F474960

General Info

Members Datasets Scaffolds Average Seq Length
683 340 682 205

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100016195|Ga0070671_1000161952
Length 223
Sequence MEPLKRRGDSIGAMIRPAKAPRHFSMIRGFHLADFFTLANAACGMGAIFLAMIHVGSHAASHFYAAAAMAPAALLFDVLDGRIARWRREHSALGRELDSLADVISFGVAPATLAYAAGLRGGWDMIALIYFVCCGVSRLARYNVTADDLSAGSGKVSYFEGTPIPTTVLLTAVLAFAAWRGRLDENIFGGMWMLGPWQIHPLVLLFVASGTLMVSKTLRIPKL

Samples

Sample ID Description Type Environment
1 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
180 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
228 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
231 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
280 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
281 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
282 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
283 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
284 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
285 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
286 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
297 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
298 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
299 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
300 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
301 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
302 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
303 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
304 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
305 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
306 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
307 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
311 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
314 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
315 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
316 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
317 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
318 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
319 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
320 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
321 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
322 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
323 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
326 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.29
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0.44
Rhizoplane 3.37
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1003387 3300001976 Bacteria 2098
2 JGI24034J26672_10023104 3300002239 Bacteria 986
3 rootH1_10009155 3300003323 Bacteria 18521
4 Ga0055526_1004475 3300003771 Bacteria 8379
5 Ga0055540_1013809 3300003792 Bacteria 2445
6 Ga0058861_10054973 3300004800 Bacteria 2128
7 Ga0065712_10075717 3300005290 Bacteria 3802
8 Ga0065715_10488263 3300005293 Bacteria 791
9 Ga0065707_10090900 3300005295 Bacteria 4027
10 Ga0070676_10003923 3300005328 Bacteria 7807
11 Ga0070676_10039107 3300005328 Bacteria 2742
12 Ga0070676_10076191 3300005328 Bacteria 2024
13 Ga0070683_100050405 3300005329 Bacteria 3854
14 Ga0070690_100054133 3300005330 Bacteria 2569
15 Ga0070690_100086712 3300005330 Bacteria 2055
16 Ga0070670_100000604 3300005331 Bacteria 28187
17 Ga0070670_100029853 3300005331 Bacteria 4696
18 Ga0070670_100294175 3300005331 Bacteria 1419
19 Ga0070670_100377568 3300005331 Bacteria 1248
20 Ga0070670_100768633 3300005331 Bacteria 869
21 Ga0070677_10216060 3300005333 Bacteria 934
22 Ga0068869_100001219 3300005334 Bacteria 15131
23 Ga0068869_100011586 3300005334 Bacteria 5789
24 Ga0068869_100055916 3300005334 Bacteria 2877
25 Ga0068869_100100543 3300005334 Bacteria 2187
26 Ga0068869_100200787 3300005334 Bacteria 1572
27 Ga0070666_10094671 3300005335 Bacteria 2055
28 Ga0070666_10256842 3300005335 Bacteria 1238
29 Ga0070680_100078774 3300005336 Unclassified 2715
30 Ga0070680_100102715 3300005336 Bacteria 2374
31 Ga0070680_100142754 3300005336 Bacteria 2008
32 Ga0070680_100155563 3300005336 Bacteria 1920
33 Ga0070682_100439851 3300005337 Bacteria 996
34 Ga0068868_100058625 3300005338 Bacteria 3043
35 Ga0068868_100211162 3300005338 Bacteria 1622
36 Ga0070660_100042423 3300005339 Bacteria 3472
37 Ga0070689_100000594 3300005340 Bacteria 21856
38 Ga0070689_100291286 3300005340 Bacteria 1357
39 Ga0070689_100395205 3300005340 Bacteria 1167
40 Ga0070691_10155946 3300005341 Bacteria 1174
41 Ga0070691_10164594 3300005341 Bacteria 1145
42 Ga0070687_100062226 3300005343 Bacteria 1975
43 Ga0070687_100079654 3300005343 Bacteria 1784
44 Ga0070687_100109105 3300005343 Bacteria 1563
45 Ga0070687_100298592 3300005343 Bacteria 1021
46 Ga0070661_100087149 3300005344 Bacteria 2309
47 Ga0070668_100005159 3300005347 Bacteria 9689
48 Ga0070668_100012530 3300005347 Bacteria 6315
49 Ga0070668_100139844 3300005347 Bacteria 1950
50 Ga0070669_100004561 3300005353 Bacteria 9996
51 Ga0070669_100006331 3300005353 Bacteria 8534
52 Ga0070669_100134960 3300005353 Bacteria 1897
53 Ga0070669_100282904 3300005353 Bacteria 1329
54 Ga0070669_100481719 3300005353 Bacteria 1027
55 Ga0070675_100006929 3300005354 Bacteria 8703
56 Ga0070675_100014015 3300005354 Bacteria 6313
57 Ga0070675_100018866 3300005354 Bacteria 5492
58 Ga0070675_100083893 3300005354 Bacteria 2660
59 Ga0070675_100104335 3300005354 Bacteria 2391
60 Ga0070675_100763391 3300005354 Bacteria 883
61 Ga0070671_100016195 3300005355 Bacteria 6029
62 Ga0070671_100055638 3300005355 Bacteria 3291
63 Ga0070671_100064503 3300005355 Bacteria 3050
64 Ga0070671_100646259 3300005355 Bacteria 916
65 Ga0070674_100083440 3300005356 Bacteria 2288
66 Ga0070674_100399624 3300005356 Bacteria 1122
67 Ga0070674_100729456 3300005356 Bacteria 850
68 Ga0070673_100004218 3300005364 Bacteria 9071
69 Ga0070673_100006929 3300005364 Bacteria 7414
70 Ga0070673_100043974 3300005364 Bacteria 3456
71 Ga0070673_100130428 3300005364 Bacteria 2108
72 Ga0070673_100303350 3300005364 Bacteria 1406
73 Ga0070688_100053437 3300005365 Bacteria 2527
74 Ga0070688_100145258 3300005365 Bacteria 1615
75 Ga0070688_100480134 3300005365 Bacteria 934
76 Ga0070659_100012718 3300005366 Bacteria 6246
77 Ga0070659_100214244 3300005366 Bacteria 1588
78 Ga0070659_100288786 3300005366 Bacteria 1366
79 Ga0070667_100011931 3300005367 Bacteria 7189
80 Ga0070667_100140314 3300005367 Bacteria 2116
81 Ga0070667_100255851 3300005367 Bacteria 1566
82 Ga0070667_100307065 3300005367 Bacteria 1429
83 Ga0070667_100549376 3300005367 Bacteria 1061
84 Ga0070701_10042281 3300005438 Bacteria 2326
85 Ga0070701_10232516 3300005438 Bacteria 1105
86 Ga0070700_100000367 3300005441 Bacteria 23131
87 Ga0070700_100005117 3300005441 Bacteria 6919
88 Ga0070700_100028528 3300005441 Bacteria 3321
89 Ga0070700_100057948 3300005441 Bacteria 2432
90 Ga0070700_100101352 3300005441 Bacteria 1897
91 Ga0070700_100105938 3300005441 Bacteria 1860
92 Ga0070694_100207655 3300005444 Bacteria 1463
93 Ga0070708_100299229 3300005445 Unclassified 1515
94 Ga0070678_100264441 3300005456 Bacteria 1448
95 Ga0070662_100101534 3300005457 Bacteria 2177
96 Ga0070662_100113468 3300005457 Bacteria 2068
97 Ga0070681_10027047 3300005458 Bacteria 5768
98 Ga0070681_10036389 3300005458 Unclassified 4943
99 Ga0068867_100001130 3300005459 Bacteria 18235
100 Ga0068867_100009485 3300005459 Bacteria 6865
101 Ga0068867_100010602 3300005459 Bacteria 6501
102 Ga0068867_100011974 3300005459 Bacteria 6128
103 Ga0068867_100173276 3300005459 Bacteria 1710
104 Ga0068867_100185706 3300005459 Bacteria 1656
105 Ga0070685_10041656 3300005466 Bacteria 2618
106 Ga0070685_10573195 3300005466 Bacteria 809
107 Ga0070706_100000846 3300005467 Bacteria 33705
108 Ga0070706_100043457 3300005467 Bacteria 4152
109 Ga0070706_101053980 3300005467 Bacteria 749
110 Ga0070707_100000587 3300005468 Bacteria 36579
111 Ga0070707_100041532 3300005468 Bacteria 4402
112 Ga0070707_100086817 3300005468 Bacteria 3026
113 Ga0070698_100009454 3300005471 Bacteria 10444
114 Ga0070698_100091390 3300005471 Bacteria 3027
115 Ga0070698_100626244 3300005471 Bacteria 1017
116 Ga0070699_100080389 3300005518 Bacteria 2841
117 Ga0070699_100235144 3300005518 Bacteria 1634
118 Ga0070679_100109674 3300005530 Bacteria 2746
119 Ga0070684_100079120 3300005535 Bacteria 2906
120 Ga0070697_100019292 3300005536 Bacteria 5386
121 Ga0070697_100230533 3300005536 Bacteria 1580
122 Ga0068853_100001930 3300005539 Bacteria 15284
123 Ga0070672_100027941 3300005543 Bacteria 4214
124 Ga0070672_100032608 3300005543 Bacteria 3934
125 Ga0070672_100114420 3300005543 Bacteria 2202
126 Ga0070672_100170355 3300005543 Bacteria 1811
127 Ga0070686_100010270 3300005544 Bacteria 5273
128 Ga0070686_100087760 3300005544 Bacteria 2074
129 Ga0070686_100130573 3300005544 Bacteria 1737
130 Ga0070695_100027112 3300005545 Bacteria 3547
131 Ga0070696_100609556 3300005546 Bacteria 881
132 Ga0070665_100441509 3300005548 Bacteria 1311
133 Ga0070665_100449257 3300005548 Bacteria 1298
134 Ga0070665_100801535 3300005548 Bacteria 955
135 Ga0070704_100095414 3300005549 Bacteria 2227
136 Ga0070704_100413031 3300005549 Bacteria 1154
137 Ga0070704_100486434 3300005549 Bacteria 1069
138 Ga0068855_100011783 3300005563 Bacteria 10574
139 Ga0068855_100102398 3300005563 Bacteria 3296
140 Ga0068855_100107689 3300005563 Bacteria 3202
141 Ga0068855_100118103 3300005563 Bacteria 3038
142 Ga0068857_100003353 3300005577 Bacteria 13334
143 Ga0068857_100008057 3300005577 Bacteria 9087
144 Ga0068857_100303716 3300005577 Bacteria 1471
145 Ga0068857_100321976 3300005577 Bacteria 1428
146 Ga0068857_100522407 3300005577 Bacteria 1116
147 Ga0068854_100255150 3300005578 Bacteria 1402
148 Ga0068854_100313817 3300005578 Bacteria 1272
149 Ga0068856_100037185 3300005614 Bacteria 4776
150 Ga0068856_100125323 3300005614 Bacteria 2572
