 |
| 447 | Ga0207683_10136812 | 3300026121 | Bacteria | 2205 |
| 448 | Ga0207683_10267017 | 3300026121 | Bacteria | 1563 |
| 449 | Ga0207683_10280125 | 3300026121 | Bacteria | 1524 |
| 450 | Ga0207683_10337137 | 3300026121 | Bacteria | 1382 |
| 451 | Ga0207698_10104346 | 3300026142 | Bacteria | 2358 |
| 452 | Ga0209389_1005145 | 3300027296 | Bacteria | 11068 |
| 453 | Ga0209969_1008690 | 3300027360 | Bacteria | 1443 |
| 454 | Ga0209981_1002048 | 3300027378 | Bacteria | 2573 |
| 455 | Ga0210000_1004960 | 3300027462 | Bacteria | 1928 |
| 456 | Ga0209995_1016929 | 3300027471 | Bacteria | 1198 |
| 457 | Ga0209968_1016458 | 3300027526 | Bacteria | 1175 |
| 458 | Ga0209999_1001993 | 3300027543 | Bacteria | 3561 |
| 459 | Ga0209999_1006910 | 3300027543 | Bacteria | 2041 |
| 460 | Ga0209971_1067721 | 3300027682 | Bacteria | 866 |
| 461 | Ga0209966_1034306 | 3300027695 | Bacteria | 1038 |
| 462 | Ga0207428_10000343 | 3300027907 | Bacteria | 60532 |
| 463 | Ga0207428_10018104 | 3300027907 | Bacteria | 6027 |
| 464 | Ga0207428_10082459 | 3300027907 | Bacteria | 2509 |
| 465 | Ga0207428_10096925 | 3300027907 | Bacteria | 2283 |
| 466 | Ga0207428_10104280 | 3300027907 | Bacteria | 2188 |
| 467 | Ga0268266_10033585 | 3300028379 | Bacteria | 4361 |
| 468 | Ga0268266_10339404 | 3300028379 | Bacteria | 1410 |
| 469 | Ga0268266_10346715 | 3300028379 | Bacteria | 1395 |
| 470 | Ga0268265_10003506 | 3300028380 | Bacteria | 11224 |
| 471 | Ga0268265_10047481 | 3300028380 | Bacteria | 3217 |
| 472 | Ga0268265_10050667 | 3300028380 | Bacteria | 3130 |
| 473 | Ga0268265_10194458 | 3300028380 | Bacteria | 1754 |
| 474 | Ga0268265_10253779 | 3300028380 | Bacteria | 1559 |
| 475 | Ga0268264_10008749 | 3300028381 | Bacteria | 8404 |
| 476 | Ga0268264_10209707 | 3300028381 | Bacteria | 1788 |
| 477 | Ga0268264_10542764 | 3300028381 | Bacteria | 1139 |
| 478 | Ga0265322_10063485 | 3300028654 | Bacteria | 1047 |
| 479 | Ga0307515_10062816 | 3300028794 | Bacteria | 5235 |
| 480 | Ga0265332_10006667 | 3300031238 | Bacteria | 5228 |
| 481 | Ga0265329_10026388 | 3300031242 | Bacteria | 1914 |
| 482 | Ga0265339_10004832 | 3300031249 | Bacteria | 9108 |
| 483 | Ga0265331_10010601 | 3300031250 | Bacteria | 5089 |
| 484 | Ga0265327_10232458 | 3300031251 | Bacteria | 826 |
| 485 | Ga0265316_10084490 | 3300031344 | Bacteria | 2431 |
| 486 | Ga0265316_10352332 | 3300031344 | Bacteria | 1065 |
| 487 | Ga0307513_10000272 | 3300031456 | Bacteria | 75284 |
| 488 | Ga0307513_10020600 | 3300031456 | Bacteria | 7816 |
| 489 | Ga0307408_100004559 | 3300031548 | Bacteria | 9384 |
| 490 | Ga0307408_100015484 | 3300031548 | Bacteria | 5078 |
| 491 | Ga0307408_100488792 | 3300031548 | Bacteria | 1075 |
| 492 | Ga0265314_10000233 | 3300031711 | Bacteria | 82725 |
| 493 | Ga0265342_10007759 | 3300031712 | Bacteria | 7810 |
| 494 | Ga0265342_10021674 | 3300031712 | Bacteria | 4097 |
| 495 | Ga0265342_10341015 | 3300031712 | Bacteria | 782 |
| 496 | Ga0307405_10006436 | 3300031731 | Bacteria | 5776 |
| 497 | Ga0307413_10044096 | 3300031824 | Bacteria | 2633 |
| 498 | Ga0307410_10002281 | 3300031852 | Bacteria | 9194 |
| 499 | Ga0307406_10002498 | 3300031901 | Bacteria | 10019 |
| 500 | Ga0307406_10722278 | 3300031901 | Bacteria | 834 |
| 501 | Ga0307407_10015167 | 3300031903 | Bacteria | 3798 |
| 502 | Ga0307407_10021730 | 3300031903 | Bacteria | 3316 |
| 503 | Ga0307412_10009824 | 3300031911 | Bacteria | 5495 |
| 504 | Ga0307412_10023396 | 3300031911 | Bacteria | 3801 |
| 505 | Ga0307412_10209093 | 3300031911 | Bacteria | 1487 |
| 506 | Ga0307409_100001947 | 3300031995 | Bacteria | 10546 |
| 507 | Ga0307409_100671906 | 3300031995 | Bacteria | 1032 |
| 508 | Ga0307416_100002671 | 3300032002 | Bacteria | 10322 |
| 509 | Ga0307416_100228428 | 3300032002 | Bacteria | 1792 |
| 510 | Ga0307416_100642484 | 3300032002 | Bacteria | 1145 |
| 511 | Ga0307416_100765771 | 3300032002 | Bacteria | 1059 |
| 512 | Ga0307414_10009697 | 3300032004 | Bacteria | 5547 |
| 513 | Ga0307411_10015024 | 3300032005 | Bacteria | 4330 |
| 514 | Ga0307411_10375287 | 3300032005 | Bacteria | 1168 |
| 515 | Ga0307415_100012347 | 3300032126 | Bacteria | 4936 |
| 516 | Ga0373950_0075413 | 3300034818 | Bacteria | 697 |
| 517 | Ga0373926_0181429 | 3300035083 | Bacteria | 807 |
| 518 | Ga0373923_0125074 | 3300035111 | Bacteria | 1152 |
| 519 | Ga0373953_0117554 | 3300035117 | Bacteria | 1128 |
| 520 | Ga0373957_0048041 | 3300035120 | Bacteria | 1625 |
| 521 | Ga0373955_0022181 | 3300035172 | Bacteria | 3218 |
| 522 | Ga0373935_0024670 | 3300035692 | Bacteria | 3703 |
| 523 | Ga0373935_0317795 | 3300035692 | Bacteria | 1104 |
| 524 | Ga0373933_0057179 | 3300035724 | Bacteria | 2343 |
| 525 | Ga0373933_0203860 | 3300035724 | Bacteria | 1266 |
| 526 | Ga0373947_0063448 | 3300035725 | Bacteria | 2251 |
| 527 | Ga0373937_0034721 | 3300036401 | Bacteria | 4586 |
| 528 | Ga0373937_0072158 | 3300036401 | Bacteria | 3184 |
| 529 | Ga0373937_0384236 | 3300036401 | Bacteria | 1331 |
| 530 | Ga0373937_0833493 | 3300036401 | Unclassified | 870 |
| 531 | Ga0395905_0027787 | 3300037471 | Bacteria | 5334 |
| 532 | Ga0395905_0223216 | 3300037471 | Bacteria | 1763 |
| 533 | Ga0439439_0139826 | 3300041406 | Bacteria | 683 |
| 534 | Ga0439443_042045 | 3300042003 | Bacteria | 782 |
| 535 | Ga0439451_059592 | 3300042009 | Bacteria | 764 |
| 536 | Ga0439462_0068783 | 3300042015 | Bacteria | 961 |
| 537 | Ga0450912_017222 | 3300042116 | Bacteria | 675 |
| 538 | Ga0450898_041117 | 3300042134 | Bacteria | 875 |
| 539 | Ga0439434_0080245 | 3300042435 | Bacteria | 1035 |
| 540 | Ga0439435_0017505 | 3300042436 | Bacteria | 1813 |
| 541 | Ga0439460_0205149 | 3300042461 | Bacteria | 672 |
| 542 | Ga0453683_0030861 | 3300044673 | Bacteria | 3386 |
| 543 | Ga0453684_0100971 | 3300044712 | Bacteria | 3530 |
| 544 | Ga0453684_0144712 | 3300044712 | Bacteria | 2833 |
| 545 | Ga0466959_0093658 | 3300045049 | Bacteria | 2156 |
| 546 | Ga0451576_0014706 | 3300045051 | Bacteria | 8701 |
| 547 | Ga0451576_0198486 | 3300045051 | Bacteria | 2095 |
| 548 | Ga0495629_0062752 | 3300046459 | Bacteria | 2595 |
| 549 | Ga0495629_0174399 | 3300046459 | Bacteria | 1491 |
| 550 | Ga0495629_0581058 | 3300046459 | Bacteria | 750 |
| 551 | Ga0495651_0478222 | 3300046462 | Bacteria | 801 |
| 552 | Ga0495582_0113085 | 3300046473 | Bacteria | 1526 |
| 553 | Ga0495582_0167903 | 3300046473 | Bacteria | 1249 |
| 554 | Ga0495605_0111226 | 3300046474 | Bacteria | 1250 |
| 555 | Ga0495594_0014352 | 3300046499 | Bacteria | 4149 |
| 556 | Ga0495594_0072642 | 3300046499 | Bacteria | 1914 |
| 557 | Ga0495630_0325512 | 3300046517 | Bacteria | 1175 |
| 558 | Ga0495642_0047162 | 3300046528 | Bacteria | 1764 |
| 559 | Ga0495586_0251783 | 3300046535 | Bacteria | 1008 |
| 560 | Ga0495587_0145415 | 3300046536 | Bacteria | 1352 |
| 561 | Ga0495598_0194011 | 3300046537 | Bacteria | 730 |
| 562 | Ga0495621_0038774 | 3300046539 | Bacteria | 1663 |
| 563 | Ga0495621_0038793 | 3300046539 | Bacteria | 1663 |
| 564 | Ga0495621_0106038 | 3300046539 | Bacteria | 1074 |
| 565 | Ga0495622_0211464 | 3300046557 | Unclassified | 862 |
| 566 | Ga0495635_0009129 | 3300046663 | Bacteria | 6924 |
| 567 | Ga0495659_0040391 | 3300046664 | Bacteria | 1663 |
| 568 | Ga0495588_0131666 | 3300046674 | Bacteria | 1319 |
| 569 | Ga0495657_0167719 | 3300046675 | Bacteria | 1354 |
| 570 | Ga0495623_0273729 | 3300046679 | Bacteria | 942 |
| 571 | Ga0495658_0185258 | 3300046683 | Bacteria | 1292 |
| 572 | Ga0495669_0156382 | 3300046684 | Bacteria | 1081 |
| 573 | Ga0495581_0159998 | 3300047315 | Bacteria | 1316 |
| 574 | Ga0495604_0683113 | 3300047317 | Bacteria | 653 |
| 575 | Ga0495676_0149715 | 3300047321 | Bacteria | 1663 |
| 576 | Ga0495680_0069672 | 3300047322 | Bacteria | 2683 |
| 577 | Ga0495687_021731 | 3300047443 | Bacteria | 3096 |
| 578 | Ga0495614_0290462 | 3300048089 | Bacteria | 754 |
| 579 | Ga0496100_0074884 | 3300048903 | Bacteria | 2269 |
| 580 | Ga0496100_0225866 | 3300048903 | Bacteria | 1376 |
| 581 | Ga0496101_0086380 | 3300048904 | Bacteria | 2326 |
| 582 | Ga0496102_0031108 | 3300048905 | Bacteria | 4784 |
| 583 | Ga0496102_0045218 | 3300048905 | Bacteria | 3997 |