151 Ga0068856_100340697 3300005614 Bacteria 1517
152 Ga0070702_100069776 3300005615 Bacteria 2072
153 Ga0070702_100096073 3300005615 Bacteria 1808
154 Ga0068852_100059661 3300005616 Bacteria 3309
155 Ga0068859_100002178 3300005617 Bacteria 19895
156 Ga0068859_100014884 3300005617 Bacteria 7810
157 Ga0068859_100031453 3300005617 Bacteria 5330
158 Ga0068859_100053334 3300005617 Bacteria 4067
159 Ga0068859_100084020 3300005617 Bacteria 3228
160 Ga0068859_100186622 3300005617 Bacteria 2157
161 Ga0068864_100003861 3300005618 Bacteria 12345
162 Ga0068864_100027295 3300005618 Bacteria 4820
163 Ga0068864_100131896 3300005618 Bacteria 2245
164 Ga0068864_100153290 3300005618 Bacteria 2089
165 Ga0068866_10024646 3300005718 Bacteria 2818
166 Ga0068866_10143228 3300005718 Bacteria 1375
167 Ga0068861_100000843 3300005719 Bacteria 18576
168 Ga0068861_100000932 3300005719 Bacteria 17784
169 Ga0068861_100049010 3300005719 Bacteria 3196
170 Ga0068861_100166995 3300005719 Bacteria 1820
171 Ga0068861_100241805 3300005719 Bacteria 1536
172 Ga0068851_10041909 3300005834 Bacteria 2303
173 Ga0068870_10251292 3300005840 Bacteria 1096
174 Ga0068863_100024480 3300005841 Bacteria 5757
175 Ga0068863_100061807 3300005841 Bacteria 3542
176 Ga0068863_100150511 3300005841 Bacteria 2227
177 Ga0068863_100208293 3300005841 Bacteria 1882
178 Ga0068858_100080516 3300005842 Bacteria 3026
179 Ga0068858_100332947 3300005842 Bacteria 1452
180 Ga0068860_100001499 3300005843 Bacteria 25181
181 Ga0068860_100008189 3300005843 Bacteria 10405
182 Ga0068860_100236638 3300005843 Bacteria 1775
183 Ga0068860_100361199 3300005843 Bacteria 1431
184 Ga0068862_100001468 3300005844 Bacteria 21680
185 Ga0068862_100004126 3300005844 Bacteria 12308
186 Ga0068862_100077379 3300005844 Bacteria 2880
187 Ga0068862_100118728 3300005844 Bacteria 2328
188 Ga0068862_100442481 3300005844 Bacteria 1224
189 Ga0068862_100986743 3300005844 Unclassified 832
190 Ga0075365_10008050 3300006038 Bacteria 5952
191 Ga0075364_10249097 3300006051 Bacteria 1207
192 Ga0075362_10035713 3300006177 Bacteria 2171
193 Ga0075367_10000137 3300006178 Bacteria 21968
194 Ga0075366_10001318 3300006195 Bacteria 12382
195 Ga0075366_10111173 3300006195 Bacteria 1648
196 Ga0097621_100018307 3300006237 Bacteria 5345
197 Ga0097621_100079838 3300006237 Bacteria 2720
198 Ga0097621_100387649 3300006237 Bacteria 1249
199 Ga0068871_100080583 3300006358 Bacteria 2695
200 Ga0068871_100168094 3300006358 Bacteria 1878
201 Ga0068871_100318131 3300006358 Bacteria 1370
202 Ga0075428_100000868 3300006844 Bacteria 31799
203 Ga0075428_100090575 3300006844 Bacteria 3336
204 Ga0075428_100671555 3300006844 Bacteria 1104
205 Ga0075430_100005921 3300006846 Bacteria 10328
206 Ga0075430_100058216 3300006846 Bacteria 3248
207 Ga0075430_100095439 3300006846 Bacteria 2485
208 Ga0075430_100097634 3300006846 Bacteria 2455
209 Ga0075430_100213151 3300006846 Bacteria 1602
210 Ga0075431_100003309 3300006847 Bacteria 15609
211 Ga0075431_100013642 3300006847 Bacteria 8211
212 Ga0075431_100056558 3300006847 Bacteria 4046
213 Ga0075433_10142226 3300006852 Bacteria 2132
214 Ga0075433_10380513 3300006852 Bacteria 1246
215 Ga0075429_100000796 3300006880 Bacteria 24797
216 Ga0075429_100007739 3300006880 Bacteria 9328
217 Ga0075429_100017068 3300006880 Bacteria 6276
218 Ga0075429_100797207 3300006880 Bacteria 827
219 Ga0068865_100006209 3300006881 Bacteria 7283
220 Ga0097620_100002178 3300006931 Bacteria 19895
221 Ga0097620_100014883 3300006931 Bacteria 7810
222 Ga0097620_100031453 3300006931 Bacteria 5330
223 Ga0097620_100053330 3300006931 Bacteria 4067
224 Ga0097620_100084021 3300006931 Bacteria 3228
225 Ga0097620_100186618 3300006931 Bacteria 2157
226 Ga0099824_1039530 3300006942 Bacteria 1202
227 Ga0099823_1000003 3300006944 Bacteria 189058
228 Ga0075435_100407323 3300007076 Unclassified 1170
229 Ga0111539_10002695 3300009094 Bacteria 23526
230 Ga0111539_10026457 3300009094 Bacteria 7092
231 Ga0111539_10098895 3300009094 Bacteria 3426
232 Ga0111539_10227395 3300009094 Bacteria 2173
233 Ga0111539_10962797 3300009094 Bacteria 992
234 Ga0105247_10410708 3300009101 Bacteria 967
235 Ga0114129_10001859 3300009147 Bacteria 28771
236 Ga0114129_10019694 3300009147 Bacteria 9605
237 Ga0114129_10130914 3300009147 Bacteria 3446
238 Ga0114129_10706265 3300009147 Bacteria 1295
239 Ga0114129_10727170 3300009147 Bacteria 1273
240 Ga0105243_10001846 3300009148 Bacteria 18113
241 Ga0105243_10426877 3300009148 Bacteria 1238
242 Ga0105243_10535292 3300009148 Bacteria 1116
243 Ga0105241_10014623 3300009174 Bacteria 5746
244 Ga0105241_10108152 3300009174 Bacteria 2222
245 Ga0105242_11450534 3300009176 Bacteria 715
246 Ga0105248_10011621 3300009177 Bacteria 9699
247 Ga0105248_10028123 3300009177 Bacteria 6262
248 Ga0105248_10425367 3300009177 Bacteria 1496
249 Ga0105248_10745690 3300009177 Bacteria 1105
250 Ga0105237_10101719 3300009545 Bacteria 2865
251 Ga0105238_10011338 3300009551 Bacteria 8969
252 Ga0105238_10017026 3300009551 Bacteria 7378
253 Ga0105249_10003380 3300009553 Bacteria 13816
254 Ga0105249_10143486 3300009553 Bacteria 2292
255 Ga0105249_10333614 3300009553 Bacteria 1531
256 Ga0105249_10694578 3300009553 Bacteria 1077
257 Ga0105249_11306513 3300009553 Unclassified 797
258 Ga0105249_11409970 3300009553 Bacteria 769
259 Ga0105239_10100344 3300010375 Bacteria 3202
260 Ga0105246_10098816 3300011119 Bacteria 2121
261 Ga0105246_10305201 3300011119 Bacteria 1287
262 Ga0105246_10497435 3300011119 Bacteria 1035
263 Ga0157371_10196339 3300013102 Bacteria 1446
264 Ga0157369_10047746 3300013105 Bacteria 4647
265 Ga0157374_10094506 3300013296 Bacteria 2857
266 Ga0157374_10167470 3300013296 Bacteria 2142
267 Ga0163162_10017941 3300013306 Bacteria 6926
268 Ga0163162_10107241 3300013306 Bacteria 2888
269 Ga0163162_10462907 3300013306 Bacteria 1400
270 Ga0163162_10749802 3300013306 Bacteria 1096
271 Ga0163162_11575553 3300013306 Bacteria 749
272 Ga0157372_10920345 3300013307 Bacteria 1014
273 Ga0157375_10063699 3300013308 Bacteria 3669
274 Ga0157375_10190221 3300013308 Bacteria 2207
275 Ga0163163_10061531 3300014325 Bacteria 3720
276 Ga0163163_10906038 3300014325 Bacteria 945
277 Ga0157380_10018127 3300014326 Bacteria 5222
278 Ga0157377_10190663 3300014745 Bacteria 1295
279 Ga0157377_10219461 3300014745 Bacteria 1216
280 Ga0157379_10254425 3300014968 Bacteria 1595
281 Ga0157376_10073704 3300014969 Bacteria 2908
282 Ga0163161_10135119 3300017792 Bacteria 1864
283 Ga0163161_10299774 3300017792 Bacteria 1265
284 Ga0206356_10399998 3300020070 Bacteria 1994
285 Ga0209673_1013689 3300025273 Bacteria 3189
286 Ga0207673_1002917 3300025290 Bacteria 1979
287 Ga0209564_1000392 3300025295 Bacteria 78508
288 Ga0209050_1001991 3300025298 Bacteria 19136
289 Ga0209256_1000634 3300025299 Bacteria 47973
290 Ga0209051_1001010 3300025303 Bacteria 27010
291 Ga0209257_1001115 3300025304 Bacteria 34828
292 Ga0207697_10011272 3300025315 Bacteria 3787
293 Ga0207697_10023714 3300025315 Bacteria 2512
294 Ga0207656_10043387 3300025321 Bacteria 1918
295 Ga0207656_10065491 3300025321 Bacteria 1604
296 Ga0207682_10001713 3300025893 Bacteria 10039
297 Ga0207682_10007887 3300025893 Bacteria 4227
298 Ga0207682_10020443 3300025893 Bacteria 2600
299 Ga0207682_10191253 3300025893 Bacteria 938
300 Ga0207642_10090307 3300025899 Bacteria 1511
301 Ga0207688_10041449 3300025901 Bacteria 2561
302 Ga0207688_10054690 3300025901 Bacteria 2240
303 Ga0207688_10225475 3300025901 Bacteria 1130
304 Ga0207680_10079468 3300025903 Bacteria 2057
305 Ga0207645_10004033 3300025907 Bacteria 10944
306 Ga0207645_10042424 3300025907 Bacteria 2910
307 Ga0207645_10054179 3300025907 Bacteria 2562
308 Ga0207643_10000819 3300025908 Bacteria 18894
309 Ga0207643_10002644 3300025908 Bacteria 9697
310 Ga0207643_10075000 3300025908 Bacteria 1951
311 Ga0207643_10091593 3300025908 Bacteria 1773
312 Ga0207684_10000363 3300025910 Bacteria 61249
313 Ga0207684_10409763 3300025910 Bacteria 1165
314 Ga0207654_10006976 3300025911 Bacteria 5692
315 Ga0207707_10028670 3300025912 Unclassified 4865
316 Ga0207707_10082358 3300025912 Bacteria 2810
317 Ga0207695_10144075 3300025913 Bacteria 2328
318 Ga0207671_10014674 3300025914 Bacteria 6180
319 Ga0207671_10100964 3300025914 Bacteria 2185
320 Ga0207663_10510540 3300025916 Bacteria 935
321 Ga0207660_10261214 3300025917 Bacteria 1369
322 Ga0207662_10000306 3300025918 Bacteria 22584
323 Ga0207662_10009126 3300025918 Bacteria 5450
324 Ga0207662_10010292 3300025918 Bacteria 5162
325 Ga0207662_10184080 3300025918 Bacteria 1345
326 Ga0207662_10226800 3300025918 Bacteria 1218
327 Ga0207657_10037765 3300025919 Bacteria 4308
328 Ga0207657_10216810 3300025919 Bacteria 1534
329 Ga0207649_10056444 3300025920 Bacteria 2452
330 Ga0207649_10082814 3300025920 Bacteria 2081
331 Ga0207649_10414870 3300025920 Bacteria 1010
332 Ga0207652_10214540 3300025921 Unclassified 1733
333 Ga0207646_10000295 3300025922 Bacteria 67699
334 Ga0207646_10037324 3300025922 Bacteria 4381
335 Ga0207681_10003926 3300025923 Bacteria 9221
336 Ga0207681_10089043 3300025923 Bacteria 2199
337 Ga0207681_10218381 3300025923 Bacteria 1473
338 Ga0207681_10409619 3300025923 Bacteria 1096
339 Ga0207694_10008187 3300025924 Bacteria 7901
340 Ga0207694_10145071 3300025924 Bacteria 1910
341 Ga0207650_10000719 3300025925 Bacteria 25725
342 Ga0207650_10015878 3300025925 Bacteria 5253
343 Ga0207650_10028142 3300025925 Bacteria 4027
344 Ga0207659_10016048 3300025926 Bacteria 4867
345 Ga0207659_10026352 3300025926 Bacteria 3921
346 Ga0207659_10092384 3300025926 Bacteria 2262
347 Ga0207659_10158284 3300025926 Bacteria 1775
348 Ga0207687_10011546 3300025927 Bacteria 5773
349 Ga0207644_10027544 3300025931 Bacteria 3927
350 Ga0207644_10028415 3300025931 Bacteria 3871
351 Ga0207644_10101239 3300025931 Bacteria 2164