| 584 | Ga0496103_0024349 | 3300048906 | Bacteria | 3654 |
| 585 | Ga0496103_0107826 | 3300048906 | Bacteria | 1767 |
| 586 | Ga0496104_0146978 | 3300048907 | Bacteria | 2263 |
| 587 | Ga0496105_0130369 | 3300048908 | Bacteria | 2073 |
| 588 | Ga0496106_0094045 | 3300048909 | Bacteria | 2317 |
| 589 | Ga0496106_0172813 | 3300048909 | Bacteria | 1713 |
| 590 | Ga0496107_0046100 | 3300048910 | Bacteria | 3137 |
| 591 | Ga0496108_0316443 | 3300048911 | Bacteria | 1360 |
| 592 | Ga0496108_0615792 | 3300048911 | Bacteria | 945 |
| 593 | Ga0496109_0050719 | 3300048912 | Bacteria | 3778 |
| 594 | Ga0496109_0113792 | 3300048912 | Bacteria | 2517 |
| 595 | Ga0496109_0134627 | 3300048912 | Bacteria | 2308 |
| 596 | Ga0496109_1074836 | 3300048912 | Bacteria | 742 |
| 597 | Ga0496110_0110273 | 3300048913 | Bacteria | 2472 |
| 598 | Ga0496110_0688221 | 3300048913 | Bacteria | 923 |
| 599 | Ga0496111_0049665 | 3300048914 | Bacteria | 3025 |
| 600 | Ga0496114_0162445 | 3300048917 | Bacteria | 1943 |
| 601 | Ga0496114_0551687 | 3300048917 | Bacteria | 1018 |
| 602 | Ga0496116_0001150 | 3300048919 | Bacteria | 31317 |
| 603 | Ga0496124_0126504 | 3300048927 | Bacteria | 2035 |
| 604 | Ga0501290_002541 | 3300049513 | Bacteria | 2347 |
| 605 | Ga0501291_000689 | 3300049514 | Bacteria | 3871 |
| 606 | Ga0501292_000230 | 3300049515 | Bacteria | 8440 |
| 607 | Ga0501293_000492 | 3300049516 | Bacteria | 2978 |
| 608 | Ga0501296_000849 | 3300049519 | Bacteria | 3002 |
| 609 | Ga0501297_000022 | 3300049520 | Bacteria | 15117 |
| 610 | Ga0501300_000082 | 3300049523 | Bacteria | 13526 |
| 611 | Ga0501303_001246 | 3300049526 | Bacteria | 1901 |
| 612 | Ga0501034_0188557 | 3300049571 | Bacteria | 2025 |
| 613 | Ga0501036_0325235 | 3300049572 | Bacteria | 1285 |
| 614 | Ga0501036_0461696 | 3300049572 | Bacteria | 1058 |
| 615 | Ga0501038_0121452 | 3300049574 | Bacteria | 2154 |
| 616 | Ga0501038_0157775 | 3300049574 | Bacteria | 1846 |
| 617 | Ga0501039_0096337 | 3300049575 | Bacteria | 2307 |
| 618 | Ga0501046_0184648 | 3300049580 | Bacteria | 1558 |
| 619 | Ga0501069_0082208 | 3300049585 | Unclassified | 1815 |
| 620 | Ga0501071_0276118 | 3300049587 | Bacteria | 1271 |
| 621 | Ga0501072_0464462 | 3300049588 | Bacteria | 1002 |
| 622 | Ga0501076_0163176 | 3300049592 | Bacteria | 1816 |
| 623 | Ga0501199_002758 | 3300049650 | Bacteria | 1658 |
| 624 | Ga0501202_036676 | 3300049652 | Bacteria | 1044 |
| 625 | Ga0501209_014175 | 3300049656 | Bacteria | 1744 |
| 626 | Ga0501211_012531 | 3300049658 | Bacteria | 838 |
| 627 | Ga0501216_031344 | 3300049660 | Bacteria | 983 |
| 628 | Ga0501224_015280 | 3300049664 | Bacteria | 1138 |
| 629 | Ga0501235_000547 | 3300049669 | Bacteria | 7512 |
| 630 | Ga0501243_000200 | 3300049675 | Bacteria | 7249 |
| 631 | Ga0501246_000210 | 3300049676 | Bacteria | 3852 |
| 632 | Ga0501248_002711 | 3300049678 | Bacteria | 1226 |
| 633 | Ga0501257_004363 | 3300049686 | Bacteria | 3086 |
| 634 | Ga0501260_002083 | 3300049689 | Bacteria | 1705 |
| 635 | Ga0501221_001736 | 3300049704 | Bacteria | 3629 |
| 636 | Ga0501225_0014264 | 3300049705 | Bacteria | 2220 |
| 637 | Ga0501229_010104 | 3300049706 | Bacteria | 1190 |
| 638 | Ga0501245_002018 | 3300049708 | Bacteria | 2686 |
| 639 | Ga0501080_0994758 | 3300049742 | Bacteria | 728 |
| 640 | Ga0501264_002343 | 3300049761 | Bacteria | 1780 |
| 641 | Ga0501265_011475 | 3300049762 | Bacteria | 1093 |
| 642 | Ga0501266_003040 | 3300049763 | Bacteria | 2087 |
| 643 | Ga0501270_000021 | 3300049767 | Bacteria | 12468 |
| 644 | Ga0501273_001850 | 3300049770 | Bacteria | 2082 |
| 645 | Ga0501275_001295 | 3300049772 | Bacteria | 2501 |
| 646 | Ga0501276_002228 | 3300049773 | Bacteria | 1362 |
| 647 | Ga0501278_000078 | 3300049774 | Bacteria | 6670 |
| 648 | Ga0501279_000695 | 3300049775 | Bacteria | 4398 |
| 649 | Ga0501281_00720 | 3300049777 | Bacteria | 2864 |
| 650 | Ga0501283_000146 | 3300049779 | Bacteria | 9058 |
| 651 | Ga0501045_0117439 | 3300049824 | Bacteria | 1975 |
| 652 | Ga0501212_003881 | 3300049851 | Bacteria | 1900 |
| 653 | nmdc:mga03683_82729_c1 | 3300050489 | Bacteria | 1389 |
| 654 | nmdc:mga00v17_6528_c1 | 3300050491 | Bacteria | 6192 |
| 655 | nmdc:mga0k408_1050_c1 | 3300050493 | Bacteria | 15173 |
| 656 | nmdc:mga0k408_479424_c1 | 3300050493 | Bacteria | 738 |
| 657 | nmdc:mga06z11_2252_c1 | 3300050494 | Bacteria | 7334 |
| 658 | nmdc:mga05p37_212485_c1 | 3300050507 | Unclassified | 2338 |
| 659 | nmdc:mga05p37_636_c1 | 3300050507 | Bacteria | 38842 |
| 660 | nmdc:mga09592_1481_c1 | 3300050508 | Bacteria | 18867 |
| 661 | nmdc:mga09592_21700_c1 | 3300050508 | Bacteria | 5294 |
| 662 | nmdc:mga09592_337367_c1 | 3300050508 | Bacteria | 1305 |
| 663 | nmdc:mga09592_439450_c1 | 3300050508 | Bacteria | 1126 |
| 664 | nmdc:mga09592_779128_c1 | 3300050508 | Bacteria | 810 |
| 665 | nmdc:mga09592_81053_c1 | 3300050508 | Bacteria | 2765 |
| 666 | nmdc:mga0qj67_11261_c1 | 3300050509 | Bacteria | 6700 |
| 667 | nmdc:mga0qj67_16443_c1 | 3300050509 | Bacteria | 5611 |
| 668 | nmdc:mga0qj67_85207_c1 | 3300050509 | Bacteria | 2534 |
| 669 | nmdc:mga06r32_113540_c1 | 3300050510 | Bacteria | 2667 |
| 670 | nmdc:mga06r32_119136_c1 | 3300050510 | Bacteria | 2603 |
| 671 | nmdc:mga08y16_3237_c1 | 3300050511 | Bacteria | 16865 |
| 672 | nmdc:mga08y16_41146_c1 | 3300050511 | Bacteria | 4841 |
| 673 | nmdc:mga08y16_4821_c1 | 3300050511 | Bacteria | 14074 |
| 674 | nmdc:mga08y16_56895_c1 | 3300050511 | Bacteria | 4087 |
| 675 | nmdc:mga0n895_624395_c1 | 3300050512 | Bacteria | 1078 |
| 676 | nmdc:mga0n895_722787_c1 | 3300050512 | Bacteria | 990 |
| 677 | nmdc:mga0a205_117512_c1 | 3300050515 | Bacteria | 2557 |
| 678 | nmdc:mga0a205_236608_c1 | 3300050515 | Bacteria | 1708 |
| 679 | Ga0495601_0237776 | 3300053077 | Bacteria | 1189 |
| 680 | Ga0495595_0083016 | 3300053084 | Bacteria | 1529 |
| 681 | Ga0495619_0394905 | 3300053085 | Bacteria | 955 |
| 682 | Ga0530510_0143240 | 3300061734 | Bacteria | 1762 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0027787 | Ga0395905_0027787_3656_4309 | 167 |
| 2 | 3300050508 | nmdc:mga09592_439450_c1 | nmdc:mga09592_439450_c1_167_790 | 174 |
| 3 | 3300027360 | Ga0209969_1008690 | Ga0209969_10086902 | 179 |
| 4 | 3300042134 | Ga0450898_041117 | Ga0450898_041117_185_796 | 179 |
| 5 | 3300049571 | Ga0501034_0188557 | Ga0501034_0188557_1218_1853 | 181 |
| 6 | 3300005617 | Ga0068859_100084020 | Ga0068859_1000840202 | 185 |
| 7 | 3300006931 | Ga0097620_100084021 | Ga0097620_1000840214 | 185 |
| 8 | 3300013296 | Ga0157374_10094506 | Ga0157374_100945062 | 185 |
| 9 | 3300026023 | Ga0207677_10114488 | Ga0207677_101144882 | 185 |
| 10 | 3300026088 | Ga0207641_10073120 | Ga0207641_100731202 | 185 |
| 11 | 3300026095 | Ga0207676_10350346 | Ga0207676_103503462 | 185 |
| 12 | 3300050493 | nmdc:mga0k408_479424_c1 | nmdc:mga0k408_479424_c1_15_572 | 185 |
| 13 | 3300042015 | Ga0439462_0068783 | Ga0439462_0068783_390_950 | 186 |
| 14 | 3300046535 | Ga0495586_0251783 | Ga0495586_0251783_12_575 | 187 |
| 15 | 3300028794 | Ga0307515_10062816 | Ga0307515_100628164 | 188 |
| 16 | 3300031251 | Ga0265327_10232458 | Ga0265327_102324582 | 188 |
| 17 | 3300031456 | Ga0307513_10020600 | Ga0307513_100206004 | 188 |
| 18 | 3300005467 | Ga0070706_100000846 | Ga0070706_1000008468 | 191 |
| 19 | 3300005536 | Ga0070697_100019292 | Ga0070697_1000192927 | 191 |
| 20 | 3300025910 | Ga0207684_10000363 | Ga0207684_1000036331 | 191 |
| 21 | 3300027526 | Ga0209968_1016458 | Ga0209968_10164581 | 191 |
| 22 | 3300006846 | Ga0075430_100097634 | Ga0075430_1000976342 | 192 |
| 23 | 3300006847 | Ga0075431_100003309 | Ga0075431_10000330914 | 192 |
| 24 | 3300006880 | Ga0075429_100007739 | Ga0075429_10000773911 | 192 |
| 25 | 3300009147 | Ga0114129_10019694 | Ga0114129_100196944 | 192 |
| 26 | 3300013306 | Ga0163162_10017941 | Ga0163162_100179413 | 192 |
| 27 | 3300031238 | Ga0265332_10006667 | Ga0265332_100066676 | 192 |
| 28 | 3300031242 | Ga0265329_10026388 | Ga0265329_100263882 | 192 |
| 29 | 3300031249 | Ga0265339_10004832 | Ga0265339_1000483210 | 192 |
| 30 | 3300031250 | Ga0265331_10010601 | Ga0265331_100106013 | 192 |