352 Ga0207644_10875290 3300025931 Bacteria 752
353 Ga0207690_10038419 3300025932 Bacteria 3116
354 Ga0207706_10002678 3300025933 Bacteria 17355
355 Ga0207706_10053095 3300025933 Bacteria 3578
356 Ga0207706_10144575 3300025933 Bacteria 2092
357 Ga0207686_10602517 3300025934 Bacteria 865
358 Ga0207709_10001128 3300025935 Bacteria 19505
359 Ga0207709_10251133 3300025935 Bacteria 1292
360 Ga0207709_10369010 3300025935 Bacteria 1089
361 Ga0207670_10000013 3300025936 Bacteria 211834
362 Ga0207670_10106436 3300025936 Bacteria 2012
363 Ga0207670_10129343 3300025936 Bacteria 1847
364 Ga0207670_10163334 3300025936 Bacteria 1664
365 Ga0207669_10036069 3300025937 Bacteria 2821
366 Ga0207669_10234753 3300025937 Bacteria 1355
367 Ga0207704_10006479 3300025938 Bacteria 5462
368 Ga0207704_10323604 3300025938 Bacteria 1190
369 Ga0207691_10004713 3300025940 Bacteria 13198
370 Ga0207691_10012663 3300025940 Bacteria 8078
371 Ga0207691_10059940 3300025940 Bacteria 3460
372 Ga0207691_10148542 3300025940 Bacteria 2062
373 Ga0207691_10166626 3300025940 Bacteria 1930
374 Ga0207711_10017421 3300025941 Bacteria 5969
375 Ga0207711_10087233 3300025941 Bacteria 2737
376 Ga0207711_10088805 3300025941 Bacteria 2714
377 Ga0207711_10446923 3300025941 Bacteria 1203
378 Ga0207689_10000028 3300025942 Bacteria 100652
379 Ga0207689_10005590 3300025942 Bacteria 11205
380 Ga0207689_10021316 3300025942 Bacteria 5448
381 Ga0207689_10069578 3300025942 Bacteria 2892
382 Ga0207689_10100694 3300025942 Bacteria 2373
383 Ga0207661_10146077 3300025944 Bacteria 2040
384 Ga0207661_10209201 3300025944 Bacteria 1718
385 Ga0207679_10003930 3300025945 Bacteria 9232
386 Ga0207679_10114739 3300025945 Bacteria 2133
387 Ga0207679_10430373 3300025945 Bacteria 1166
388 Ga0207667_10007162 3300025949 Bacteria 13464
389 Ga0207667_10052414 3300025949 Bacteria 4297
390 Ga0207667_10069817 3300025949 Bacteria 3657
391 Ga0207667_10155859 3300025949 Bacteria 2350
392 Ga0207651_10069466 3300025960 Bacteria 2487
393 Ga0207651_10447841 3300025960 Bacteria 1107
394 Ga0207651_10800548 3300025960 Bacteria 835
395 Ga0207712_10017823 3300025961 Bacteria 4618
396 Ga0207712_10105366 3300025961 Bacteria 2104
397 Ga0207712_10139452 3300025961 Bacteria 1859
398 Ga0207668_10034095 3300025972 Bacteria 3378
399 Ga0207640_10048338 3300025981 Bacteria 2749
400 Ga0207640_10473241 3300025981 Bacteria 1037
401 Ga0207658_10060269 3300025986 Bacteria 2831
402 Ga0207658_10109112 3300025986 Bacteria 2184
403 Ga0207658_10247193 3300025986 Bacteria 1514
404 Ga0207658_10286707 3300025986 Bacteria 1413
405 Ga0207677_10089943 3300026023 Bacteria 2230
406 Ga0207677_10114488 3300026023 Bacteria 2015
407 Ga0207677_10176760 3300026023 Bacteria 1675
408 Ga0207703_10001188 3300026035 Bacteria 24487
409 Ga0207703_10064744 3300026035 Bacteria 3001
410 Ga0207703_10088963 3300026035 Bacteria 2593
411 Ga0207703_10147891 3300026035 Bacteria 2045
412 Ga0207639_10002176 3300026041 Bacteria 13192
413 Ga0207708_10005815 3300026075 Bacteria 9124
414 Ga0207708_10006203 3300026075 Bacteria 8861
415 Ga0207708_10056929 3300026075 Bacteria 2982
416 Ga0207702_10009516 3300026078 Bacteria 8160
417 Ga0207702_10439099 3300026078 Bacteria 1265
418 Ga0207702_10676646 3300026078 Bacteria 1016
419 Ga0207641_10005314 3300026088 Bacteria 10999
420 Ga0207641_10010772 3300026088 Bacteria 7497
421 Ga0207641_10073120 3300026088 Bacteria 2954
422 Ga0207641_10552492 3300026088 Bacteria 1123
423 Ga0207641_10566156 3300026088 Bacteria 1109
424 Ga0207648_10003835 3300026089 Bacteria 15703
425 Ga0207648_10006020 3300026089 Bacteria 12099
426 Ga0207648_10006745 3300026089 Bacteria 11387
427 Ga0207648_10011832 3300026089 Bacteria 8200
428 Ga0207648_10084221 3300026089 Bacteria 2773
429 Ga0207676_10000410 3300026095 Bacteria 36252
430 Ga0207676_10002118 3300026095 Bacteria 14373
431 Ga0207676_10015805 3300026095 Bacteria 5457
432 Ga0207676_10074039 3300026095 Bacteria 2742
433 Ga0207676_10350346 3300026095 Bacteria 1365
434 Ga0207674_10002867 3300026116 Bacteria 21414
435 Ga0207674_10007003 3300026116 Bacteria 13180
436 Ga0207674_10012997 3300026116 Bacteria 9278
437 Ga0207674_10065812 3300026116 Bacteria 3653
438 Ga0207674_10103706 3300026116 Bacteria 2823
439 Ga0207674_10231108 3300026116 Bacteria 1797
440 Ga0207674_10263992 3300026116 Bacteria 1669
441 Ga0207674_10299029 3300026116 Bacteria 1558
442 Ga0207675_100000558 3300026118 Bacteria 36410
443 Ga0207675_100001808 3300026118 Bacteria 21432
444 Ga0207675_100002279 3300026118 Bacteria 19062
445 Ga0207675_100028938 3300026118 Bacteria 5162
446 Ga0207675_100059525 3300026118 Bacteria 3564
447 Ga0207683_10136812 3300026121 Bacteria 2205
448 Ga0207683_10267017 3300026121 Bacteria 1563
449 Ga0207683_10280125 3300026121 Bacteria 1524
450 Ga0207683_10337137 3300026121 Bacteria 1382
451 Ga0207698_10104346 3300026142 Bacteria 2358
452 Ga0209389_1005145 3300027296 Bacteria 11068
453 Ga0209969_1008690 3300027360 Bacteria 1443
454 Ga0209981_1002048 3300027378 Bacteria 2573
455 Ga0210000_1004960 3300027462 Bacteria 1928
456 Ga0209995_1016929 3300027471 Bacteria 1198
457 Ga0209968_1016458 3300027526 Bacteria 1175
458 Ga0209999_1001993 3300027543 Bacteria 3561
459 Ga0209999_1006910 3300027543 Bacteria 2041
460 Ga0209971_1067721 3300027682 Bacteria 866
461 Ga0209966_1034306 3300027695 Bacteria 1038
462 Ga0207428_10000343 3300027907 Bacteria 60532
463 Ga0207428_10018104 3300027907 Bacteria 6027
464 Ga0207428_10082459 3300027907 Bacteria 2509
465 Ga0207428_10096925 3300027907 Bacteria 2283
466 Ga0207428_10104280 3300027907 Bacteria 2188
467 Ga0268266_10033585 3300028379 Bacteria 4361
468 Ga0268266_10339404 3300028379 Bacteria 1410
469 Ga0268266_10346715 3300028379 Bacteria 1395
470 Ga0268265_10003506 3300028380 Bacteria 11224
471 Ga0268265_10047481 3300028380 Bacteria 3217
472 Ga0268265_10050667 3300028380 Bacteria 3130
473 Ga0268265_10194458 3300028380 Bacteria 1754
474 Ga0268265_10253779 3300028380 Bacteria 1559
475 Ga0268264_10008749 3300028381 Bacteria 8404
476 Ga0268264_10209707 3300028381 Bacteria 1788
477 Ga0268264_10542764 3300028381 Bacteria 1139
478 Ga0265322_10063485 3300028654 Bacteria 1047
479 Ga0307515_10062816 3300028794 Bacteria 5235
480 Ga0265332_10006667 3300031238 Bacteria 5228
481 Ga0265329_10026388 3300031242 Bacteria 1914
482 Ga0265339_10004832 3300031249 Bacteria 9108
483 Ga0265331_10010601 3300031250 Bacteria 5089
484 Ga0265327_10232458 3300031251 Bacteria 826
485 Ga0265316_10084490 3300031344 Bacteria 2431
486 Ga0265316_10352332 3300031344 Bacteria 1065
487 Ga0307513_10000272 3300031456 Bacteria 75284
488 Ga0307513_10020600 3300031456 Bacteria 7816
489 Ga0307408_100004559 3300031548 Bacteria 9384
490 Ga0307408_100015484 3300031548 Bacteria 5078
491 Ga0307408_100488792 3300031548 Bacteria 1075
492 Ga0265314_10000233 3300031711 Bacteria 82725
493 Ga0265342_10007759 3300031712 Bacteria 7810
494 Ga0265342_10021674 3300031712 Bacteria 4097
495 Ga0265342_10341015 3300031712 Bacteria 782
496 Ga0307405_10006436 3300031731 Bacteria 5776
497 Ga0307413_10044096 3300031824 Bacteria 2633
498 Ga0307410_10002281 3300031852 Bacteria 9194
499 Ga0307406_10002498 3300031901 Bacteria 10019
500 Ga0307406_10722278 3300031901 Bacteria 834
501 Ga0307407_10015167 3300031903 Bacteria 3798
502 Ga0307407_10021730 3300031903 Bacteria 3316
503 Ga0307412_10009824 3300031911 Bacteria 5495
504 Ga0307412_10023396 3300031911 Bacteria 3801
505 Ga0307412_10209093 3300031911 Bacteria 1487
506 Ga0307409_100001947 3300031995 Bacteria 10546
507 Ga0307409_100671906 3300031995 Bacteria 1032
508 Ga0307416_100002671 3300032002 Bacteria 10322
509 Ga0307416_100228428 3300032002 Bacteria 1792
510 Ga0307416_100642484 3300032002 Bacteria 1145
511 Ga0307416_100765771 3300032002 Bacteria 1059
512 Ga0307414_10009697 3300032004 Bacteria 5547
513 Ga0307411_10015024 3300032005 Bacteria 4330
514 Ga0307411_10375287 3300032005 Bacteria 1168
515 Ga0307415_100012347 3300032126 Bacteria 4936
516 Ga0373950_0075413 3300034818 Bacteria 697
517 Ga0373926_0181429 3300035083 Bacteria 807
518 Ga0373923_0125074 3300035111 Bacteria 1152
519 Ga0373953_0117554 3300035117 Bacteria 1128
520 Ga0373957_0048041 3300035120 Bacteria 1625
521 Ga0373955_0022181 3300035172 Bacteria 3218
522 Ga0373935_0024670 3300035692 Bacteria 3703
523 Ga0373935_0317795 3300035692 Bacteria 1104
524 Ga0373933_0057179 3300035724 Bacteria 2343
525 Ga0373933_0203860 3300035724 Bacteria 1266
526 Ga0373947_0063448 3300035725 Bacteria 2251
527 Ga0373937_0034721 3300036401 Bacteria 4586
528 Ga0373937_0072158 3300036401 Bacteria 3184
529 Ga0373937_0384236 3300036401 Bacteria 1331
530 Ga0373937_0833493 3300036401 Unclassified 870
531 Ga0395905_0027787 3300037471 Bacteria 5334
532 Ga0395905_0223216 3300037471 Bacteria 1763
533 Ga0439439_0139826 3300041406 Bacteria 683
534 Ga0439443_042045 3300042003 Bacteria 782
535 Ga0439451_059592 3300042009 Bacteria 764
536 Ga0439462_0068783 3300042015 Bacteria 961
537 Ga0450912_017222 3300042116 Bacteria 675
538 Ga0450898_041117 3300042134 Bacteria 875
539 Ga0439434_0080245 3300042435 Bacteria 1035
540 Ga0439435_0017505 3300042436 Bacteria 1813
541 Ga0439460_0205149 3300042461 Bacteria 672
542 Ga0453683_0030861 3300044673 Bacteria 3386
543 Ga0453684_0100971 3300044712 Bacteria 3530
544 Ga0453684_0144712 3300044712 Bacteria 2833
545 Ga0466959_0093658 3300045049 Bacteria 2156
546 Ga0451576_0014706 3300045051 Bacteria 8701
547 Ga0451576_0198486 3300045051 Bacteria 2095
548 Ga0495629_0062752 3300046459 Bacteria 2595
549 Ga0495629_0174399 3300046459 Bacteria 1491
550 Ga0495629_0581058 3300046459 Bacteria 750
551 Ga0495651_0478222 3300046462 Bacteria 801
552 Ga0495582_0113085 3300046473 Bacteria 1526
553 Ga0495582_0167903 3300046473 Bacteria 1249
554 Ga0495605_0111226 3300046474 Bacteria 1250
555 Ga0495594_0014352 3300046499 Bacteria 4149