| 31 | 3300031711 | Ga0265314_10000233 | Ga0265314_100002335 | 192 |
| 32 | 3300031712 | Ga0265342_10021674 | Ga0265342_100216744 | 192 |
| 33 | 3300049574 | Ga0501038_0121452 | Ga0501038_0121452_1503_2102 | 192 |
| 34 | 3300050508 | nmdc:mga09592_81053_c1 | nmdc:mga09592_81053_c1_36_614 | 192 |
| 35 | 3300050509 | nmdc:mga0qj67_16443_c1 | nmdc:mga0qj67_16443_c1_1487_2065 | 192 |
| 36 | 3300050510 | nmdc:mga06r32_113540_c1 | nmdc:mga06r32_113540_c1_1731_2309 | 192 |
| 37 | 3300014325 | Ga0163163_10906038 | Ga0163163_109060382 | 193 |
| 38 | 3300031911 | Ga0307412_10023396 | Ga0307412_100233962 | 193 |
| 39 | 3300003323 | rootH1_10009155 | rootH1_100091558 | 197 |
| 40 | 3300003771 | Ga0055526_1004475 | Ga0055526_10044757 | 197 |
| 41 | 3300003792 | Ga0055540_1013809 | Ga0055540_10138092 | 197 |
| 42 | 3300005328 | Ga0070676_10003923 | Ga0070676_100039233 | 197 |
| 43 | 3300005329 | Ga0070683_100050405 | Ga0070683_1000504052 | 197 |
| 44 | 3300005331 | Ga0070670_100029853 | Ga0070670_1000298533 | 197 |
| 45 | 3300005334 | Ga0068869_100011586 | Ga0068869_1000115863 | 197 |
| 46 | 3300005334 | Ga0068869_100200787 | Ga0068869_1002007872 | 197 |
| 47 | 3300005336 | Ga0070680_100142754 | Ga0070680_1001427542 | 197 |
| 48 | 3300005336 | Ga0070680_100155563 | Ga0070680_1001555632 | 197 |
| 49 | 3300005338 | Ga0068868_100211162 | Ga0068868_1002111621 | 197 |
| 50 | 3300005339 | Ga0070660_100042423 | Ga0070660_1000424232 | 197 |
| 51 | 3300005344 | Ga0070661_100087149 | Ga0070661_1000871492 | 197 |
| 52 | 3300005354 | Ga0070675_100014015 | Ga0070675_1000140153 | 197 |
| 53 | 3300005354 | Ga0070675_100763391 | Ga0070675_1007633911 | 197 |
| 54 | 3300005355 | Ga0070671_100055638 | Ga0070671_1000556384 | 197 |
| 55 | 3300005364 | Ga0070673_100004218 | Ga0070673_1000042184 | 197 |
| 56 | 3300005365 | Ga0070688_100053437 | Ga0070688_1000534372 | 197 |
| 57 | 3300005366 | Ga0070659_100012718 | Ga0070659_1000127186 | 197 |
| 58 | 3300005367 | Ga0070667_100140314 | Ga0070667_1001403142 | 197 |
| 59 | 3300005441 | Ga0070700_100028528 | Ga0070700_1000285283 | 197 |
| 60 | 3300005456 | Ga0070678_100264441 | Ga0070678_1002644412 | 197 |
| 61 | 3300005458 | Ga0070681_10027047 | Ga0070681_100270474 | 197 |
| 62 | 3300005459 | Ga0068867_100010602 | Ga0068867_1000106022 | 197 |
| 63 | 3300005459 | Ga0068867_100185706 | Ga0068867_1001857062 | 197 |
| 64 | 3300005467 | Ga0070706_101053980 | Ga0070706_1010539801 | 197 |
| 65 | 3300005468 | Ga0070707_100041532 | Ga0070707_1000415322 | 197 |
| 66 | 3300005471 | Ga0070698_100091390 | Ga0070698_1000913902 | 197 |
| 67 | 3300005471 | Ga0070698_100626244 | Ga0070698_1006262442 | 197 |
| 68 | 3300005530 | Ga0070679_100109674 | Ga0070679_1001096744 | 197 |
| 69 | 3300005545 | Ga0070695_100027112 | Ga0070695_1000271122 | 197 |
| 70 | 3300005563 | Ga0068855_100011783 | Ga0068855_10001178311 | 197 |
| 71 | 3300005577 | Ga0068857_100003353 | Ga0068857_1000033534 | 197 |
| 72 | 3300005577 | Ga0068857_100321976 | Ga0068857_1003219762 | 197 |
| 73 | 3300005578 | Ga0068854_100313817 | Ga0068854_1003138172 | 197 |
| 74 | 3300005614 | Ga0068856_100340697 | Ga0068856_1003406972 | 197 |
| 75 | 3300005834 | Ga0068851_10041909 | Ga0068851_100419092 | 197 |
| 76 | 3300006195 | Ga0075366_10111173 | Ga0075366_101111732 | 197 |
| 77 | 3300006942 | Ga0099824_1039530 | Ga0099824_10395302 | 197 |
| 78 | 3300006944 | Ga0099823_1000003 | Ga0099823_1000003153 | 197 |
| 79 | 3300009174 | Ga0105241_10014623 | Ga0105241_100146234 | 197 |
| 80 | 3300009551 | Ga0105238_10011338 | Ga0105238_100113383 | 197 |
| 81 | 3300009553 | Ga0105249_11306513 | Ga0105249_113065131 | 197 |
| 82 | 3300025273 | Ga0209673_1013689 | Ga0209673_10136892 | 197 |
| 83 | 3300025295 | Ga0209564_1000392 | Ga0209564_100039221 | 197 |
| 84 | 3300025298 | Ga0209050_1001991 | Ga0209050_10019915 | 197 |
| 85 | 3300025299 | Ga0209256_1000634 | Ga0209256_100063423 | 197 |
| 86 | 3300025303 | Ga0209051_1001010 | Ga0209051_10010105 | 197 |
| 87 | 3300025304 | Ga0209257_1001115 | Ga0209257_10011158 | 197 |
| 88 | 3300025321 | Ga0207656_10043387 | Ga0207656_100433872 | 197 |
| 89 | 3300025910 | Ga0207684_10409763 | Ga0207684_104097632 | 197 |
| 90 | 3300025911 | Ga0207654_10006976 | Ga0207654_100069764 | 197 |
| 91 | 3300025912 | Ga0207707_10082358 | Ga0207707_100823582 | 197 |
| 92 | 3300025913 | Ga0207695_10144075 | Ga0207695_101440752 | 197 |
| 93 | 3300025914 | Ga0207671_10014674 | Ga0207671_100146745 | 197 |
| 94 | 3300025917 | Ga0207660_10261214 | Ga0207660_102612142 | 197 |
| 95 | 3300025919 | Ga0207657_10216810 | Ga0207657_102168102 | 197 |
| 96 | 3300025920 | Ga0207649_10082814 | Ga0207649_100828142 | 197 |
| 97 | 3300025922 | Ga0207646_10037324 | Ga0207646_100373242 | 197 |
| 98 | 3300025924 | Ga0207694_10008187 | Ga0207694_100081873 | 197 |
| 99 | 3300025926 | Ga0207659_10158284 | Ga0207659_101582842 | 197 |
| 100 | 3300025927 | Ga0207687_10011546 | Ga0207687_100115468 | 197 |
| 101 | 3300025932 | Ga0207690_10038419 | Ga0207690_100384193 | 197 |
| 102 | 3300025944 | Ga0207661_10146077 | Ga0207661_101460772 | 197 |
| 103 | 3300025945 | Ga0207679_10003930 | Ga0207679_1000393010 | 197 |
| 104 | 3300025949 | Ga0207667_10007162 | Ga0207667_1000716212 | 197 |
| 105 | 3300026078 | Ga0207702_10009516 | Ga0207702_100095167 | 197 |
| 106 | 3300026116 | Ga0207674_10007003 | Ga0207674_100070034 | 197 |
| 107 | 3300026116 | Ga0207674_10231108 | Ga0207674_102311082 | 197 |
| 108 | 3300026121 | Ga0207683_10280125 | Ga0207683_102801253 | 197 |
| 109 | 3300027296 | Ga0209389_1005145 | Ga0209389_10051456 | 197 |
| 110 | 3300028654 | Ga0265322_10063485 | Ga0265322_100634852 | 197 |
| 111 | 3300031344 | Ga0265316_10084490 | Ga0265316_100844902 | 197 |
| 112 | 3300031344 | Ga0265316_10352332 | Ga0265316_103523321 | 197 |
| 113 | 3300031548 | Ga0307408_100488792 | Ga0307408_1004887922 | 197 |
| 114 | 3300031712 | Ga0265342_10007759 | Ga0265342_100077596 | 197 |
| 115 | 3300031712 | Ga0265342_10341015 | Ga0265342_103410152 | 197 |
| 116 | 3300031901 | Ga0307406_10722278 | Ga0307406_107222781 | 197 |
| 117 | 3300032002 | Ga0307416_100228428 | Ga0307416_1002284282 | 197 |
| 118 | 3300032002 | Ga0307416_100642484 | Ga0307416_1006424842 | 197 |
| 119 | 3300032002 | Ga0307416_100765771 | Ga0307416_1007657711 | 197 |
| 120 | 3300032005 | Ga0307411_10375287 | Ga0307411_103752872 | 197 |
| 121 | 3300037471 | Ga0395905_0223216 | Ga0395905_0223216_739_1350 | 197 |
| 122 | 3300042116 | Ga0450912_017222 | Ga0450912_017222_65_664 | 197 |
| 123 | 3300044673 | Ga0453683_0030861 | Ga0453683_0030861_537_1148 | 197 |
| 124 | 3300044712 | Ga0453684_0100971 | Ga0453684_0100971_1497_2108 | 197 |
| 125 | 3300044712 | Ga0453684_0144712 | Ga0453684_0144712_840_1463 | 197 |
| 126 | 3300045051 | Ga0451576_0014706 | Ga0451576_0014706_1563_2186 | 197 |
| 127 | 3300045051 | Ga0451576_0198486 | Ga0451576_0198486_555_1166 | 197 |
| 128 | 3300049824 | Ga0501045_0117439 | Ga0501045_0117439_250_843 | 197 |
| 129 | 3300001976 | JGI24752J21851_1003387 | JGI24752J21851_10033872 | 198 |
| 130 | 3300002239 | JGI24034J26672_10023104 | JGI24034J26672_100231042 | 198 |
| 131 | 3300004800 | Ga0058861_10054973 | Ga0058861_100549731 | 198 |
| 132 | 3300005290 | Ga0065712_10075717 | Ga0065712_100757173 | 198 |
| 133 | 3300005293 | Ga0065715_10488263 | Ga0065715_104882631 | 198 |
| 134 | 3300005295 | Ga0065707_10090900 | Ga0065707_100909004 | 198 |
| 135 | 3300005328 | Ga0070676_10039107 | Ga0070676_100391074 | 198 |
| 136 | 3300005328 | Ga0070676_10076191 | Ga0070676_100761913 | 198 |
| 137 | 3300005330 | Ga0070690_100054133 | Ga0070690_1000541332 | 198 |
| 138 | 3300005330 | Ga0070690_100086712 | Ga0070690_1000867122 | 198 |
| 139 | 3300005331 | Ga0070670_100000604 | Ga0070670_1000006044 | 198 |
| 140 | 3300005331 | Ga0070670_100294175 | Ga0070670_1002941752 | 198 |
| 141 | 3300005331 | Ga0070670_100377568 | Ga0070670_1003775682 | 198 |
| 142 | 3300005331 | Ga0070670_100768633 | Ga0070670_1007686331 | 198 |
| 143 | 3300005333 | Ga0070677_10216060 | Ga0070677_102160601 | 198 |
| 144 | 3300005334 | Ga0068869_100001219 | Ga0068869_1000012196 | 198 |
| 145 | 3300005334 | Ga0068869_100055916 | Ga0068869_1000559163 | 198 |
| 146 | 3300005334 | Ga0068869_100100543 | Ga0068869_1001005433 | 198 |
| 147 | 3300005335 | Ga0070666_10094671 | Ga0070666_100946713 | 198 |
| 148 | 3300005335 | Ga0070666_10256842 | Ga0070666_102568421 | 198 |
| 149 | 3300005336 | Ga0070680_100078774 | Ga0070680_1000787742 | 198 |
| 150 | 3300005336 | Ga0070680_100102715 | Ga0070680_1001027153 | 198 |
| 151 | 3300005337 | Ga0070682_100439851 | Ga0070682_1004398511 | 198 |
| 152 | 3300005338 | Ga0068868_100058625 | Ga0068868_1000586253 | 198 |
| 153 | 3300005340 | Ga0070689_100000594 | Ga0070689_1000005946 | 198 |
| 154 | 3300005340 | Ga0070689_100291286 | Ga0070689_1002912862 | 198 |
| 155 | 3300005340 | Ga0070689_100395205 | Ga0070689_1003952051 | 198 |
| 156 | 3300005341 | Ga0070691_10155946 | Ga0070691_101559462 | 198 |
| 157 | 3300005341 | Ga0070691_10164594 | Ga0070691_101645942 | 198 |
| 158 | 3300005343 | Ga0070687_100062226 | Ga0070687_1000622262 | 198 |
| 159 | 3300005343 | Ga0070687_100079654 | Ga0070687_1000796543 | 198 |
| 160 | 3300005343 | Ga0070687_100109105 | Ga0070687_1001091052 | 198 |
| 161 | 3300005343 | Ga0070687_100298592 | Ga0070687_1002985921 | 198 |
| 162 | 3300005347 | Ga0070668_100005159 | Ga0070668_1000051593 | 198 |
| 163 | 3300005347 | Ga0070668_100012530 | Ga0070668_1000125303 | 198 |
| 164 | 3300005347 | Ga0070668_100139844 | Ga0070668_1001398442 | 198 |
| 165 | 3300005353 | Ga0070669_100004561 | Ga0070669_1000045619 | 198 |
| 166 | 3300005353 | Ga0070669_100006331 | Ga0070669_1000063319 | 198 |
| 167 | 3300005353 | Ga0070669_100134960 | Ga0070669_1001349604 | 198 |
| 168 | 3300005353 | Ga0070669_100282904 | Ga0070669_1002829042 | 198 |
| 169 | 3300005353 | Ga0070669_100481719 | Ga0070669_1004817191 | 198 |
| 170 | 3300005354 | Ga0070675_100006929 | Ga0070675_1000069299 | 198 |
| 171 | 3300005354 | Ga0070675_100018866 | Ga0070675_1000188664 | 198 |
| 172 | 3300005354 | Ga0070675_100083893 | Ga0070675_1000838933 | 198 |
| 173 | 3300005354 | Ga0070675_100104335 | Ga0070675_1001043352 | 198 |
| 174 | 3300005355 | Ga0070671_100016195 | Ga0070671_1000161952 | 198 |
| 175 | 3300005355 | Ga0070671_100064503 | Ga0070671_1000645033 | 198 |
| 176 | 3300005355 | Ga0070671_100646259 | Ga0070671_1006462592 | 198 |
| 177 | 3300005356 | Ga0070674_100083440 | Ga0070674_1000834402 | 198 |
| 178 | 3300005356 | Ga0070674_100399624 | Ga0070674_1003996241 | 198 |
| 179 | 3300005356 | Ga0070674_100729456 | Ga0070674_1007294562 | 198 |
| 180 | 3300005364 | Ga0070673_100006929 | Ga0070673_10000692910 | 198 |
| 181 | 3300005364 | Ga0070673_100043974 | Ga0070673_1000439743 | 198 |
| 182 | 3300005364 | Ga0070673_100130428 | Ga0070673_1001304283 | 198 |
| 183 | 3300005364 | Ga0070673_100303350 | Ga0070673_1003033502 | 198 |
| 184 | 3300005365 | Ga0070688_100145258 | Ga0070688_1001452582 | 198 |
| 185 | 3300005365 | Ga0070688_100480134 | Ga0070688_1004801342 | 198 |
| 186 | 3300005366 | Ga0070659_100214244 | Ga0070659_1002142442 | 198 |
| 187 | 3300005366 | Ga0070659_100288786 | Ga0070659_1002887862 | 198 |
| 188 | 3300005367 | Ga0070667_100011931 | Ga0070667_1000119318 | 198 |
| 189 | 3300005367 | Ga0070667_100255851 | Ga0070667_1002558512 | 198 |
| 190 | 3300005367 | Ga0070667_100307065 | Ga0070667_1003070652 | 198 |
| 191 | 3300005367 | Ga0070667_100549376 | Ga0070667_1005493762 | 198 |
| 192 | 3300005438 | Ga0070701_10042281 | Ga0070701_100422811 | 198 |
| 193 | 3300005438 | Ga0070701_10232516 | Ga0070701_102325162 | 198 |
| 194 | 3300005441 | Ga0070700_100000367 | Ga0070700_10000036723 | 198 |
| 195 | 3300005441 | Ga0070700_100005117 | Ga0070700_1000051172 | 198 |
| 196 | 3300005441 | Ga0070700_100057948 | Ga0070700_1000579483 | 198 |
| 197 | 3300005441 | Ga0070700_100101352 | Ga0070700_1001013523 | 198 |
| 198 | 3300005441 | Ga0070700_100105938 | Ga0070700_1001059382 | 198 |
| 199 | 3300005444 | Ga0070694_100207655 | Ga0070694_1002076552 | 198 |
| 200 | 3300005445 | Ga0070708_100299229 | Ga0070708_1002992292 | 198 |
| 201 | 3300005457 | Ga0070662_100101534 | Ga0070662_1001015342 | 198 |
| 202 | 3300005457 | Ga0070662_100113468 | Ga0070662_1001134681 | 198 |
| 203 | 3300005458 | Ga0070681_10036389 | Ga0070681_100363892 | 198 |
| 204 | 3300005459 | Ga0068867_100001130 | Ga0068867_1000011302 | 198 |
| 205 | 3300005459 | Ga0068867_100009485 | Ga0068867_1000094853 | 198 |
| 206 | 3300005459 | Ga0068867_100011974 | Ga0068867_1000119742 | 198 |
| 207 | 3300005459 | Ga0068867_100173276 | Ga0068867_1001732763 | 198 |
| 208 | 3300005466 | Ga0070685_10041656 | Ga0070685_100416563 | 198 |
| 209 | 3300005466 | Ga0070685_10573195 | Ga0070685_105731951 | 198 |
| 210 | 3300005467 | Ga0070706_100043457 | Ga0070706_1000434572 | 198 |
| 211 | 3300005468 | Ga0070707_100000587 | Ga0070707_10000058729 | 198 |
| 212 | 3300005468 | Ga0070707_100086817 | Ga0070707_1000868173 | 198 |
| 213 | 3300005471 | Ga0070698_100009454 | Ga0070698_10000945411 | 198 |
| 214 | 3300005518 | Ga0070699_100080389 | Ga0070699_1000803892 | 198 |
| 215 | 3300005518 | Ga0070699_100235144 | Ga0070699_1002351442 | 198 |
| 216 | 3300005535 | Ga0070684_100079120 | Ga0070684_1000791202 | 198 |
| 217 | 3300005536 | Ga0070697_100230533 | Ga0070697_1002305331 | 198 |
| 218 | 3300005539 | Ga0068853_100001930 | Ga0068853_1000019307 | 198 |
| 219 | 3300005543 | Ga0070672_100027941 | Ga0070672_1000279414 | 198 |
| 220 | 3300005543 | Ga0070672_100032608 | Ga0070672_1000326083 | 198 |
| 221 | 3300005543 | Ga0070672_100114420 | Ga0070672_1001144202 | 198 |
| 222 | 3300005543 | Ga0070672_100170355 | Ga0070672_1001703552 | 198 |
| 223 | 3300005544 | Ga0070686_100010270 | Ga0070686_1000102705 | 198 |
| 224 | 3300005544 | Ga0070686_100087760 | Ga0070686_1000877602 | 198 |
| 225 | 3300005544 | Ga0070686_100130573 | Ga0070686_1001305733 | 198 |
| 226 | 3300005546 | Ga0070696_100609556 | Ga0070696_1006095561 | 198 |
| 227 | 3300005548 | Ga0070665_100441509 | Ga0070665_1004415093 | 198 |
| 228 | 3300005548 | Ga0070665_100449257 | Ga0070665_1004492572 | 198 |
| 229 | 3300005548 | Ga0070665_100801535 | Ga0070665_1008015352 | 198 |
| 230 | 3300005549 | Ga0070704_100095414 | Ga0070704_1000954142 | 198 |
| 231 | 3300005549 | Ga0070704_100413031 | Ga0070704_1004130311 | 198 |
| 232 | 3300005549 | Ga0070704_100486434 | Ga0070704_1004864342 | 198 |
| 233 | 3300005563 | Ga0068855_100102398 | Ga0068855_1001023982 | 198 |
| 234 | 3300005563 | Ga0068855_100107689 | Ga0068855_1001076893 | 198 |
| 235 | 3300005563 | Ga0068855_100118103 | Ga0068855_1001181033 | 198 |
| 236 | 3300005577 | Ga0068857_100008057 | Ga0068857_1000080574 | 198 |
| 237 | 3300005577 | Ga0068857_100303716 | Ga0068857_1003037162 | 198 |
| 238 | 3300005577 | Ga0068857_100522407 | Ga0068857_1005224071 | 198 |
| 239 | 3300005578 | Ga0068854_100255150 | Ga0068854_1002551502 | 198 |
| 240 | 3300005614 | Ga0068856_100037185 | Ga0068856_1000371852 | 198 |
| 241 | 3300005614 | Ga0068856_100125323 | Ga0068856_1001253234 | 198 |
| 242 | 3300005615 | Ga0070702_100069776 | Ga0070702_1000697762 | 198 |
| 243 | 3300005615 | Ga0070702_100096073 | Ga0070702_1000960732 | 198 |
| 244 | 3300005616 | Ga0068852_100059661 | Ga0068852_1000596612 | 198 |
| 245 | 3300005617 | Ga0068859_100002178 | Ga0068859_1000021786 | 198 |
| 246 | 3300005617 | Ga0068859_100014884 | Ga0068859_1000148843 | 198 |
| 247 | 3300005617 | Ga0068859_100031453 | Ga0068859_1000314534 | 198 |
| 248 | 3300005617 | Ga0068859_100053334 | Ga0068859_1000533343 | 198 |
| 249 | 3300005617 | Ga0068859_100186622 | Ga0068859_1001866223 | 198 |
| 250 | 3300005618 | Ga0068864_100003861 | Ga0068864_1000038619 | 198 |
| 251 | 3300005618 | Ga0068864_100027295 | Ga0068864_1000272956 | 198 |
| 252 | 3300005618 | Ga0068864_100131896 | Ga0068864_1001318966 | 198 |
| 253 | 3300005618 | Ga0068864_100153290 | Ga0068864_1001532902 | 198 |
| 254 | 3300005718 | Ga0068866_10024646 | Ga0068866_100246463 | 198 |
| 255 | 3300005718 | Ga0068866_10143228 | Ga0068866_101432282 | 198 |
| 256 | 3300005719 | Ga0068861_100000843 | Ga0068861_1000008433 | 198 |
| 257 | 3300005719 | Ga0068861_100000932 | Ga0068861_1000009322 | 198 |
| 258 | 3300005719 | Ga0068861_100049010 | Ga0068861_1000490103 | 198 |