556 Ga0495594_0072642 3300046499 Bacteria 1914
557 Ga0495630_0325512 3300046517 Bacteria 1175
558 Ga0495642_0047162 3300046528 Bacteria 1764
559 Ga0495586_0251783 3300046535 Bacteria 1008
560 Ga0495587_0145415 3300046536 Bacteria 1352
561 Ga0495598_0194011 3300046537 Bacteria 730
562 Ga0495621_0038774 3300046539 Bacteria 1663
563 Ga0495621_0038793 3300046539 Bacteria 1663
564 Ga0495621_0106038 3300046539 Bacteria 1074
565 Ga0495622_0211464 3300046557 Unclassified 862
566 Ga0495635_0009129 3300046663 Bacteria 6924
567 Ga0495659_0040391 3300046664 Bacteria 1663
568 Ga0495588_0131666 3300046674 Bacteria 1319
569 Ga0495657_0167719 3300046675 Bacteria 1354
570 Ga0495623_0273729 3300046679 Bacteria 942
571 Ga0495658_0185258 3300046683 Bacteria 1292
572 Ga0495669_0156382 3300046684 Bacteria 1081
573 Ga0495581_0159998 3300047315 Bacteria 1316
574 Ga0495604_0683113 3300047317 Bacteria 653
575 Ga0495676_0149715 3300047321 Bacteria 1663
576 Ga0495680_0069672 3300047322 Bacteria 2683
577 Ga0495687_021731 3300047443 Bacteria 3096
578 Ga0495614_0290462 3300048089 Bacteria 754
579 Ga0496100_0074884 3300048903 Bacteria 2269
580 Ga0496100_0225866 3300048903 Bacteria 1376
581 Ga0496101_0086380 3300048904 Bacteria 2326
582 Ga0496102_0031108 3300048905 Bacteria 4784
583 Ga0496102_0045218 3300048905 Bacteria 3997
584 Ga0496103_0024349 3300048906 Bacteria 3654
585 Ga0496103_0107826 3300048906 Bacteria 1767
586 Ga0496104_0146978 3300048907 Bacteria 2263
587 Ga0496105_0130369 3300048908 Bacteria 2073
588 Ga0496106_0094045 3300048909 Bacteria 2317
589 Ga0496106_0172813 3300048909 Bacteria 1713
590 Ga0496107_0046100 3300048910 Bacteria 3137
591 Ga0496108_0316443 3300048911 Bacteria 1360
592 Ga0496108_0615792 3300048911 Bacteria 945
593 Ga0496109_0050719 3300048912 Bacteria 3778
594 Ga0496109_0113792 3300048912 Bacteria 2517
595 Ga0496109_0134627 3300048912 Bacteria 2308
596 Ga0496109_1074836 3300048912 Bacteria 742
597 Ga0496110_0110273 3300048913 Bacteria 2472
598 Ga0496110_0688221 3300048913 Bacteria 923
599 Ga0496111_0049665 3300048914 Bacteria 3025
600 Ga0496114_0162445 3300048917 Bacteria 1943
601 Ga0496114_0551687 3300048917 Bacteria 1018
602 Ga0496116_0001150 3300048919 Bacteria 31317
603 Ga0496124_0126504 3300048927 Bacteria 2035
604 Ga0501290_002541 3300049513 Bacteria 2347
605 Ga0501291_000689 3300049514 Bacteria 3871
606 Ga0501292_000230 3300049515 Bacteria 8440
607 Ga0501293_000492 3300049516 Bacteria 2978
608 Ga0501296_000849 3300049519 Bacteria 3002
609 Ga0501297_000022 3300049520 Bacteria 15117
610 Ga0501300_000082 3300049523 Bacteria 13526
611 Ga0501303_001246 3300049526 Bacteria 1901
612 Ga0501034_0188557 3300049571 Bacteria 2025
613 Ga0501036_0325235 3300049572 Bacteria 1285
614 Ga0501036_0461696 3300049572 Bacteria 1058
615 Ga0501038_0121452 3300049574 Bacteria 2154
616 Ga0501038_0157775 3300049574 Bacteria 1846
617 Ga0501039_0096337 3300049575 Bacteria 2307
618 Ga0501046_0184648 3300049580 Bacteria 1558
619 Ga0501069_0082208 3300049585 Unclassified 1815
620 Ga0501071_0276118 3300049587 Bacteria 1271
621 Ga0501072_0464462 3300049588 Bacteria 1002
622 Ga0501076_0163176 3300049592 Bacteria 1816
623 Ga0501199_002758 3300049650 Bacteria 1658
624 Ga0501202_036676 3300049652 Bacteria 1044
625 Ga0501209_014175 3300049656 Bacteria 1744
626 Ga0501211_012531 3300049658 Bacteria 838
627 Ga0501216_031344 3300049660 Bacteria 983
628 Ga0501224_015280 3300049664 Bacteria 1138
629 Ga0501235_000547 3300049669 Bacteria 7512
630 Ga0501243_000200 3300049675 Bacteria 7249
631 Ga0501246_000210 3300049676 Bacteria 3852
632 Ga0501248_002711 3300049678 Bacteria 1226
633 Ga0501257_004363 3300049686 Bacteria 3086
634 Ga0501260_002083 3300049689 Bacteria 1705
635 Ga0501221_001736 3300049704 Bacteria 3629
636 Ga0501225_0014264 3300049705 Bacteria 2220
637 Ga0501229_010104 3300049706 Bacteria 1190
638 Ga0501245_002018 3300049708 Bacteria 2686
639 Ga0501080_0994758 3300049742 Bacteria 728
640 Ga0501264_002343 3300049761 Bacteria 1780
641 Ga0501265_011475 3300049762 Bacteria 1093
642 Ga0501266_003040 3300049763 Bacteria 2087
643 Ga0501270_000021 3300049767 Bacteria 12468
644 Ga0501273_001850 3300049770 Bacteria 2082
645 Ga0501275_001295 3300049772 Bacteria 2501
646 Ga0501276_002228 3300049773 Bacteria 1362
647 Ga0501278_000078 3300049774 Bacteria 6670
648 Ga0501279_000695 3300049775 Bacteria 4398
649 Ga0501281_00720 3300049777 Bacteria 2864
650 Ga0501283_000146 3300049779 Bacteria 9058
651 Ga0501045_0117439 3300049824 Bacteria 1975
652 Ga0501212_003881 3300049851 Bacteria 1900
653 nmdc:mga03683_82729_c1 3300050489 Bacteria 1389
654 nmdc:mga00v17_6528_c1 3300050491 Bacteria 6192
655 nmdc:mga0k408_1050_c1 3300050493 Bacteria 15173
656 nmdc:mga0k408_479424_c1 3300050493 Bacteria 738
657 nmdc:mga06z11_2252_c1 3300050494 Bacteria 7334
658 nmdc:mga05p37_212485_c1 3300050507 Unclassified 2338
659 nmdc:mga05p37_636_c1 3300050507 Bacteria 38842
660 nmdc:mga09592_1481_c1 3300050508 Bacteria 18867
661 nmdc:mga09592_21700_c1 3300050508 Bacteria 5294
662 nmdc:mga09592_337367_c1 3300050508 Bacteria 1305
663 nmdc:mga09592_439450_c1 3300050508 Bacteria 1126
664 nmdc:mga09592_779128_c1 3300050508 Bacteria 810
665 nmdc:mga09592_81053_c1 3300050508 Bacteria 2765
666 nmdc:mga0qj67_11261_c1 3300050509 Bacteria 6700
667 nmdc:mga0qj67_16443_c1 3300050509 Bacteria 5611
668 nmdc:mga0qj67_85207_c1 3300050509 Bacteria 2534
669 nmdc:mga06r32_113540_c1 3300050510 Bacteria 2667
670 nmdc:mga06r32_119136_c1 3300050510 Bacteria 2603
671 nmdc:mga08y16_3237_c1 3300050511 Bacteria 16865
672 nmdc:mga08y16_41146_c1 3300050511 Bacteria 4841
673 nmdc:mga08y16_4821_c1 3300050511 Bacteria 14074
674 nmdc:mga08y16_56895_c1 3300050511 Bacteria 4087
675 nmdc:mga0n895_624395_c1 3300050512 Bacteria 1078
676 nmdc:mga0n895_722787_c1 3300050512 Bacteria 990
677 nmdc:mga0a205_117512_c1 3300050515 Bacteria 2557
678 nmdc:mga0a205_236608_c1 3300050515 Bacteria 1708
679 Ga0495601_0237776 3300053077 Bacteria 1189
680 Ga0495595_0083016 3300053084 Bacteria 1529
681 Ga0495619_0394905 3300053085 Bacteria 955
682 Ga0530510_0143240 3300061734 Bacteria 1762

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0027787 Ga0395905_0027787_3656_4309 167
2 3300050508 nmdc:mga09592_439450_c1 nmdc:mga09592_439450_c1_167_790 174
3 3300027360 Ga0209969_1008690 Ga0209969_10086902 179
4 3300042134 Ga0450898_041117 Ga0450898_041117_185_796 179
5 3300049571 Ga0501034_0188557 Ga0501034_0188557_1218_1853 181
6 3300005617 Ga0068859_100084020 Ga0068859_1000840202 185
7 3300006931 Ga0097620_100084021 Ga0097620_1000840214 185
8 3300013296 Ga0157374_10094506 Ga0157374_100945062 185
9 3300026023 Ga0207677_10114488 Ga0207677_101144882 185
10 3300026088 Ga0207641_10073120 Ga0207641_100731202 185
11 3300026095 Ga0207676_10350346 Ga0207676_103503462 185
12 3300050493 nmdc:mga0k408_479424_c1 nmdc:mga0k408_479424_c1_15_572 185
13 3300042015 Ga0439462_0068783 Ga0439462_0068783_390_950 186
14 3300046535 Ga0495586_0251783 Ga0495586_0251783_12_575 187
15 3300028794 Ga0307515_10062816 Ga0307515_100628164 188
16 3300031251 Ga0265327_10232458 Ga0265327_102324582 188
17 3300031456 Ga0307513_10020600 Ga0307513_100206004 188
18 3300005467 Ga0070706_100000846 Ga0070706_1000008468 191
19 3300005536 Ga0070697_100019292 Ga0070697_1000192927 191
20 3300025910 Ga0207684_10000363 Ga0207684_1000036331 191
21 3300027526 Ga0209968_1016458 Ga0209968_10164581 191
22 3300006846 Ga0075430_100097634 Ga0075430_1000976342 192
23 3300006847 Ga0075431_100003309 Ga0075431_10000330914 192
24 3300006880 Ga0075429_100007739 Ga0075429_10000773911 192
25 3300009147 Ga0114129_10019694 Ga0114129_100196944 192
26 3300013306 Ga0163162_10017941 Ga0163162_100179413 192
27 3300031238 Ga0265332_10006667 Ga0265332_100066676 192
28 3300031242 Ga0265329_10026388 Ga0265329_100263882 192
29 3300031249 Ga0265339_10004832 Ga0265339_1000483210 192
30 3300031250 Ga0265331_10010601 Ga0265331_100106013 192
31 3300031711 Ga0265314_10000233 Ga0265314_100002335 192
32 3300031712 Ga0265342_10021674 Ga0265342_100216744 192
33 3300049574 Ga0501038_0121452 Ga0501038_0121452_1503_2102 192
34 3300050508 nmdc:mga09592_81053_c1 nmdc:mga09592_81053_c1_36_614 192
35 3300050509 nmdc:mga0qj67_16443_c1 nmdc:mga0qj67_16443_c1_1487_2065 192
36 3300050510 nmdc:mga06r32_113540_c1 nmdc:mga06r32_113540_c1_1731_2309 192
37 3300014325 Ga0163163_10906038 Ga0163163_109060382 193
38 3300031911 Ga0307412_10023396 Ga0307412_100233962 193
39 3300003323 rootH1_10009155 rootH1_100091558 197
40 3300003771 Ga0055526_1004475 Ga0055526_10044757 197
41 3300003792 Ga0055540_1013809 Ga0055540_10138092 197
42 3300005328 Ga0070676_10003923 Ga0070676_100039233 197
43 3300005329 Ga0070683_100050405 Ga0070683_1000504052 197
44 3300005331 Ga0070670_100029853 Ga0070670_1000298533 197
45 3300005334 Ga0068869_100011586 Ga0068869_1000115863 197
46 3300005334 Ga0068869_100200787 Ga0068869_1002007872 197
47 3300005336 Ga0070680_100142754 Ga0070680_1001427542 197
48 3300005336 Ga0070680_100155563 Ga0070680_1001555632 197
49 3300005338 Ga0068868_100211162 Ga0068868_1002111621 197
50 3300005339 Ga0070660_100042423 Ga0070660_1000424232 197
51 3300005344 Ga0070661_100087149 Ga0070661_1000871492 197
52 3300005354 Ga0070675_100014015 Ga0070675_1000140153 197
53 3300005354 Ga0070675_100763391 Ga0070675_1007633911 197
54 3300005355 Ga0070671_100055638 Ga0070671_1000556384 197
55 3300005364 Ga0070673_100004218 Ga0070673_1000042184 197
56 3300005365 Ga0070688_100053437 Ga0070688_1000534372 197
57 3300005366 Ga0070659_100012718 Ga0070659_1000127186 197
58 3300005367 Ga0070667_100140314 Ga0070667_1001403142 197
59 3300005441 Ga0070700_100028528 Ga0070700_1000285283 197
60 3300005456 Ga0070678_100264441 Ga0070678_1002644412 197
61 3300005458 Ga0070681_10027047 Ga0070681_100270474 197