| 259 | 3300005719 | Ga0068861_100166995 | Ga0068861_1001669952 | 198 |
| 260 | 3300005719 | Ga0068861_100241805 | Ga0068861_1002418052 | 198 |
| 261 | 3300005840 | Ga0068870_10251292 | Ga0068870_102512921 | 198 |
| 262 | 3300005841 | Ga0068863_100024480 | Ga0068863_1000244804 | 198 |
| 263 | 3300005841 | Ga0068863_100061807 | Ga0068863_1000618076 | 198 |
| 264 | 3300005841 | Ga0068863_100150511 | Ga0068863_1001505113 | 198 |
| 265 | 3300005841 | Ga0068863_100208293 | Ga0068863_1002082932 | 198 |
| 266 | 3300005842 | Ga0068858_100080516 | Ga0068858_1000805162 | 198 |
| 267 | 3300005842 | Ga0068858_100332947 | Ga0068858_1003329472 | 198 |
| 268 | 3300005843 | Ga0068860_100001499 | Ga0068860_1000014995 | 198 |
| 269 | 3300005843 | Ga0068860_100008189 | Ga0068860_1000081897 | 198 |
| 270 | 3300005843 | Ga0068860_100236638 | Ga0068860_1002366382 | 198 |
| 271 | 3300005843 | Ga0068860_100361199 | Ga0068860_1003611992 | 198 |
| 272 | 3300005844 | Ga0068862_100001468 | Ga0068862_10000146820 | 198 |
| 273 | 3300005844 | Ga0068862_100004126 | Ga0068862_1000041267 | 198 |
| 274 | 3300005844 | Ga0068862_100077379 | Ga0068862_1000773793 | 198 |
| 275 | 3300005844 | Ga0068862_100118728 | Ga0068862_1001187284 | 198 |
| 276 | 3300005844 | Ga0068862_100442481 | Ga0068862_1004424812 | 198 |
| 277 | 3300005844 | Ga0068862_100986743 | Ga0068862_1009867431 | 198 |
| 278 | 3300006038 | Ga0075365_10008050 | Ga0075365_100080506 | 198 |
| 279 | 3300006051 | Ga0075364_10249097 | Ga0075364_102490972 | 198 |
| 280 | 3300006177 | Ga0075362_10035713 | Ga0075362_100357132 | 198 |
| 281 | 3300006178 | Ga0075367_10000137 | Ga0075367_100001379 | 198 |
| 282 | 3300006195 | Ga0075366_10001318 | Ga0075366_1000131810 | 198 |
| 283 | 3300006237 | Ga0097621_100018307 | Ga0097621_1000183077 | 198 |
| 284 | 3300006237 | Ga0097621_100079838 | Ga0097621_1000798382 | 198 |
| 285 | 3300006237 | Ga0097621_100387649 | Ga0097621_1003876491 | 198 |
| 286 | 3300006358 | Ga0068871_100080583 | Ga0068871_1000805832 | 198 |
| 287 | 3300006358 | Ga0068871_100168094 | Ga0068871_1001680942 | 198 |
| 288 | 3300006358 | Ga0068871_100318131 | Ga0068871_1003181311 | 198 |
| 289 | 3300006844 | Ga0075428_100000868 | Ga0075428_10000086839 | 198 |
| 290 | 3300006844 | Ga0075428_100090575 | Ga0075428_1000905753 | 198 |
| 291 | 3300006844 | Ga0075428_100671555 | Ga0075428_1006715552 | 198 |
| 292 | 3300006846 | Ga0075430_100005921 | Ga0075430_10000592113 | 198 |
| 293 | 3300006846 | Ga0075430_100058216 | Ga0075430_1000582164 | 198 |
| 294 | 3300006846 | Ga0075430_100095439 | Ga0075430_1000954392 | 198 |
| 295 | 3300006846 | Ga0075430_100213151 | Ga0075430_1002131513 | 198 |
| 296 | 3300006847 | Ga0075431_100013642 | Ga0075431_1000136424 | 198 |
| 297 | 3300006847 | Ga0075431_100056558 | Ga0075431_1000565585 | 198 |
| 298 | 3300006852 | Ga0075433_10142226 | Ga0075433_101422263 | 198 |
| 299 | 3300006852 | Ga0075433_10380513 | Ga0075433_103805131 | 198 |
| 300 | 3300006880 | Ga0075429_100000796 | Ga0075429_10000079614 | 198 |
| 301 | 3300006880 | Ga0075429_100017068 | Ga0075429_1000170686 | 198 |
| 302 | 3300006880 | Ga0075429_100797207 | Ga0075429_1007972071 | 198 |
| 303 | 3300006881 | Ga0068865_100006209 | Ga0068865_1000062094 | 198 |
| 304 | 3300006931 | Ga0097620_100002178 | Ga0097620_1000021786 | 198 |
| 305 | 3300006931 | Ga0097620_100014883 | Ga0097620_1000148833 | 198 |
| 306 | 3300006931 | Ga0097620_100031453 | Ga0097620_1000314534 | 198 |
| 307 | 3300006931 | Ga0097620_100053330 | Ga0097620_1000533305 | 198 |
| 308 | 3300006931 | Ga0097620_100186618 | Ga0097620_1001866183 | 198 |
| 309 | 3300007076 | Ga0075435_100407323 | Ga0075435_1004073232 | 198 |
| 310 | 3300009094 | Ga0111539_10002695 | Ga0111539_100026956 | 198 |
| 311 | 3300009094 | Ga0111539_10026457 | Ga0111539_100264575 | 198 |
| 312 | 3300009094 | Ga0111539_10098895 | Ga0111539_100988953 | 198 |
| 313 | 3300009094 | Ga0111539_10227395 | Ga0111539_102273952 | 198 |
| 314 | 3300009094 | Ga0111539_10962797 | Ga0111539_109627972 | 198 |
| 315 | 3300009101 | Ga0105247_10410708 | Ga0105247_104107081 | 198 |
| 316 | 3300009147 | Ga0114129_10001859 | Ga0114129_1000185935 | 198 |
| 317 | 3300009147 | Ga0114129_10130914 | Ga0114129_101309144 | 198 |
| 318 | 3300009147 | Ga0114129_10706265 | Ga0114129_107062651 | 198 |
| 319 | 3300009147 | Ga0114129_10727170 | Ga0114129_107271702 | 198 |
| 320 | 3300009148 | Ga0105243_10001846 | Ga0105243_1000184614 | 198 |
| 321 | 3300009148 | Ga0105243_10426877 | Ga0105243_104268772 | 198 |
| 322 | 3300009148 | Ga0105243_10535292 | Ga0105243_105352922 | 198 |
| 323 | 3300009174 | Ga0105241_10108152 | Ga0105241_101081522 | 198 |
| 324 | 3300009176 | Ga0105242_11450534 | Ga0105242_114505341 | 198 |
| 325 | 3300009177 | Ga0105248_10011621 | Ga0105248_100116214 | 198 |
| 326 | 3300009177 | Ga0105248_10028123 | Ga0105248_100281236 | 198 |
| 327 | 3300009177 | Ga0105248_10425367 | Ga0105248_104253672 | 198 |
| 328 | 3300009177 | Ga0105248_10745690 | Ga0105248_107456902 | 198 |
| 329 | 3300009545 | Ga0105237_10101719 | Ga0105237_101017193 | 198 |
| 330 | 3300009551 | Ga0105238_10017026 | Ga0105238_100170265 | 198 |
| 331 | 3300009553 | Ga0105249_10003380 | Ga0105249_1000338016 | 198 |
| 332 | 3300009553 | Ga0105249_10143486 | Ga0105249_101434863 | 198 |
| 333 | 3300009553 | Ga0105249_10333614 | Ga0105249_103336142 | 198 |
| 334 | 3300009553 | Ga0105249_10694578 | Ga0105249_106945782 | 198 |
| 335 | 3300009553 | Ga0105249_11409970 | Ga0105249_114099701 | 198 |
| 336 | 3300010375 | Ga0105239_10100344 | Ga0105239_101003442 | 198 |
| 337 | 3300011119 | Ga0105246_10098816 | Ga0105246_100988162 | 198 |
| 338 | 3300011119 | Ga0105246_10305201 | Ga0105246_103052012 | 198 |
| 339 | 3300011119 | Ga0105246_10497435 | Ga0105246_104974351 | 198 |
| 340 | 3300013102 | Ga0157371_10196339 | Ga0157371_101963392 | 198 |
| 341 | 3300013105 | Ga0157369_10047746 | Ga0157369_100477463 | 198 |
| 342 | 3300013296 | Ga0157374_10167470 | Ga0157374_101674701 | 198 |
| 343 | 3300013306 | Ga0163162_10107241 | Ga0163162_101072416 | 198 |
| 344 | 3300013306 | Ga0163162_10462907 | Ga0163162_104629072 | 198 |
| 345 | 3300013306 | Ga0163162_10749802 | Ga0163162_107498022 | 198 |
| 346 | 3300013306 | Ga0163162_11575553 | Ga0163162_115755531 | 198 |
| 347 | 3300013307 | Ga0157372_10920345 | Ga0157372_109203451 | 198 |
| 348 | 3300013308 | Ga0157375_10063699 | Ga0157375_100636993 | 198 |
| 349 | 3300013308 | Ga0157375_10190221 | Ga0157375_101902212 | 198 |
| 350 | 3300014325 | Ga0163163_10061531 | Ga0163163_100615312 | 198 |
| 351 | 3300014326 | Ga0157380_10018127 | Ga0157380_100181273 | 198 |
| 352 | 3300014745 | Ga0157377_10190663 | Ga0157377_101906631 | 198 |
| 353 | 3300014745 | Ga0157377_10219461 | Ga0157377_102194612 | 198 |
| 354 | 3300014968 | Ga0157379_10254425 | Ga0157379_102544252 | 198 |
| 355 | 3300014969 | Ga0157376_10073704 | Ga0157376_100737045 | 198 |
| 356 | 3300017792 | Ga0163161_10135119 | Ga0163161_101351193 | 198 |
| 357 | 3300017792 | Ga0163161_10299774 | Ga0163161_102997742 | 198 |
| 358 | 3300020070 | Ga0206356_10399998 | Ga0206356_103999981 | 198 |
| 359 | 3300025290 | Ga0207673_1002917 | Ga0207673_10029172 | 198 |
| 360 | 3300025315 | Ga0207697_10011272 | Ga0207697_100112722 | 198 |
| 361 | 3300025315 | Ga0207697_10023714 | Ga0207697_100237143 | 198 |
| 362 | 3300025321 | Ga0207656_10065491 | Ga0207656_100654912 | 198 |
| 363 | 3300025893 | Ga0207682_10001713 | Ga0207682_100017137 | 198 |
| 364 | 3300025893 | Ga0207682_10007887 | Ga0207682_100078872 | 198 |
| 365 | 3300025893 | Ga0207682_10020443 | Ga0207682_100204433 | 198 |
| 366 | 3300025893 | Ga0207682_10191253 | Ga0207682_101912532 | 198 |
| 367 | 3300025899 | Ga0207642_10090307 | Ga0207642_100903072 | 198 |
| 368 | 3300025901 | Ga0207688_10041449 | Ga0207688_100414492 | 198 |
| 369 | 3300025901 | Ga0207688_10054690 | Ga0207688_100546903 | 198 |
| 370 | 3300025901 | Ga0207688_10225475 | Ga0207688_102254752 | 198 |
| 371 | 3300025903 | Ga0207680_10079468 | Ga0207680_100794682 | 198 |
| 372 | 3300025907 | Ga0207645_10004033 | Ga0207645_1000403312 | 198 |
| 373 | 3300025907 | Ga0207645_10042424 | Ga0207645_100424242 | 198 |
| 374 | 3300025907 | Ga0207645_10054179 | Ga0207645_100541792 | 198 |
| 375 | 3300025908 | Ga0207643_10000819 | Ga0207643_100008199 | 198 |
| 376 | 3300025908 | Ga0207643_10002644 | Ga0207643_100026446 | 198 |
| 377 | 3300025908 | Ga0207643_10075000 | Ga0207643_100750002 | 198 |
| 378 | 3300025908 | Ga0207643_10091593 | Ga0207643_100915933 | 198 |
| 379 | 3300025912 | Ga0207707_10028670 | Ga0207707_100286701 | 198 |
| 380 | 3300025914 | Ga0207671_10100964 | Ga0207671_101009643 | 198 |
| 381 | 3300025916 | Ga0207663_10510540 | Ga0207663_105105401 | 198 |
| 382 | 3300025918 | Ga0207662_10000306 | Ga0207662_1000030610 | 198 |
| 383 | 3300025918 | Ga0207662_10009126 | Ga0207662_100091262 | 198 |
| 384 | 3300025918 | Ga0207662_10010292 | Ga0207662_100102922 | 198 |
| 385 | 3300025918 | Ga0207662_10184080 | Ga0207662_101840802 | 198 |
| 386 | 3300025918 | Ga0207662_10226800 | Ga0207662_102268002 | 198 |
| 387 | 3300025919 | Ga0207657_10037765 | Ga0207657_100377653 | 198 |
| 388 | 3300025920 | Ga0207649_10056444 | Ga0207649_100564442 | 198 |
| 389 | 3300025920 | Ga0207649_10414870 | Ga0207649_104148702 | 198 |
| 390 | 3300025921 | Ga0207652_10214540 | Ga0207652_102145401 | 198 |
| 391 | 3300025922 | Ga0207646_10000295 | Ga0207646_1000029542 | 198 |
| 392 | 3300025923 | Ga0207681_10003926 | Ga0207681_100039264 | 198 |
| 393 | 3300025923 | Ga0207681_10089043 | Ga0207681_100890434 | 198 |
| 394 | 3300025923 | Ga0207681_10218381 | Ga0207681_102183811 | 198 |
| 395 | 3300025923 | Ga0207681_10409619 | Ga0207681_104096192 | 198 |
| 396 | 3300025924 | Ga0207694_10145071 | Ga0207694_101450712 | 198 |
| 397 | 3300025925 | Ga0207650_10000719 | Ga0207650_1000071928 | 198 |
| 398 | 3300025925 | Ga0207650_10015878 | Ga0207650_100158783 | 198 |
| 399 | 3300025925 | Ga0207650_10028142 | Ga0207650_100281423 | 198 |
| 400 | 3300025926 | Ga0207659_10016048 | Ga0207659_100160486 | 198 |
| 401 | 3300025926 | Ga0207659_10026352 | Ga0207659_100263523 | 198 |
| 402 | 3300025926 | Ga0207659_10092384 | Ga0207659_100923842 | 198 |
| 403 | 3300025931 | Ga0207644_10027544 | Ga0207644_100275442 | 198 |
| 404 | 3300025931 | Ga0207644_10028415 | Ga0207644_100284156 | 198 |
| 405 | 3300025931 | Ga0207644_10101239 | Ga0207644_101012391 | 198 |
| 406 | 3300025931 | Ga0207644_10875290 | Ga0207644_108752901 | 198 |
| 407 | 3300025933 | Ga0207706_10002678 | Ga0207706_100026786 | 198 |
| 408 | 3300025933 | Ga0207706_10053095 | Ga0207706_100530952 | 198 |
| 409 | 3300025933 | Ga0207706_10144575 | Ga0207706_101445752 | 198 |
| 410 | 3300025934 | Ga0207686_10602517 | Ga0207686_106025171 | 198 |
| 411 | 3300025935 | Ga0207709_10001128 | Ga0207709_100011284 | 198 |
| 412 | 3300025935 | Ga0207709_10251133 | Ga0207709_102511332 | 198 |
| 413 | 3300025935 | Ga0207709_10369010 | Ga0207709_103690102 | 198 |
| 414 | 3300025936 | Ga0207670_10000013 | Ga0207670_100000135 | 198 |
| 415 | 3300025936 | Ga0207670_10106436 | Ga0207670_101064362 | 198 |
| 416 | 3300025936 | Ga0207670_10129343 | Ga0207670_101293432 | 198 |
| 417 | 3300025936 | Ga0207670_10163334 | Ga0207670_101633342 | 198 |
| 418 | 3300025937 | Ga0207669_10036069 | Ga0207669_100360693 | 198 |
| 419 | 3300025937 | Ga0207669_10234753 | Ga0207669_102347531 | 198 |
| 420 | 3300025938 | Ga0207704_10006479 | Ga0207704_100064795 | 198 |
| 421 | 3300025938 | Ga0207704_10323604 | Ga0207704_103236042 | 198 |
| 422 | 3300025940 | Ga0207691_10004713 | Ga0207691_100047136 | 198 |
| 423 | 3300025940 | Ga0207691_10012663 | Ga0207691_100126631 | 198 |
| 424 | 3300025940 | Ga0207691_10059940 | Ga0207691_100599403 | 198 |
| 425 | 3300025940 | Ga0207691_10148542 | Ga0207691_101485424 | 198 |
| 426 | 3300025940 | Ga0207691_10166626 | Ga0207691_101666262 | 198 |
| 427 | 3300025941 | Ga0207711_10017421 | Ga0207711_100174211 | 198 |
| 428 | 3300025941 | Ga0207711_10087233 | Ga0207711_100872332 | 198 |
| 429 | 3300025941 | Ga0207711_10088805 | Ga0207711_100888052 | 198 |
| 430 | 3300025941 | Ga0207711_10446923 | Ga0207711_104469231 | 198 |
| 431 | 3300025942 | Ga0207689_10000028 | Ga0207689_1000002867 | 198 |
| 432 | 3300025942 | Ga0207689_10005590 | Ga0207689_1000559011 | 198 |
| 433 | 3300025942 | Ga0207689_10021316 | Ga0207689_100213166 | 198 |
| 434 | 3300025942 | Ga0207689_10069578 | Ga0207689_100695783 | 198 |
| 435 | 3300025942 | Ga0207689_10100694 | Ga0207689_101006942 | 198 |
| 436 | 3300025944 | Ga0207661_10209201 | Ga0207661_102092012 | 198 |
| 437 | 3300025945 | Ga0207679_10114739 | Ga0207679_101147392 | 198 |
| 438 | 3300025945 | Ga0207679_10430373 | Ga0207679_104303732 | 198 |
| 439 | 3300025949 | Ga0207667_10052414 | Ga0207667_100524143 | 198 |
| 440 | 3300025949 | Ga0207667_10069817 | Ga0207667_100698176 | 198 |
| 441 | 3300025949 | Ga0207667_10155859 | Ga0207667_101558592 | 198 |
| 442 | 3300025960 | Ga0207651_10069466 | Ga0207651_100694662 | 198 |
| 443 | 3300025960 | Ga0207651_10447841 | Ga0207651_104478412 | 198 |
| 444 | 3300025960 | Ga0207651_10800548 | Ga0207651_108005481 | 198 |
| 445 | 3300025961 | Ga0207712_10017823 | Ga0207712_100178235 | 198 |
| 446 | 3300025961 | Ga0207712_10105366 | Ga0207712_101053662 | 198 |
| 447 | 3300025961 | Ga0207712_10139452 | Ga0207712_101394522 | 198 |
| 448 | 3300025972 | Ga0207668_10034095 | Ga0207668_100340953 | 198 |
| 449 | 3300025981 | Ga0207640_10048338 | Ga0207640_100483382 | 198 |
| 450 | 3300025981 | Ga0207640_10473241 | Ga0207640_104732412 | 198 |
| 451 | 3300025986 | Ga0207658_10060269 | Ga0207658_100602693 | 198 |
| 452 | 3300025986 | Ga0207658_10109112 | Ga0207658_101091124 | 198 |
| 453 | 3300025986 | Ga0207658_10247193 | Ga0207658_102471932 | 198 |
| 454 | 3300025986 | Ga0207658_10286707 | Ga0207658_102867072 | 198 |
| 455 | 3300026023 | Ga0207677_10089943 | Ga0207677_100899432 | 198 |
| 456 | 3300026023 | Ga0207677_10176760 | Ga0207677_101767603 | 198 |
| 457 | 3300026035 | Ga0207703_10001188 | Ga0207703_100011889 | 198 |
| 458 | 3300026035 | Ga0207703_10064744 | Ga0207703_100647442 | 198 |
| 459 | 3300026035 | Ga0207703_10088963 | Ga0207703_100889632 | 198 |
| 460 | 3300026035 | Ga0207703_10147891 | Ga0207703_101478911 | 198 |
| 461 | 3300026041 | Ga0207639_10002176 | Ga0207639_100021767 | 198 |
| 462 | 3300026075 | Ga0207708_10005815 | Ga0207708_100058154 | 198 |
| 463 | 3300026075 | Ga0207708_10006203 | Ga0207708_100062037 | 198 |
| 464 | 3300026075 | Ga0207708_10056929 | Ga0207708_100569294 | 198 |
| 465 | 3300026078 | Ga0207702_10439099 | Ga0207702_104390992 | 198 |
| 466 | 3300026078 | Ga0207702_10676646 | Ga0207702_106766461 | 198 |
| 467 | 3300026088 | Ga0207641_10005314 | Ga0207641_1000531411 | 198 |
| 468 | 3300026088 | Ga0207641_10010772 | Ga0207641_100107725 | 198 |
| 469 | 3300026088 | Ga0207641_10552492 | Ga0207641_105524922 | 198 |
| 470 | 3300026088 | Ga0207641_10566156 | Ga0207641_105661562 | 198 |
| 471 | 3300026089 | Ga0207648_10003835 | Ga0207648_100038359 | 198 |
| 472 | 3300026089 | Ga0207648_10006020 | Ga0207648_100060204 | 198 |
| 473 | 3300026089 | Ga0207648_10006745 | Ga0207648_100067456 | 198 |
| 474 | 3300026089 | Ga0207648_10011832 | Ga0207648_100118328 | 198 |
| 475 | 3300026089 | Ga0207648_10084221 | Ga0207648_100842212 | 198 |
| 476 | 3300026095 | Ga0207676_10000410 | Ga0207676_100004109 | 198 |
| 477 | 3300026095 | Ga0207676_10002118 | Ga0207676_1000211815 | 198 |
| 478 | 3300026095 | Ga0207676_10015805 | Ga0207676_100158056 | 198 |
| 479 | 3300026095 | Ga0207676_10074039 | Ga0207676_100740393 | 198 |
| 480 | 3300026116 | Ga0207674_10002867 | Ga0207674_1000286720 | 198 |
| 481 | 3300026116 | Ga0207674_10012997 | Ga0207674_100129971 | 198 |
| 482 | 3300026116 | Ga0207674_10065812 | Ga0207674_100658123 | 198 |
| 483 | 3300026116 | Ga0207674_10103706 | Ga0207674_101037063 | 198 |
| 484 | 3300026116 | Ga0207674_10263992 | Ga0207674_102639924 | 198 |
| 485 | 3300026116 | Ga0207674_10299029 | Ga0207674_102990292 | 198 |
| 486 | 3300026118 | Ga0207675_100000558 | Ga0207675_10000055821 | 198 |
| 487 | 3300026118 | Ga0207675_100001808 | Ga0207675_1000018083 | 198 |
| 488 | 3300026118 | Ga0207675_100002279 | Ga0207675_1000022798 | 198 |