62 3300005459 Ga0068867_100010602 Ga0068867_1000106022 197
63 3300005459 Ga0068867_100185706 Ga0068867_1001857062 197
64 3300005467 Ga0070706_101053980 Ga0070706_1010539801 197
65 3300005468 Ga0070707_100041532 Ga0070707_1000415322 197
66 3300005471 Ga0070698_100091390 Ga0070698_1000913902 197
67 3300005471 Ga0070698_100626244 Ga0070698_1006262442 197
68 3300005530 Ga0070679_100109674 Ga0070679_1001096744 197
69 3300005545 Ga0070695_100027112 Ga0070695_1000271122 197
70 3300005563 Ga0068855_100011783 Ga0068855_10001178311 197
71 3300005577 Ga0068857_100003353 Ga0068857_1000033534 197
72 3300005577 Ga0068857_100321976 Ga0068857_1003219762 197
73 3300005578 Ga0068854_100313817 Ga0068854_1003138172 197
74 3300005614 Ga0068856_100340697 Ga0068856_1003406972 197
75 3300005834 Ga0068851_10041909 Ga0068851_100419092 197
76 3300006195 Ga0075366_10111173 Ga0075366_101111732 197
77 3300006942 Ga0099824_1039530 Ga0099824_10395302 197
78 3300006944 Ga0099823_1000003 Ga0099823_1000003153 197
79 3300009174 Ga0105241_10014623 Ga0105241_100146234 197
80 3300009551 Ga0105238_10011338 Ga0105238_100113383 197
81 3300009553 Ga0105249_11306513 Ga0105249_113065131 197
82 3300025273 Ga0209673_1013689 Ga0209673_10136892 197
83 3300025295 Ga0209564_1000392 Ga0209564_100039221 197
84 3300025298 Ga0209050_1001991 Ga0209050_10019915 197
85 3300025299 Ga0209256_1000634 Ga0209256_100063423 197
86 3300025303 Ga0209051_1001010 Ga0209051_10010105 197
87 3300025304 Ga0209257_1001115 Ga0209257_10011158 197
88 3300025321 Ga0207656_10043387 Ga0207656_100433872 197
89 3300025910 Ga0207684_10409763 Ga0207684_104097632 197
90 3300025911 Ga0207654_10006976 Ga0207654_100069764 197
91 3300025912 Ga0207707_10082358 Ga0207707_100823582 197
92 3300025913 Ga0207695_10144075 Ga0207695_101440752 197
93 3300025914 Ga0207671_10014674 Ga0207671_100146745 197
94 3300025917 Ga0207660_10261214 Ga0207660_102612142 197
95 3300025919 Ga0207657_10216810 Ga0207657_102168102 197
96 3300025920 Ga0207649_10082814 Ga0207649_100828142 197
97 3300025922 Ga0207646_10037324 Ga0207646_100373242 197
98 3300025924 Ga0207694_10008187 Ga0207694_100081873 197
99 3300025926 Ga0207659_10158284 Ga0207659_101582842 197
100 3300025927 Ga0207687_10011546 Ga0207687_100115468 197
101 3300025932 Ga0207690_10038419 Ga0207690_100384193 197
102 3300025944 Ga0207661_10146077 Ga0207661_101460772 197
103 3300025945 Ga0207679_10003930 Ga0207679_1000393010 197
104 3300025949 Ga0207667_10007162 Ga0207667_1000716212 197
105 3300026078 Ga0207702_10009516 Ga0207702_100095167 197
106 3300026116 Ga0207674_10007003 Ga0207674_100070034 197
107 3300026116 Ga0207674_10231108 Ga0207674_102311082 197
108 3300026121 Ga0207683_10280125 Ga0207683_102801253 197
109 3300027296 Ga0209389_1005145 Ga0209389_10051456 197
110 3300028654 Ga0265322_10063485 Ga0265322_100634852 197
111 3300031344 Ga0265316_10084490 Ga0265316_100844902 197
112 3300031344 Ga0265316_10352332 Ga0265316_103523321 197
113 3300031548 Ga0307408_100488792 Ga0307408_1004887922 197
114 3300031712 Ga0265342_10007759 Ga0265342_100077596 197
115 3300031712 Ga0265342_10341015 Ga0265342_103410152 197
116 3300031901 Ga0307406_10722278 Ga0307406_107222781 197
117 3300032002 Ga0307416_100228428 Ga0307416_1002284282 197
118 3300032002 Ga0307416_100642484 Ga0307416_1006424842 197
119 3300032002 Ga0307416_100765771 Ga0307416_1007657711 197
120 3300032005 Ga0307411_10375287 Ga0307411_103752872 197
121 3300037471 Ga0395905_0223216 Ga0395905_0223216_739_1350 197
122 3300042116 Ga0450912_017222 Ga0450912_017222_65_664 197
123 3300044673 Ga0453683_0030861 Ga0453683_0030861_537_1148 197
124 3300044712 Ga0453684_0100971 Ga0453684_0100971_1497_2108 197
125 3300044712 Ga0453684_0144712 Ga0453684_0144712_840_1463 197
126 3300045051 Ga0451576_0014706 Ga0451576_0014706_1563_2186 197
127 3300045051 Ga0451576_0198486 Ga0451576_0198486_555_1166 197
128 3300049824 Ga0501045_0117439 Ga0501045_0117439_250_843 197
129 3300001976 JGI24752J21851_1003387 JGI24752J21851_10033872 198
130 3300002239 JGI24034J26672_10023104 JGI24034J26672_100231042 198
131 3300004800 Ga0058861_10054973 Ga0058861_100549731 198
132 3300005290 Ga0065712_10075717 Ga0065712_100757173 198
133 3300005293 Ga0065715_10488263 Ga0065715_104882631 198
134 3300005295 Ga0065707_10090900 Ga0065707_100909004 198
135 3300005328 Ga0070676_10039107 Ga0070676_100391074 198
136 3300005328 Ga0070676_10076191 Ga0070676_100761913 198
137 3300005330 Ga0070690_100054133 Ga0070690_1000541332 198
138 3300005330 Ga0070690_100086712 Ga0070690_1000867122 198
139 3300005331 Ga0070670_100000604 Ga0070670_1000006044 198
140 3300005331 Ga0070670_100294175 Ga0070670_1002941752 198
141 3300005331 Ga0070670_100377568 Ga0070670_1003775682 198
142 3300005331 Ga0070670_100768633 Ga0070670_1007686331 198
143 3300005333 Ga0070677_10216060 Ga0070677_102160601 198
144 3300005334 Ga0068869_100001219 Ga0068869_1000012196 198
145 3300005334 Ga0068869_100055916 Ga0068869_1000559163 198
146 3300005334 Ga0068869_100100543 Ga0068869_1001005433 198
147 3300005335 Ga0070666_10094671 Ga0070666_100946713 198
148 3300005335 Ga0070666_10256842 Ga0070666_102568421 198
149 3300005336 Ga0070680_100078774 Ga0070680_1000787742 198
150 3300005336 Ga0070680_100102715 Ga0070680_1001027153 198
151 3300005337 Ga0070682_100439851 Ga0070682_1004398511 198
152 3300005338 Ga0068868_100058625 Ga0068868_1000586253 198
153 3300005340 Ga0070689_100000594 Ga0070689_1000005946 198
154 3300005340 Ga0070689_100291286 Ga0070689_1002912862 198
155 3300005340 Ga0070689_100395205 Ga0070689_1003952051 198
156 3300005341 Ga0070691_10155946 Ga0070691_101559462 198
157 3300005341 Ga0070691_10164594 Ga0070691_101645942 198
158 3300005343 Ga0070687_100062226 Ga0070687_1000622262 198
159 3300005343 Ga0070687_100079654 Ga0070687_1000796543 198
160 3300005343 Ga0070687_100109105 Ga0070687_1001091052 198
161 3300005343 Ga0070687_100298592 Ga0070687_1002985921 198
162 3300005347 Ga0070668_100005159 Ga0070668_1000051593 198
163 3300005347 Ga0070668_100012530 Ga0070668_1000125303 198
164 3300005347 Ga0070668_100139844 Ga0070668_1001398442 198
165 3300005353 Ga0070669_100004561 Ga0070669_1000045619 198
166 3300005353 Ga0070669_100006331 Ga0070669_1000063319 198
167 3300005353 Ga0070669_100134960 Ga0070669_1001349604 198
168 3300005353 Ga0070669_100282904 Ga0070669_1002829042 198
169 3300005353 Ga0070669_100481719 Ga0070669_1004817191 198
170 3300005354 Ga0070675_100006929 Ga0070675_1000069299 198
171 3300005354 Ga0070675_100018866 Ga0070675_1000188664 198
172 3300005354 Ga0070675_100083893 Ga0070675_1000838933 198
173 3300005354 Ga0070675_100104335 Ga0070675_1001043352 198
174 3300005355 Ga0070671_100016195 Ga0070671_1000161952 198
175 3300005355 Ga0070671_100064503 Ga0070671_1000645033 198
176 3300005355 Ga0070671_100646259 Ga0070671_1006462592 198
177 3300005356 Ga0070674_100083440 Ga0070674_1000834402 198
178 3300005356 Ga0070674_100399624 Ga0070674_1003996241 198
179 3300005356 Ga0070674_100729456 Ga0070674_1007294562 198
180 3300005364 Ga0070673_100006929 Ga0070673_10000692910 198
181 3300005364 Ga0070673_100043974 Ga0070673_1000439743 198
182 3300005364 Ga0070673_100130428 Ga0070673_1001304283 198
183 3300005364 Ga0070673_100303350 Ga0070673_1003033502 198
184 3300005365 Ga0070688_100145258 Ga0070688_1001452582 198
185 3300005365 Ga0070688_100480134 Ga0070688_1004801342 198
186 3300005366 Ga0070659_100214244 Ga0070659_1002142442 198
187 3300005366 Ga0070659_100288786 Ga0070659_1002887862 198
188 3300005367 Ga0070667_100011931 Ga0070667_1000119318 198
189 3300005367 Ga0070667_100255851 Ga0070667_1002558512 198
190 3300005367 Ga0070667_100307065 Ga0070667_1003070652 198
191 3300005367 Ga0070667_100549376 Ga0070667_1005493762 198
192 3300005438 Ga0070701_10042281 Ga0070701_100422811 198
193 3300005438 Ga0070701_10232516 Ga0070701_102325162 198
194 3300005441 Ga0070700_100000367 Ga0070700_10000036723 198
195 3300005441 Ga0070700_100005117 Ga0070700_1000051172 198
196 3300005441 Ga0070700_100057948 Ga0070700_1000579483 198
197 3300005441 Ga0070700_100101352 Ga0070700_1001013523 198
198 3300005441 Ga0070700_100105938 Ga0070700_1001059382 198
199 3300005444 Ga0070694_100207655 Ga0070694_1002076552 198
200 3300005445 Ga0070708_100299229 Ga0070708_1002992292 198
201 3300005457 Ga0070662_100101534 Ga0070662_1001015342 198
202 3300005457 Ga0070662_100113468 Ga0070662_1001134681 198
203 3300005458 Ga0070681_10036389 Ga0070681_100363892 198
204 3300005459 Ga0068867_100001130 Ga0068867_1000011302 198
205 3300005459 Ga0068867_100009485 Ga0068867_1000094853 198
206 3300005459 Ga0068867_100011974 Ga0068867_1000119742 198
207 3300005459 Ga0068867_100173276 Ga0068867_1001732763 198
208 3300005466 Ga0070685_10041656 Ga0070685_100416563 198
209 3300005466 Ga0070685_10573195 Ga0070685_105731951 198
210 3300005467 Ga0070706_100043457 Ga0070706_1000434572 198
211 3300005468 Ga0070707_100000587 Ga0070707_10000058729 198
212 3300005468 Ga0070707_100086817 Ga0070707_1000868173 198
213 3300005471 Ga0070698_100009454 Ga0070698_10000945411 198
214 3300005518 Ga0070699_100080389 Ga0070699_1000803892 198
215 3300005518 Ga0070699_100235144 Ga0070699_1002351442 198
216 3300005535 Ga0070684_100079120 Ga0070684_1000791202 198
217 3300005536 Ga0070697_100230533 Ga0070697_1002305331 198
218 3300005539 Ga0068853_100001930 Ga0068853_1000019307 198
219 3300005543 Ga0070672_100027941 Ga0070672_1000279414 198
220 3300005543 Ga0070672_100032608 Ga0070672_1000326083 198
221 3300005543 Ga0070672_100114420 Ga0070672_1001144202 198
222 3300005543 Ga0070672_100170355 Ga0070672_1001703552 198
223 3300005544 Ga0070686_100010270 Ga0070686_1000102705 198
224 3300005544 Ga0070686_100087760 Ga0070686_1000877602 198
225 3300005544 Ga0070686_100130573 Ga0070686_1001305733 198
226 3300005546 Ga0070696_100609556 Ga0070696_1006095561 198
227 3300005548 Ga0070665_100441509 Ga0070665_1004415093 198
228 3300005548 Ga0070665_100449257 Ga0070665_1004492572 198
229 3300005548 Ga0070665_100801535 Ga0070665_1008015352 198
230 3300005549 Ga0070704_100095414 Ga0070704_1000954142 198
231 3300005549 Ga0070704_100413031 Ga0070704_1004130311 198
232 3300005549 Ga0070704_100486434 Ga0070704_1004864342 198
233 3300005563 Ga0068855_100102398 Ga0068855_1001023982 198
234 3300005563 Ga0068855_100107689 Ga0068855_1001076893 198
235 3300005563 Ga0068855_100118103 Ga0068855_1001181033 198
236 3300005577 Ga0068857_100008057 Ga0068857_1000080574 198
237 3300005577 Ga0068857_100303716 Ga0068857_1003037162 198
238 3300005577 Ga0068857_100522407 Ga0068857_1005224071 198
239 3300005578 Ga0068854_100255150 Ga0068854_1002551502 198
240 3300005614 Ga0068856_100037185 Ga0068856_1000371852 198
241 3300005614 Ga0068856_100125323 Ga0068856_1001253234 198
242 3300005615 Ga0070702_100069776 Ga0070702_1000697762 198
243 3300005615 Ga0070702_100096073 Ga0070702_1000960732 198
244 3300005616 Ga0068852_100059661 Ga0068852_1000596612 198
245 3300005617 Ga0068859_100002178 Ga0068859_1000021786 198
246 3300005617 Ga0068859_100014884 Ga0068859_1000148843 198
247 3300005617 Ga0068859_100031453 Ga0068859_1000314534 198
248 3300005617 Ga0068859_100053334 Ga0068859_1000533343 198
249 3300005617 Ga0068859_100186622 Ga0068859_1001866223 198
250 3300005618 Ga0068864_100003861 Ga0068864_1000038619 198
251 3300005618 Ga0068864_100027295 Ga0068864_1000272956 198
252 3300005618 Ga0068864_100131896 Ga0068864_1001318966 198
253 3300005618 Ga0068864_100153290 Ga0068864_1001532902 198
254 3300005718 Ga0068866_10024646 Ga0068866_100246463 198
255 3300005718 Ga0068866_10143228 Ga0068866_101432282 198
256 3300005719 Ga0068861_100000843 Ga0068861_1000008433 198
257 3300005719 Ga0068861_100000932 Ga0068861_1000009322 198
258 3300005719 Ga0068861_100049010 Ga0068861_1000490103 198
259 3300005719 Ga0068861_100166995 Ga0068861_1001669952 198
260 3300005719 Ga0068861_100241805 Ga0068861_1002418052 198
261 3300005840 Ga0068870_10251292 Ga0068870_102512921 198
262 3300005841 Ga0068863_100024480 Ga0068863_1000244804 198
263 3300005841 Ga0068863_100061807 Ga0068863_1000618076 198
264 3300005841 Ga0068863_100150511 Ga0068863_1001505113 198
265 3300005841 Ga0068863_100208293 Ga0068863_1002082932 198
266 3300005842 Ga0068858_100080516 Ga0068858_1000805162 198
267 3300005842 Ga0068858_100332947 Ga0068858_1003329472 198
268 3300005843 Ga0068860_100001499 Ga0068860_1000014995 198
269 3300005843 Ga0068860_100008189 Ga0068860_1000081897 198
270 3300005843 Ga0068860_100236638 Ga0068860_1002366382 198
271 3300005843 Ga0068860_100361199 Ga0068860_1003611992 198
272 3300005844 Ga0068862_100001468 Ga0068862_10000146820 198
273 3300005844 Ga0068862_100004126 Ga0068862_1000041267 198
274 3300005844 Ga0068862_100077379 Ga0068862_1000773793 198
275 3300005844 Ga0068862_100118728 Ga0068862_1001187284 198
276 3300005844 Ga0068862_100442481 Ga0068862_1004424812 198
277 3300005844 Ga0068862_100986743 Ga0068862_1009867431 198
278 3300006038 Ga0075365_10008050 Ga0075365_100080506 198
279 3300006051 Ga0075364_10249097 Ga0075364_102490972 198
280 3300006177 Ga0075362_10035713 Ga0075362_100357132 198
281 3300006178 Ga0075367_10000137 Ga0075367_100001379 198
282 3300006195 Ga0075366_10001318 Ga0075366_1000131810 198
283 3300006237 Ga0097621_100018307 Ga0097621_1000183077 198
284 3300006237 Ga0097621_100079838 Ga0097621_1000798382 198
285 3300006237 Ga0097621_100387649 Ga0097621_1003876491 198
286 3300006358 Ga0068871_100080583 Ga0068871_1000805832 198
287 3300006358 Ga0068871_100168094 Ga0068871_1001680942 198
288 3300006358 Ga0068871_100318131 Ga0068871_1003181311 198
289 3300006844 Ga0075428_100000868 Ga0075428_10000086839 198
290 3300006844 Ga0075428_100090575 Ga0075428_1000905753 198
291 3300006844 Ga0075428_100671555 Ga0075428_1006715552 198
292 3300006846 Ga0075430_100005921 Ga0075430_10000592113 198
293 3300006846 Ga0075430_100058216 Ga0075430_1000582164 198
294 3300006846 Ga0075430_100095439 Ga0075430_1000954392 198
295 3300006846 Ga0075430_100213151 Ga0075430_1002131513 198
296 3300006847 Ga0075431_100013642 Ga0075431_1000136424 198
297 3300006847 Ga0075431_100056558 Ga0075431_1000565585 198
298 3300006852 Ga0075433_10142226 Ga0075433_101422263 198
299 3300006852 Ga0075433_10380513 Ga0075433_103805131 198
300 3300006880 Ga0075429_100000796 Ga0075429_10000079614 198
301 3300006880 Ga0075429_100017068 Ga0075429_1000170686 198
302 3300006880 Ga0075429_100797207 Ga0075429_1007972071 198
303 3300006881 Ga0068865_100006209 Ga0068865_1000062094 198
304 3300006931 Ga0097620_100002178 Ga0097620_1000021786 198
305 3300006931 Ga0097620_100014883 Ga0097620_1000148833 198
306 3300006931 Ga0097620_100031453 Ga0097620_1000314534 198
307 3300006931 Ga0097620_100053330 Ga0097620_1000533305 198
308 3300006931 Ga0097620_100186618 Ga0097620_1001866183 198
309 3300007076 Ga0075435_100407323 Ga0075435_1004073232 198
310 3300009094 Ga0111539_10002695 Ga0111539_100026956 198
311 3300009094 Ga0111539_10026457 Ga0111539_100264575 198
312 3300009094 Ga0111539_10098895 Ga0111539_100988953 198
313 3300009094 Ga0111539_10227395 Ga0111539_102273952 198
314 3300009094 Ga0111539_10962797 Ga0111539_109627972 198
315 3300009101 Ga0105247_10410708 Ga0105247_104107081 198
316 3300009147 Ga0114129_10001859 Ga0114129_1000185935 198
317 3300009147 Ga0114129_10130914 Ga0114129_101309144 198
318 3300009147 Ga0114129_10706265 Ga0114129_107062651 198
319 3300009147 Ga0114129_10727170 Ga0114129_107271702 198
320 3300009148 Ga0105243_10001846 Ga0105243_1000184614 198
321 3300009148 Ga0105243_10426877 Ga0105243_104268772 198
322 3300009148 Ga0105243_10535292 Ga0105243_105352922 198
323 3300009174 Ga0105241_10108152 Ga0105241_101081522 198
324 3300009176 Ga0105242_11450534 Ga0105242_114505341 198
325 3300009177 Ga0105248_10011621 Ga0105248_100116214 198
326 3300009177 Ga0105248_10028123 Ga0105248_100281236 198
327 3300009177 Ga0105248_10425367 Ga0105248_104253672 198
328 3300009177 Ga0105248_10745690 Ga0105248_107456902 198
329 3300009545 Ga0105237_10101719 Ga0105237_101017193 198
330 3300009551 Ga0105238_10017026 Ga0105238_100170265 198
331 3300009553 Ga0105249_10003380 Ga0105249_1000338016 198
332 3300009553 Ga0105249_10143486 Ga0105249_101434863 198
333 3300009553 Ga0105249_10333614 Ga0105249_103336142 198
334 3300009553 Ga0105249_10694578 Ga0105249_106945782 198
335 3300009553 Ga0105249_11409970 Ga0105249_114099701 198
336 3300010375 Ga0105239_10100344 Ga0105239_101003442 198
337 3300011119 Ga0105246_10098816 Ga0105246_100988162 198
338 3300011119 Ga0105246_10305201 Ga0105246_103052012 198
339 3300011119 Ga0105246_10497435 Ga0105246_104974351 198
340 3300013102 Ga0157371_10196339 Ga0157371_101963392 198
341 3300013105 Ga0157369_10047746 Ga0157369_100477463 198
342 3300013296 Ga0157374_10167470 Ga0157374_101674701 198
343 3300013306 Ga0163162_10107241 Ga0163162_101072416 198
344 3300013306 Ga0163162_10462907 Ga0163162_104629072 198
345 3300013306 Ga0163162_10749802 Ga0163162_107498022 198
346 3300013306 Ga0163162_11575553 Ga0163162_115755531 198
347 3300013307 Ga0157372_10920345 Ga0157372_109203451 198
348 3300013308 Ga0157375_10063699 Ga0157375_100636993 198
349 3300013308 Ga0157375_10190221 Ga0157375_101902212 198
350 3300014325 Ga0163163_10061531 Ga0163163_100615312 198
351 3300014326 Ga0157380_10018127 Ga0157380_100181273 198
352 3300014745 Ga0157377_10190663 Ga0157377_101906631 198
353 3300014745 Ga0157377_10219461 Ga0157377_102194612 198
354 3300014968 Ga0157379_10254425 Ga0157379_102544252 198
355 3300014969 Ga0157376_10073704 Ga0157376_100737045 198
356 3300017792 Ga0163161_10135119 Ga0163161_101351193 198
357 3300017792 Ga0163161_10299774 Ga0163161_102997742 198
358 3300020070 Ga0206356_10399998 Ga0206356_103999981 198
359 3300025290 Ga0207673_1002917 Ga0207673_10029172 198
360 3300025315 Ga0207697_10011272 Ga0207697_100112722 198
361 3300025315 Ga0207697_10023714 Ga0207697_100237143 198
362 3300025321 Ga0207656_10065491 Ga0207656_100654912 198
363 3300025893 Ga0207682_10001713 Ga0207682_100017137 198
364 3300025893 Ga0207682_10007887 Ga0207682_100078872 198
365 3300025893 Ga0207682_10020443 Ga0207682_100204433 198
366 3300025893 Ga0207682_10191253 Ga0207682_101912532 198
367 3300025899 Ga0207642_10090307 Ga0207642_100903072 198
368 3300025901 Ga0207688_10041449 Ga0207688_100414492 198
369 3300025901 Ga0207688_10054690 Ga0207688_100546903 198
370 3300025901 Ga0207688_10225475 Ga0207688_102254752 198
371 3300025903 Ga0207680_10079468 Ga0207680_100794682 198
372 3300025907 Ga0207645_10004033 Ga0207645_1000403312 198
373 3300025907 Ga0207645_10042424 Ga0207645_100424242 198
374 3300025907 Ga0207645_10054179 Ga0207645_100541792 198
375 3300025908 Ga0207643_10000819 Ga0207643_100008199 198
376 3300025908 Ga0207643_10002644 Ga0207643_100026446 198
377 3300025908 Ga0207643_10075000 Ga0207643_100750002 198
378 3300025908 Ga0207643_10091593 Ga0207643_100915933 198
379 3300025912 Ga0207707_10028670 Ga0207707_100286701 198
380 3300025914 Ga0207671_10100964 Ga0207671_101009643 198
381 3300025916 Ga0207663_10510540 Ga0207663_105105401 198
382 3300025918 Ga0207662_10000306 Ga0207662_1000030610 198
383 3300025918 Ga0207662_10009126 Ga0207662_100091262 198
384 3300025918 Ga0207662_10010292 Ga0207662_100102922 198
385 3300025918 Ga0207662_10184080 Ga0207662_101840802 198
386 3300025918 Ga0207662_10226800 Ga0207662_102268002 198
387 3300025919 Ga0207657_10037765 Ga0207657_100377653 198
388 3300025920 Ga0207649_10056444 Ga0207649_100564442 198
389 3300025920 Ga0207649_10414870 Ga0207649_104148702 198
390 3300025921 Ga0207652_10214540 Ga0207652_102145401 198
391 3300025922 Ga0207646_10000295 Ga0207646_1000029542 198
392 3300025923 Ga0207681_10003926 Ga0207681_100039264 198
393 3300025923 Ga0207681_10089043 Ga0207681_100890434 198
394 3300025923 Ga0207681_10218381 Ga0207681_102183811 198
395 3300025923 Ga0207681_10409619 Ga0207681_104096192 198
396 3300025924 Ga0207694_10145071 Ga0207694_101450712 198
397 3300025925 Ga0207650_10000719 Ga0207650_1000071928 198
398 3300025925 Ga0207650_10015878 Ga0207650_100158783 198
399 3300025925 Ga0207650_10028142 Ga0207650_100281423 198
400 3300025926 Ga0207659_10016048 Ga0207659_100160486 198
401 3300025926 Ga0207659_10026352 Ga0207659_100263523 198
402 3300025926 Ga0207659_10092384 Ga0207659_100923842 198
403 3300025931 Ga0207644_10027544 Ga0207644_100275442 198
404 3300025931 Ga0207644_10028415 Ga0207644_100284156 198
405 3300025931 Ga0207644_10101239 Ga0207644_101012391 198
406 3300025931 Ga0207644_10875290 Ga0207644_108752901 198
407 3300025933 Ga0207706_10002678 Ga0207706_100026786 198
408 3300025933 Ga0207706_10053095 Ga0207706_100530952 198
409 3300025933 Ga0207706_10144575 Ga0207706_101445752 198
410 3300025934 Ga0207686_10602517 Ga0207686_106025171 198
411 3300025935 Ga0207709_10001128 Ga0207709_100011284 198
412 3300025935 Ga0207709_10251133 Ga0207709_102511332 198
413 3300025935 Ga0207709_10369010 Ga0207709_103690102 198
414 3300025936 Ga0207670_10000013 Ga0207670_100000135 198
415 3300025936 Ga0207670_10106436 Ga0207670_101064362 198
416 3300025936 Ga0207670_10129343 Ga0207670_101293432 198
417 3300025936 Ga0207670_10163334 Ga0207670_101633342 198
418 3300025937 Ga0207669_10036069 Ga0207669_100360693 198
419 3300025937 Ga0207669_10234753 Ga0207669_102347531 198
420 3300025938 Ga0207704_10006479 Ga0207704_100064795 198
421 3300025938 Ga0207704_10323604 Ga0207704_103236042 198
422 3300025940 Ga0207691_10004713 Ga0207691_100047136 198
423 3300025940 Ga0207691_10012663 Ga0207691_100126631 198
424 3300025940 Ga0207691_10059940 Ga0207691_100599403 198
425 3300025940 Ga0207691_10148542 Ga0207691_101485424 198
426 3300025940 Ga0207691_10166626 Ga0207691_101666262 198
427 3300025941 Ga0207711_10017421 Ga0207711_100174211 198
428 3300025941 Ga0207711_10087233 Ga0207711_100872332 198
429 3300025941 Ga0207711_10088805 Ga0207711_100888052 198
430 3300025941 Ga0207711_10446923 Ga0207711_104469231 198
431 3300025942 Ga0207689_10000028 Ga0207689_1000002867 198
432 3300025942 Ga0207689_10005590 Ga0207689_1000559011 198
433 3300025942 Ga0207689_10021316 Ga0207689_100213166 198
434 3300025942 Ga0207689_10069578 Ga0207689_100695783 198
435 3300025942 Ga0207689_10100694 Ga0207689_101006942 198
436 3300025944 Ga0207661_10209201 Ga0207661_102092012 198
437 3300025945 Ga0207679_10114739 Ga0207679_101147392 198
438 3300025945 Ga0207679_10430373 Ga0207679_104303732 198
439 3300025949 Ga0207667_10052414 Ga0207667_100524143 198
440 3300025949 Ga0207667_10069817 Ga0207667_100698176 198
441 3300025949 Ga0207667_10155859 Ga0207667_101558592 198
442 3300025960 Ga0207651_10069466 Ga0207651_100694662 198
443 3300025960 Ga0207651_10447841 Ga0207651_104478412 198
444 3300025960 Ga0207651_10800548 Ga0207651_108005481 198
445 3300025961 Ga0207712_10017823 Ga0207712_100178235 198
446 3300025961 Ga0207712_10105366 Ga0207712_101053662 198
447 3300025961 Ga0207712_10139452 Ga0207712_101394522 198
448 3300025972 Ga0207668_10034095 Ga0207668_100340953 198
449 3300025981 Ga0207640_10048338 Ga0207640_100483382 198
450 3300025981 Ga0207640_10473241 Ga0207640_104732412 198
451 3300025986 Ga0207658_10060269 Ga0207658_100602693 198
452 3300025986 Ga0207658_10109112 Ga0207658_101091124 198
453 3300025986 Ga0207658_10247193 Ga0207658_102471932 198
454 3300025986 Ga0207658_10286707 Ga0207658_102867072 198
455 3300026023 Ga0207677_10089943 Ga0207677_100899432 198
456 3300026023 Ga0207677_10176760 Ga0207677_101767603 198
457 3300026035 Ga0207703_10001188 Ga0207703_100011889 198
458 3300026035 Ga0207703_10064744 Ga0207703_100647442 198
459 3300026035 Ga0207703_10088963 Ga0207703_100889632 198
460 3300026035 Ga0207703_10147891 Ga0207703_101478911 198
461 3300026041 Ga0207639_10002176 Ga0207639_100021767 198
462 3300026075 Ga0207708_10005815 Ga0207708_100058154 198
463 3300026075 Ga0207708_10006203 Ga0207708_100062037 198
464 3300026075 Ga0207708_10056929 Ga0207708_100569294 198
465 3300026078 Ga0207702_10439099 Ga0207702_104390992 198
466 3300026078 Ga0207702_10676646 Ga0207702_106766461 198
467 3300026088 Ga0207641_10005314 Ga0207641_1000531411 198
468 3300026088 Ga0207641_10010772 Ga0207641_100107725 198
469 3300026088 Ga0207641_10552492 Ga0207641_105524922 198
470 3300026088 Ga0207641_10566156 Ga0207641_105661562 198
471 3300026089 Ga0207648_10003835 Ga0207648_100038359 198
472 3300026089 Ga0207648_10006020 Ga0207648_100060204 198
473 3300026089 Ga0207648_10006745 Ga0207648_100067456 198
474 3300026089 Ga0207648_10011832 Ga0207648_100118328 198
475 3300026089 Ga0207648_10084221 Ga0207648_100842212 198
476 3300026095 Ga0207676_10000410 Ga0207676_100004109 198
477 3300026095 Ga0207676_10002118 Ga0207676_1000211815 198
478 3300026095 Ga0207676_10015805 Ga0207676_100158056 198
479 3300026095 Ga0207676_10074039 Ga0207676_100740393 198
480 3300026116 Ga0207674_10002867 Ga0207674_1000286720 198
481 3300026116 Ga0207674_10012997 Ga0207674_100129971 198
482 3300026116 Ga0207674_10065812 Ga0207674_100658123 198
483 3300026116 Ga0207674_10103706 Ga0207674_101037063 198
484 3300026116 Ga0207674_10263992 Ga0207674_102639924 198
485 3300026116 Ga0207674_10299029 Ga0207674_102990292 198
486 3300026118 Ga0207675_100000558 Ga0207675_10000055821 198
487 3300026118 Ga0207675_100001808 Ga0207675_1000018083 198
488 3300026118 Ga0207675_100002279 Ga0207675_1000022798 198
489 3300026118 Ga0207675_100028938 Ga0207675_1000289381 198
490 3300026118 Ga0207675_100059525 Ga0207675_1000595253 198
491 3300026121 Ga0207683_10136812 Ga0207683_101368122 198
492 3300026121 Ga0207683_10267017 Ga0207683_102670173 198
493 3300026121 Ga0207683_10337137 Ga0207683_103371371 198
494 3300026142 Ga0207698_10104346 Ga0207698_101043462 198
495 3300027378 Ga0209981_1002048 Ga0209981_10020483 198
496 3300027462 Ga0210000_1004960 Ga0210000_10049602 198
497 3300027471 Ga0209995_1016929 Ga0209995_10169291 198
498 3300027543 Ga0209999_1001993 Ga0209999_10019932 198
499 3300027543 Ga0209999_1006910 Ga0209999_10069101 198
500 3300027682 Ga0209971_1067721 Ga0209971_10677211 198
501 3300027695 Ga0209966_1034306 Ga0209966_10343062 198
502 3300027907 Ga0207428_10000343 Ga0207428_1000034337 198
503 3300027907 Ga0207428_10018104 Ga0207428_100181046 198
504 3300027907 Ga0207428_10082459 Ga0207428_100824592 198
505 3300027907 Ga0207428_10096925 Ga0207428_100969251 198
506 3300027907 Ga0207428_10104280 Ga0207428_101042802 198
507 3300028379 Ga0268266_10033585 Ga0268266_100335855 198
508 3300028379 Ga0268266_10339404 Ga0268266_103394042 198
509 3300028379 Ga0268266_10346715 Ga0268266_103467151 198
510 3300028380 Ga0268265_10003506 Ga0268265_100035064 198
511 3300028380 Ga0268265_10047481 Ga0268265_100474813 198
512 3300028380 Ga0268265_10050667 Ga0268265_100506672 198
513 3300028380 Ga0268265_10194458 Ga0268265_101944584 198
514 3300028380 Ga0268265_10253779 Ga0268265_102537792 198
515 3300028381 Ga0268264_10008749 Ga0268264_100087497 198
516 3300028381 Ga0268264_10209707 Ga0268264_102097072 198
517 3300028381 Ga0268264_10542764 Ga0268264_105427642 198
518 3300031456 Ga0307513_10000272 Ga0307513_100002729 198
519 3300031548 Ga0307408_100004559 Ga0307408_1000045595 198
520 3300031548 Ga0307408_100015484 Ga0307408_1000154841 198
521 3300031731 Ga0307405_10006436 Ga0307405_100064365 198
522 3300031824 Ga0307413_10044096 Ga0307413_100440962 198
523 3300031852 Ga0307410_10002281 Ga0307410_100022815 198
524 3300031901 Ga0307406_10002498 Ga0307406_100024983 198
525 3300031903 Ga0307407_10015167 Ga0307407_100151673 198
526 3300031903 Ga0307407_10021730 Ga0307407_100217303 198
527 3300031911 Ga0307412_10009824 Ga0307412_100098244 198
528 3300031911 Ga0307412_10209093 Ga0307412_102090932 198
529 3300031995 Ga0307409_100001947 Ga0307409_1000019476 198
530 3300031995 Ga0307409_100671906 Ga0307409_1006719062 198
531 3300032002 Ga0307416_100002671 Ga0307416_1000026715 198
532 3300032004 Ga0307414_10009697 Ga0307414_100096972 198
533 3300032005 Ga0307411_10015024 Ga0307411_100150244 198
534 3300032126 Ga0307415_100012347 Ga0307415_1000123474 198
535 3300034818 Ga0373950_0075413 Ga0373950_0075413_42_668 198
536 3300035083 Ga0373926_0181429 Ga0373926_0181429_66_662 198
537 3300035111 Ga0373923_0125074 Ga0373923_0125074_429_1025 198
538 3300035117 Ga0373953_0117554 Ga0373953_0117554_513_1109 198
539 3300035120 Ga0373957_0048041 Ga0373957_0048041_202_819 198
540 3300035172 Ga0373955_0022181 Ga0373955_0022181_2561_3178 198
541 3300035692 Ga0373935_0024670 Ga0373935_0024670_1196_1792 198
542 3300035692 Ga0373935_0317795 Ga0373935_0317795_372_968 198
543 3300035724 Ga0373933_0057179 Ga0373933_0057179_161_757 198
544 3300035724 Ga0373933_0203860 Ga0373933_0203860_109_705 198
545 3300035725 Ga0373947_0063448 Ga0373947_0063448_13_609 198
546 3300036401 Ga0373937_0034721 Ga0373937_0034721_1728_2324 198
547 3300036401 Ga0373937_0072158 Ga0373937_0072158_1377_1973 198
548 3300036401 Ga0373937_0384236 Ga0373937_0384236_138_755 198
549 3300036401 Ga0373937_0833493 Ga0373937_0833493_128_724 198
550 3300041406 Ga0439439_0139826 Ga0439439_0139826_17_664 198
551 3300042003 Ga0439443_042045 Ga0439443_042045_68_715 198
552 3300042009 Ga0439451_059592 Ga0439451_059592_69_716 198
553 3300042435 Ga0439434_0080245 Ga0439434_0080245_78_725 198
554 3300042436 Ga0439435_0017505 Ga0439435_0017505_1000_1647 198
555 3300042461 Ga0439460_0205149 Ga0439460_0205149_15_617 198
556 3300045049 Ga0466959_0093658 Ga0466959_0093658_1537_2133 198
557 3300046459 Ga0495629_0062752 Ga0495629_0062752_1845_2462 198
558 3300046459 Ga0495629_0174399 Ga0495629_0174399_411_1007 198
559 3300046459 Ga0495629_0581058 Ga0495629_0581058_91_729 198
560 3300046462 Ga0495651_0478222 Ga0495651_0478222_83_679 198
561 3300046473 Ga0495582_0113085 Ga0495582_0113085_807_1403 198
562 3300046473 Ga0495582_0167903 Ga0495582_0167903_600_1217 198
563 3300046474 Ga0495605_0111226 Ga0495605_0111226_376_972 198
564 3300046499 Ga0495594_0014352 Ga0495594_0014352_2945_3541 198
565 3300046499 Ga0495594_0072642 Ga0495594_0072642_1210_1806 198
566 3300046517 Ga0495630_0325512 Ga0495630_0325512_454_1050 198
567 3300046528 Ga0495642_0047162 Ga0495642_0047162_185_781 198
568 3300046536 Ga0495587_0145415 Ga0495587_0145415_282_878 198
569 3300046537 Ga0495598_0194011 Ga0495598_0194011_27_659 198
570 3300046539 Ga0495621_0038774 Ga0495621_0038774_397_1029 198
571 3300046539 Ga0495621_0038793 Ga0495621_0038793_100_702 198
572 3300046539 Ga0495621_0106038 Ga0495621_0106038_235_882 198
573 3300046557 Ga0495622_0211464 Ga0495622_0211464_184_780 198
574 3300046663 Ga0495635_0009129 Ga0495635_0009129_6211_6807 198
575 3300046664 Ga0495659_0040391 Ga0495659_0040391_137_772 198
576 3300046674 Ga0495588_0131666 Ga0495588_0131666_358_954 198
577 3300046675 Ga0495657_0167719 Ga0495657_0167719_439_1035 198
578 3300046679 Ga0495623_0273729 Ga0495623_0273729_110_706 198
579 3300046683 Ga0495658_0185258 Ga0495658_0185258_436_1074 198
580 3300046684 Ga0495669_0156382 Ga0495669_0156382_260_907 198
581 3300047315 Ga0495581_0159998 Ga0495581_0159998_423_1019 198
582 3300047317 Ga0495604_0683113 Ga0495604_0683113_21_617 198
583 3300047321 Ga0495676_0149715 Ga0495676_0149715_805_1401 198
584 3300047322 Ga0495680_0069672 Ga0495680_0069672_746_1342 198
585 3300047443 Ga0495687_021731 Ga0495687_021731_585_1181 198
586 3300048089 Ga0495614_0290462 Ga0495614_0290462_79_675 198
587 3300048903 Ga0496100_0074884 Ga0496100_0074884_232_828 198
588 3300048903 Ga0496100_0225866 Ga0496100_0225866_715_1347 198
589 3300048904 Ga0496101_0086380 Ga0496101_0086380_813_1409 198
590 3300048905 Ga0496102_0031108 Ga0496102_0031108_259_855 198
591 3300048905 Ga0496102_0045218 Ga0496102_0045218_1992_2621 198
592 3300048906 Ga0496103_0024349 Ga0496103_0024349_413_1009 198
593 3300048906 Ga0496103_0107826 Ga0496103_0107826_932_1561 198
594 3300048907 Ga0496104_0146978 Ga0496104_0146978_1449_2045 198
595 3300048908 Ga0496105_0130369 Ga0496105_0130369_23_655 198
596 3300048909 Ga0496106_0094045 Ga0496106_0094045_1290_1919 198
597 3300048909 Ga0496106_0172813 Ga0496106_0172813_162_758 198
598 3300048910 Ga0496107_0046100 Ga0496107_0046100_1396_1992 198
599 3300048911 Ga0496108_0316443 Ga0496108_0316443_580_1176 198
600 3300048911 Ga0496108_0615792 Ga0496108_0615792_106_738 198
601 3300048912 Ga0496109_0050719 Ga0496109_0050719_1241_1837 198
602 3300048912 Ga0496109_0113792 Ga0496109_0113792_17_649 198
603 3300048912 Ga0496109_0134627 Ga0496109_0134627_1372_2001 198
604 3300048912 Ga0496109_1074836 Ga0496109_1074836_96_728 198
605 3300048913 Ga0496110_0110273 Ga0496110_0110273_1208_1840 198
606 3300048913 Ga0496110_0688221 Ga0496110_0688221_29_625 198
607 3300048914 Ga0496111_0049665 Ga0496111_0049665_949_1581 198
608 3300048917 Ga0496114_0162445 Ga0496114_0162445_1069_1665 198
609 3300048917 Ga0496114_0551687 Ga0496114_0551687_247_879 198
610 3300048919 Ga0496116_0001150 Ga0496116_0001150_27028_27660 198
611 3300048927 Ga0496124_0126504 Ga0496124_0126504_1391_1987 198
612 3300049513 Ga0501290_002541 Ga0501290_002541_1524_2120 198
613 3300049514 Ga0501291_000689 Ga0501291_000689_1587_2183 198
614 3300049515 Ga0501292_000230 Ga0501292_000230_6273_6869 198
615 3300049516 Ga0501293_000492 Ga0501293_000492_1176_1772 198
616 3300049519 Ga0501296_000849 Ga0501296_000849_952_1548 198
617 3300049520 Ga0501297_000022 Ga0501297_000022_1200_1796 198
618 3300049523 Ga0501300_000082 Ga0501300_000082_12720_13316 198
619 3300049526 Ga0501303_001246 Ga0501303_001246_378_974 198
620 3300049572 Ga0501036_0325235 Ga0501036_0325235_380_1009 198
621 3300049572 Ga0501036_0461696 Ga0501036_0461696_44_694 198
622 3300049574 Ga0501038_0157775 Ga0501038_0157775_891_1487 198
623 3300049575 Ga0501039_0096337 Ga0501039_0096337_181_777 198
624 3300049580 Ga0501046_0184648 Ga0501046_0184648_481_1077 198
625 3300049585 Ga0501069_0082208 Ga0501069_0082208_980_1576 198
626 3300049587 Ga0501071_0276118 Ga0501071_0276118_69_698 198
627 3300049588 Ga0501072_0464462 Ga0501072_0464462_282_911 198
628 3300049592 Ga0501076_0163176 Ga0501076_0163176_566_1195 198
629 3300049650 Ga0501199_002758 Ga0501199_002758_131_727 198
630 3300049652 Ga0501202_036676 Ga0501202_036676_237_833 198
631 3300049656 Ga0501209_014175 Ga0501209_014175_1065_1661 198
632 3300049658 Ga0501211_012531 Ga0501211_012531_62_658 198
633 3300049660 Ga0501216_031344 Ga0501216_031344_309_905 198
634 3300049664 Ga0501224_015280 Ga0501224_015280_403_999 198
635 3300049669 Ga0501235_000547 Ga0501235_000547_263_859 198
636 3300049675 Ga0501243_000200 Ga0501243_000200_4320_4916 198
637 3300049676 Ga0501246_000210 Ga0501246_000210_822_1418 198
638 3300049678 Ga0501248_002711 Ga0501248_002711_272_868 198
639 3300049686 Ga0501257_004363 Ga0501257_004363_815_1411 198
640 3300049689 Ga0501260_002083 Ga0501260_002083_279_875 198
641 3300049704 Ga0501221_001736 Ga0501221_001736_2503_3099 198
642 3300049705 Ga0501225_0014264 Ga0501225_0014264_1384_1980 198
643 3300049706 Ga0501229_010104 Ga0501229_010104_539_1135 198
644 3300049708 Ga0501245_002018 Ga0501245_002018_749_1345 198
645 3300049742 Ga0501080_0994758 Ga0501080_0994758_19_621 198
646 3300049761 Ga0501264_002343 Ga0501264_002343_832_1428 198
647 3300049762 Ga0501265_011475 Ga0501265_011475_201_797 198
648 3300049763 Ga0501266_003040 Ga0501266_003040_851_1447 198
649 3300049767 Ga0501270_000021 Ga0501270_000021_8866_9462 198
650 3300049770 Ga0501273_001850 Ga0501273_001850_853_1449 198
651 3300049772 Ga0501275_001295 Ga0501275_001295_166_762 198
652 3300049773 Ga0501276_002228 Ga0501276_002228_428_1024 198
653 3300049774 Ga0501278_000078 Ga0501278_000078_3450_4046 198
654 3300049775 Ga0501279_000695 Ga0501279_000695_2602_3198 198
655 3300049777 Ga0501281_00720 Ga0501281_00720_1314_1910 198
656 3300049779 Ga0501283_000146 Ga0501283_000146_1638_2234 198
657 3300049851 Ga0501212_003881 Ga0501212_003881_460_1056 198
658 3300050489 nmdc:mga03683_82729_c1 nmdc:mga03683_82729_c1_713_1348 198
659 3300050491 nmdc:mga00v17_6528_c1 nmdc:mga00v17_6528_c1_4078_4713 198
660 3300050493 nmdc:mga0k408_1050_c1 nmdc:mga0k408_1050_c1_249_884 198
661 3300050494 nmdc:mga06z11_2252_c1 nmdc:mga06z11_2252_c1_2628_3263 198
662 3300050507 nmdc:mga05p37_212485_c1 nmdc:mga05p37_212485_c1_1182_1778 198
663 3300050507 nmdc:mga05p37_636_c1 nmdc:mga05p37_636_c1_24872_25474 198
664 3300050508 nmdc:mga09592_1481_c1 nmdc:mga09592_1481_c1_12220_12822 198
665 3300050508 nmdc:mga09592_21700_c1 nmdc:mga09592_21700_c1_3058_3684 198
666 3300050508 nmdc:mga09592_337367_c1 nmdc:mga09592_337367_c1_367_1002 198
667 3300050508 nmdc:mga09592_779128_c1 nmdc:mga09592_779128_c1_92_688 198
668 3300050509 nmdc:mga0qj67_11261_c1 nmdc:mga0qj67_11261_c1_1013_1654 198
669 3300050509 nmdc:mga0qj67_85207_c1 nmdc:mga0qj67_85207_c1_178_804 198
670 3300050510 nmdc:mga06r32_119136_c1 nmdc:mga06r32_119136_c1_1850_2476 198
671 3300050511 nmdc:mga08y16_3237_c1 nmdc:mga08y16_3237_c1_15065_15700 198
672 3300050511 nmdc:mga08y16_41146_c1 nmdc:mga08y16_41146_c1_2998_3594 198
673 3300050511 nmdc:mga08y16_4821_c1 nmdc:mga08y16_4821_c1_7862_8464 198
674 3300050511 nmdc:mga08y16_56895_c1 nmdc:mga08y16_56895_c1_2888_3484 198
675 3300050512 nmdc:mga0n895_624395_c1 nmdc:mga0n895_624395_c1_419_1054 198
676 3300050512 nmdc:mga0n895_722787_c1 nmdc:mga0n895_722787_c1_17_649 198
677 3300050515 nmdc:mga0a205_117512_c1 nmdc:mga0a205_117512_c1_1821_2456 198
678 3300050515 nmdc:mga0a205_236608_c1 nmdc:mga0a205_236608_c1_177_779 198
679 3300053077 Ga0495601_0237776 Ga0495601_0237776_180_776 198
680 3300053084 Ga0495595_0083016 Ga0495595_0083016_411_1007 198
681 3300053085 Ga0495619_0394905 Ga0495619_0394905_107_703 198
682 3300061734 Ga0530510_0143240 Ga0530510_0143240_560_1177 198
683 iso_pu_bacteria 2834641062 2834645213 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

30

213

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8375 5 198
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.7565 8 188
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6782 8 189
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6767 8 189
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.6701 8 189
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9554 2 195 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9362 1 184 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9321 2 195 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9033 1 184 1.20.120.1760
af_E7F188_23_199_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8741 8 196 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A068S3H5-F1-model_v4 Pyruvate carboxylase 0.9803 2 93 GO:0005524
GO:0008654
GO:0016020
GO:0016780
GO:0016874
GO:0046872
AF-A0A507CX03-F1-model_v4 RNA polymerase II transcription factor B subunit 2 0.97 2 198 GO:0000439
GO:0001671
GO:0003690
GO:0005675
GO:0006289
GO:0008654
GO:0016020
GO:0016780
AF-A0A507CX03-F1-model_v4 RNA polymerase II transcription factor B subunit 2 0.9605 2 198 GO:0000439
GO:0001671
GO:0003690
GO:0005675
GO:0006289
GO:0008654
GO:0016020
GO:0016780
AF-A0A507C890-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9595 2 198 GO:0008654
GO:0012505
GO:0016020
GO:0016780
AF-R8BT71-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9585 2 198 GO:0008654
GO:0012505
GO:0016020
GO:0016780
GO:0022857

Feature Viewer

pLDDT pTM Quality
83.19 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map