| 489 | 3300026118 | Ga0207675_100028938 | Ga0207675_1000289381 | 198 |
| 490 | 3300026118 | Ga0207675_100059525 | Ga0207675_1000595253 | 198 |
| 491 | 3300026121 | Ga0207683_10136812 | Ga0207683_101368122 | 198 |
| 492 | 3300026121 | Ga0207683_10267017 | Ga0207683_102670173 | 198 |
| 493 | 3300026121 | Ga0207683_10337137 | Ga0207683_103371371 | 198 |
| 494 | 3300026142 | Ga0207698_10104346 | Ga0207698_101043462 | 198 |
| 495 | 3300027378 | Ga0209981_1002048 | Ga0209981_10020483 | 198 |
| 496 | 3300027462 | Ga0210000_1004960 | Ga0210000_10049602 | 198 |
| 497 | 3300027471 | Ga0209995_1016929 | Ga0209995_10169291 | 198 |
| 498 | 3300027543 | Ga0209999_1001993 | Ga0209999_10019932 | 198 |
| 499 | 3300027543 | Ga0209999_1006910 | Ga0209999_10069101 | 198 |
| 500 | 3300027682 | Ga0209971_1067721 | Ga0209971_10677211 | 198 |
| 501 | 3300027695 | Ga0209966_1034306 | Ga0209966_10343062 | 198 |
| 502 | 3300027907 | Ga0207428_10000343 | Ga0207428_1000034337 | 198 |
| 503 | 3300027907 | Ga0207428_10018104 | Ga0207428_100181046 | 198 |
| 504 | 3300027907 | Ga0207428_10082459 | Ga0207428_100824592 | 198 |
| 505 | 3300027907 | Ga0207428_10096925 | Ga0207428_100969251 | 198 |
| 506 | 3300027907 | Ga0207428_10104280 | Ga0207428_101042802 | 198 |
| 507 | 3300028379 | Ga0268266_10033585 | Ga0268266_100335855 | 198 |
| 508 | 3300028379 | Ga0268266_10339404 | Ga0268266_103394042 | 198 |
| 509 | 3300028379 | Ga0268266_10346715 | Ga0268266_103467151 | 198 |
| 510 | 3300028380 | Ga0268265_10003506 | Ga0268265_100035064 | 198 |
| 511 | 3300028380 | Ga0268265_10047481 | Ga0268265_100474813 | 198 |
| 512 | 3300028380 | Ga0268265_10050667 | Ga0268265_100506672 | 198 |
| 513 | 3300028380 | Ga0268265_10194458 | Ga0268265_101944584 | 198 |
| 514 | 3300028380 | Ga0268265_10253779 | Ga0268265_102537792 | 198 |
| 515 | 3300028381 | Ga0268264_10008749 | Ga0268264_100087497 | 198 |
| 516 | 3300028381 | Ga0268264_10209707 | Ga0268264_102097072 | 198 |
| 517 | 3300028381 | Ga0268264_10542764 | Ga0268264_105427642 | 198 |
| 518 | 3300031456 | Ga0307513_10000272 | Ga0307513_100002729 | 198 |
| 519 | 3300031548 | Ga0307408_100004559 | Ga0307408_1000045595 | 198 |
| 520 | 3300031548 | Ga0307408_100015484 | Ga0307408_1000154841 | 198 |
| 521 | 3300031731 | Ga0307405_10006436 | Ga0307405_100064365 | 198 |
| 522 | 3300031824 | Ga0307413_10044096 | Ga0307413_100440962 | 198 |
| 523 | 3300031852 | Ga0307410_10002281 | Ga0307410_100022815 | 198 |
| 524 | 3300031901 | Ga0307406_10002498 | Ga0307406_100024983 | 198 |
| 525 | 3300031903 | Ga0307407_10015167 | Ga0307407_100151673 | 198 |
| 526 | 3300031903 | Ga0307407_10021730 | Ga0307407_100217303 | 198 |
| 527 | 3300031911 | Ga0307412_10009824 | Ga0307412_100098244 | 198 |
| 528 | 3300031911 | Ga0307412_10209093 | Ga0307412_102090932 | 198 |
| 529 | 3300031995 | Ga0307409_100001947 | Ga0307409_1000019476 | 198 |
| 530 | 3300031995 | Ga0307409_100671906 | Ga0307409_1006719062 | 198 |
| 531 | 3300032002 | Ga0307416_100002671 | Ga0307416_1000026715 | 198 |
| 532 | 3300032004 | Ga0307414_10009697 | Ga0307414_100096972 | 198 |
| 533 | 3300032005 | Ga0307411_10015024 | Ga0307411_100150244 | 198 |
| 534 | 3300032126 | Ga0307415_100012347 | Ga0307415_1000123474 | 198 |
| 535 | 3300034818 | Ga0373950_0075413 | Ga0373950_0075413_42_668 | 198 |
| 536 | 3300035083 | Ga0373926_0181429 | Ga0373926_0181429_66_662 | 198 |
| 537 | 3300035111 | Ga0373923_0125074 | Ga0373923_0125074_429_1025 | 198 |
| 538 | 3300035117 | Ga0373953_0117554 | Ga0373953_0117554_513_1109 | 198 |
| 539 | 3300035120 | Ga0373957_0048041 | Ga0373957_0048041_202_819 | 198 |
| 540 | 3300035172 | Ga0373955_0022181 | Ga0373955_0022181_2561_3178 | 198 |
| 541 | 3300035692 | Ga0373935_0024670 | Ga0373935_0024670_1196_1792 | 198 |
| 542 | 3300035692 | Ga0373935_0317795 | Ga0373935_0317795_372_968 | 198 |
| 543 | 3300035724 | Ga0373933_0057179 | Ga0373933_0057179_161_757 | 198 |
| 544 | 3300035724 | Ga0373933_0203860 | Ga0373933_0203860_109_705 | 198 |
| 545 | 3300035725 | Ga0373947_0063448 | Ga0373947_0063448_13_609 | 198 |
| 546 | 3300036401 | Ga0373937_0034721 | Ga0373937_0034721_1728_2324 | 198 |
| 547 | 3300036401 | Ga0373937_0072158 | Ga0373937_0072158_1377_1973 | 198 |
| 548 | 3300036401 | Ga0373937_0384236 | Ga0373937_0384236_138_755 | 198 |
| 549 | 3300036401 | Ga0373937_0833493 | Ga0373937_0833493_128_724 | 198 |
| 550 | 3300041406 | Ga0439439_0139826 | Ga0439439_0139826_17_664 | 198 |
| 551 | 3300042003 | Ga0439443_042045 | Ga0439443_042045_68_715 | 198 |
| 552 | 3300042009 | Ga0439451_059592 | Ga0439451_059592_69_716 | 198 |
| 553 | 3300042435 | Ga0439434_0080245 | Ga0439434_0080245_78_725 | 198 |
| 554 | 3300042436 | Ga0439435_0017505 | Ga0439435_0017505_1000_1647 | 198 |
| 555 | 3300042461 | Ga0439460_0205149 | Ga0439460_0205149_15_617 | 198 |
| 556 | 3300045049 | Ga0466959_0093658 | Ga0466959_0093658_1537_2133 | 198 |
| 557 | 3300046459 | Ga0495629_0062752 | Ga0495629_0062752_1845_2462 | 198 |
| 558 | 3300046459 | Ga0495629_0174399 | Ga0495629_0174399_411_1007 | 198 |
| 559 | 3300046459 | Ga0495629_0581058 | Ga0495629_0581058_91_729 | 198 |
| 560 | 3300046462 | Ga0495651_0478222 | Ga0495651_0478222_83_679 | 198 |
| 561 | 3300046473 | Ga0495582_0113085 | Ga0495582_0113085_807_1403 | 198 |
| 562 | 3300046473 | Ga0495582_0167903 | Ga0495582_0167903_600_1217 | 198 |
| 563 | 3300046474 | Ga0495605_0111226 | Ga0495605_0111226_376_972 | 198 |
| 564 | 3300046499 | Ga0495594_0014352 | Ga0495594_0014352_2945_3541 | 198 |
| 565 | 3300046499 | Ga0495594_0072642 | Ga0495594_0072642_1210_1806 | 198 |
| 566 | 3300046517 | Ga0495630_0325512 | Ga0495630_0325512_454_1050 | 198 |
| 567 | 3300046528 | Ga0495642_0047162 | Ga0495642_0047162_185_781 | 198 |
| 568 | 3300046536 | Ga0495587_0145415 | Ga0495587_0145415_282_878 | 198 |
| 569 | 3300046537 | Ga0495598_0194011 | Ga0495598_0194011_27_659 | 198 |
| 570 | 3300046539 | Ga0495621_0038774 | Ga0495621_0038774_397_1029 | 198 |
| 571 | 3300046539 | Ga0495621_0038793 | Ga0495621_0038793_100_702 | 198 |
| 572 | 3300046539 | Ga0495621_0106038 | Ga0495621_0106038_235_882 | 198 |
| 573 | 3300046557 | Ga0495622_0211464 | Ga0495622_0211464_184_780 | 198 |
| 574 | 3300046663 | Ga0495635_0009129 | Ga0495635_0009129_6211_6807 | 198 |
| 575 | 3300046664 | Ga0495659_0040391 | Ga0495659_0040391_137_772 | 198 |
| 576 | 3300046674 | Ga0495588_0131666 | Ga0495588_0131666_358_954 | 198 |
| 577 | 3300046675 | Ga0495657_0167719 | Ga0495657_0167719_439_1035 | 198 |
| 578 | 3300046679 | Ga0495623_0273729 | Ga0495623_0273729_110_706 | 198 |
| 579 | 3300046683 | Ga0495658_0185258 | Ga0495658_0185258_436_1074 | 198 |
| 580 | 3300046684 | Ga0495669_0156382 | Ga0495669_0156382_260_907 | 198 |
| 581 | 3300047315 | Ga0495581_0159998 | Ga0495581_0159998_423_1019 | 198 |
| 582 | 3300047317 | Ga0495604_0683113 | Ga0495604_0683113_21_617 | 198 |
| 583 | 3300047321 | Ga0495676_0149715 | Ga0495676_0149715_805_1401 | 198 |
| 584 | 3300047322 | Ga0495680_0069672 | Ga0495680_0069672_746_1342 | 198 |
| 585 | 3300047443 | Ga0495687_021731 | Ga0495687_021731_585_1181 | 198 |
| 586 | 3300048089 | Ga0495614_0290462 | Ga0495614_0290462_79_675 | 198 |
| 587 | 3300048903 | Ga0496100_0074884 | Ga0496100_0074884_232_828 | 198 |
| 588 | 3300048903 | Ga0496100_0225866 | Ga0496100_0225866_715_1347 | 198 |
| 589 | 3300048904 | Ga0496101_0086380 | Ga0496101_0086380_813_1409 | 198 |
| 590 | 3300048905 | Ga0496102_0031108 | Ga0496102_0031108_259_855 | 198 |
| 591 | 3300048905 | Ga0496102_0045218 | Ga0496102_0045218_1992_2621 | 198 |
| 592 | 3300048906 | Ga0496103_0024349 | Ga0496103_0024349_413_1009 | 198 |
| 593 | 3300048906 | Ga0496103_0107826 | Ga0496103_0107826_932_1561 | 198 |
| 594 | 3300048907 | Ga0496104_0146978 | Ga0496104_0146978_1449_2045 | 198 |
| 595 | 3300048908 | Ga0496105_0130369 | Ga0496105_0130369_23_655 | 198 |
| 596 | 3300048909 | Ga0496106_0094045 | Ga0496106_0094045_1290_1919 | 198 |
| 597 | 3300048909 | Ga0496106_0172813 | Ga0496106_0172813_162_758 | 198 |
| 598 | 3300048910 | Ga0496107_0046100 | Ga0496107_0046100_1396_1992 | 198 |
| 599 | 3300048911 | Ga0496108_0316443 | Ga0496108_0316443_580_1176 | 198 |
| 600 | 3300048911 | Ga0496108_0615792 | Ga0496108_0615792_106_738 | 198 |
| 601 | 3300048912 | Ga0496109_0050719 | Ga0496109_0050719_1241_1837 | 198 |
| 602 | 3300048912 | Ga0496109_0113792 | Ga0496109_0113792_17_649 | 198 |
| 603 | 3300048912 | Ga0496109_0134627 | Ga0496109_0134627_1372_2001 | 198 |
| 604 | 3300048912 | Ga0496109_1074836 | Ga0496109_1074836_96_728 | 198 |
| 605 | 3300048913 | Ga0496110_0110273 | Ga0496110_0110273_1208_1840 | 198 |
| 606 | 3300048913 | Ga0496110_0688221 | Ga0496110_0688221_29_625 | 198 |
| 607 | 3300048914 | Ga0496111_0049665 | Ga0496111_0049665_949_1581 | 198 |
| 608 | 3300048917 | Ga0496114_0162445 | Ga0496114_0162445_1069_1665 | 198 |
| 609 | 3300048917 | Ga0496114_0551687 | Ga0496114_0551687_247_879 | 198 |
| 610 | 3300048919 | Ga0496116_0001150 | Ga0496116_0001150_27028_27660 | 198 |
| 611 | 3300048927 | Ga0496124_0126504 | Ga0496124_0126504_1391_1987 | 198 |
| 612 | 3300049513 | Ga0501290_002541 | Ga0501290_002541_1524_2120 | 198 |
| 613 | 3300049514 | Ga0501291_000689 | Ga0501291_000689_1587_2183 | 198 |
| 614 | 3300049515 | Ga0501292_000230 | Ga0501292_000230_6273_6869 | 198 |
| 615 | 3300049516 | Ga0501293_000492 | Ga0501293_000492_1176_1772 | 198 |
| 616 | 3300049519 | Ga0501296_000849 | Ga0501296_000849_952_1548 | 198 |
| 617 | 3300049520 | Ga0501297_000022 | Ga0501297_000022_1200_1796 | 198 |
| 618 | 3300049523 | Ga0501300_000082 | Ga0501300_000082_12720_13316 | 198 |
| 619 | 3300049526 | Ga0501303_001246 | Ga0501303_001246_378_974 | 198 |
| 620 | 3300049572 | Ga0501036_0325235 | Ga0501036_0325235_380_1009 | 198 |
| 621 | 3300049572 | Ga0501036_0461696 | Ga0501036_0461696_44_694 | 198 |
| 622 | 3300049574 | Ga0501038_0157775 | Ga0501038_0157775_891_1487 | 198 |
| 623 | 3300049575 | Ga0501039_0096337 | Ga0501039_0096337_181_777 | 198 |
| 624 | 3300049580 | Ga0501046_0184648 | Ga0501046_0184648_481_1077 | 198 |
| 625 | 3300049585 | Ga0501069_0082208 | Ga0501069_0082208_980_1576 | 198 |
| 626 | 3300049587 | Ga0501071_0276118 | Ga0501071_0276118_69_698 | 198 |
| 627 | 3300049588 | Ga0501072_0464462 | Ga0501072_0464462_282_911 | 198 |
| 628 | 3300049592 | Ga0501076_0163176 | Ga0501076_0163176_566_1195 | 198 |
| 629 | 3300049650 | Ga0501199_002758 | Ga0501199_002758_131_727 | 198 |
| 630 | 3300049652 | Ga0501202_036676 | Ga0501202_036676_237_833 | 198 |
| 631 | 3300049656 | Ga0501209_014175 | Ga0501209_014175_1065_1661 | 198 |
| 632 | 3300049658 | Ga0501211_012531 | Ga0501211_012531_62_658 | 198 |
| 633 | 3300049660 | Ga0501216_031344 | Ga0501216_031344_309_905 | 198 |
| 634 | 3300049664 | Ga0501224_015280 | Ga0501224_015280_403_999 | 198 |
| 635 | 3300049669 | Ga0501235_000547 | Ga0501235_000547_263_859 | 198 |
| 636 | 3300049675 | Ga0501243_000200 | Ga0501243_000200_4320_4916 | 198 |
| 637 | 3300049676 | Ga0501246_000210 | Ga0501246_000210_822_1418 | 198 |
| 638 | 3300049678 | Ga0501248_002711 | Ga0501248_002711_272_868 | 198 |
| 639 | 3300049686 | Ga0501257_004363 | Ga0501257_004363_815_1411 | 198 |
| 640 | 3300049689 | Ga0501260_002083 | Ga0501260_002083_279_875 | 198 |
| 641 | 3300049704 | Ga0501221_001736 | Ga0501221_001736_2503_3099 | 198 |
| 642 | 3300049705 | Ga0501225_0014264 | Ga0501225_0014264_1384_1980 | 198 |
| 643 | 3300049706 | Ga0501229_010104 | Ga0501229_010104_539_1135 | 198 |
| 644 | 3300049708 | Ga0501245_002018 | Ga0501245_002018_749_1345 | 198 |
| 645 | 3300049742 | Ga0501080_0994758 | Ga0501080_0994758_19_621 | 198 |
| 646 | 3300049761 | Ga0501264_002343 | Ga0501264_002343_832_1428 | 198 |
| 647 | 3300049762 | Ga0501265_011475 | Ga0501265_011475_201_797 | 198 |
| 648 | 3300049763 | Ga0501266_003040 | Ga0501266_003040_851_1447 | 198 |
| 649 | 3300049767 | Ga0501270_000021 | Ga0501270_000021_8866_9462 | 198 |
| 650 | 3300049770 | Ga0501273_001850 | Ga0501273_001850_853_1449 | 198 |
| 651 | 3300049772 | Ga0501275_001295 | Ga0501275_001295_166_762 | 198 |
| 652 | 3300049773 | Ga0501276_002228 | Ga0501276_002228_428_1024 | 198 |
| 653 | 3300049774 | Ga0501278_000078 | Ga0501278_000078_3450_4046 | 198 |
| 654 | 3300049775 | Ga0501279_000695 | Ga0501279_000695_2602_3198 | 198 |
| 655 | 3300049777 | Ga0501281_00720 | Ga0501281_00720_1314_1910 | 198 |
| 656 | 3300049779 | Ga0501283_000146 | Ga0501283_000146_1638_2234 | 198 |
| 657 | 3300049851 | Ga0501212_003881 | Ga0501212_003881_460_1056 | 198 |
| 658 | 3300050489 | nmdc:mga03683_82729_c1 | nmdc:mga03683_82729_c1_713_1348 | 198 |
| 659 | 3300050491 | nmdc:mga00v17_6528_c1 | nmdc:mga00v17_6528_c1_4078_4713 | 198 |
| 660 | 3300050493 | nmdc:mga0k408_1050_c1 | nmdc:mga0k408_1050_c1_249_884 | 198 |
| 661 | 3300050494 | nmdc:mga06z11_2252_c1 | nmdc:mga06z11_2252_c1_2628_3263 | 198 |
| 662 | 3300050507 | nmdc:mga05p37_212485_c1 | nmdc:mga05p37_212485_c1_1182_1778 | 198 |
| 663 | 3300050507 | nmdc:mga05p37_636_c1 | nmdc:mga05p37_636_c1_24872_25474 | 198 |
| 664 | 3300050508 | nmdc:mga09592_1481_c1 | nmdc:mga09592_1481_c1_12220_12822 | 198 |
| 665 | 3300050508 | nmdc:mga09592_21700_c1 | nmdc:mga09592_21700_c1_3058_3684 | 198 |
| 666 | 3300050508 | nmdc:mga09592_337367_c1 | nmdc:mga09592_337367_c1_367_1002 | 198 |
| 667 | 3300050508 | nmdc:mga09592_779128_c1 | nmdc:mga09592_779128_c1_92_688 | 198 |
| 668 | 3300050509 | nmdc:mga0qj67_11261_c1 | nmdc:mga0qj67_11261_c1_1013_1654 | 198 |
| 669 | 3300050509 | nmdc:mga0qj67_85207_c1 | nmdc:mga0qj67_85207_c1_178_804 | 198 |
| 670 | 3300050510 | nmdc:mga06r32_119136_c1 | nmdc:mga06r32_119136_c1_1850_2476 | 198 |
| 671 | 3300050511 | nmdc:mga08y16_3237_c1 | nmdc:mga08y16_3237_c1_15065_15700 | 198 |
| 672 | 3300050511 | nmdc:mga08y16_41146_c1 | nmdc:mga08y16_41146_c1_2998_3594 | 198 |
| 673 | 3300050511 | nmdc:mga08y16_4821_c1 | nmdc:mga08y16_4821_c1_7862_8464 | 198 |
| 674 | 3300050511 | nmdc:mga08y16_56895_c1 | nmdc:mga08y16_56895_c1_2888_3484 | 198 |
| 675 | 3300050512 | nmdc:mga0n895_624395_c1 | nmdc:mga0n895_624395_c1_419_1054 | 198 |
| 676 | 3300050512 | nmdc:mga0n895_722787_c1 | nmdc:mga0n895_722787_c1_17_649 | 198 |
| 677 | 3300050515 | nmdc:mga0a205_117512_c1 | nmdc:mga0a205_117512_c1_1821_2456 | 198 |
| 678 | 3300050515 | nmdc:mga0a205_236608_c1 | nmdc:mga0a205_236608_c1_177_779 | 198 |
| 679 | 3300053077 | Ga0495601_0237776 | Ga0495601_0237776_180_776 | 198 |
| 680 | 3300053084 | Ga0495595_0083016 | Ga0495595_0083016_411_1007 | 198 |
| 681 | 3300053085 | Ga0495619_0394905 | Ga0495619_0394905_107_703 | 198 |
| 682 | 3300061734 | Ga0530510_0143240 | Ga0530510_0143240_560_1177 | 198 |
| 683 | iso_pu_bacteria | 2834641062 | 2834645213 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.8375 | 5 | 198 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.7565 | 8 | 188 |
| 5d92-assembly2.cif.gz_B | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.6782 | 8 | 189 |
| 5d92-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.6767 | 8 | 189 |
| 4mnd-assembly1.cif.gz_A-2 | crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein | 0.6701 | 8 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9554 | 2 | 195 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9362 | 1 | 184 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9321 | 2 | 195 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9033 | 1 | 184 | 1.20.120.1760 |
| af_E7F188_23_199_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8741 | 8 | 196 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A068S3H5-F1-model_v4 | Pyruvate carboxylase | 0.9803 | 2 | 93 |
GO:0005524
GO:0008654 GO:0016020 GO:0016780 GO:0016874 GO:0046872 |
| AF-A0A507CX03-F1-model_v4 | RNA polymerase II transcription factor B subunit 2 | 0.97 | 2 | 198 |
GO:0000439
GO:0001671 GO:0003690 GO:0005675 GO:0006289 GO:0008654 GO:0016020 GO:0016780 |
| AF-A0A507CX03-F1-model_v4 | RNA polymerase II transcription factor B subunit 2 | 0.9605 | 2 | 198 |
GO:0000439
GO:0001671 GO:0003690 GO:0005675 GO:0006289 GO:0008654 GO:0016020 GO:0016780 |
| AF-A0A507C890-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9595 | 2 | 198 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
| AF-R8BT71-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9585 | 2 | 198 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar