F474910

General Info

Members Datasets Scaffolds Average Seq Length
682 222 1364 70

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10667144|Ga0207707_106671442
Length 82
Sequence MPGQHLENLFRRFKGEVVDVKTISGGIYSGRISEVTNDYVCLIETSGSPGQQVFLTFNAIESMGGEHSGRVVATKRHIRHTK

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
165 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
166 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
179 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
184 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
191 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
192 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
200 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
201 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
204 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
205 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
208 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
209 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
210 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
211 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
212 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
213 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
214 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.88
Rhizosphere 99.12
Stem 0
Stem Tuber 0
Unclassified 32.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10667144 3300025912 Bacteria 875
2 JGI24751J29686_10000017 3300002459 Bacteria 109415
3 JGI25406J46586_10023153 3300003203 Bacteria 2458
4 Ga0065712_10000804 3300005290 Bacteria 8129
5 Ga0065712_10024692 3300005290 Bacteria 1239
6 Ga0065712_10067902 3300005290 Bacteria 21942
7 Ga0065715_10064535 3300005293 Bacteria 1015
8 Ga0065715_10092791 3300005293 Bacteria 4905
9 Ga0065715_10120772 3300005293 Bacteria 2245
10 Ga0065715_10127414 3300005293 Bacteria 2086
11 Ga0065715_10374820 3300005293 Bacteria 860
12 Ga0065715_10555770 3300005293 Unclassified 737
13 Ga0065715_10805417 3300005293 Unclassified 608
14 Ga0065715_10872451 3300005293 Bacteria 527
15 Ga0065707_10064352 3300005295 Unclassified 573
16 Ga0065707_10119732 3300005295 Bacteria 2152
17 Ga0065707_10562871 3300005295 Unclassified 713
18 Ga0070670_100134332 3300005331 Bacteria 2137
19 Ga0070670_100188844 3300005331 Bacteria 1789
20 Ga0070670_100516237 3300005331 Bacteria 1064
21 Ga0070670_100771535 3300005331 Unclassified 867
22 Ga0070670_101067850 3300005331 Unclassified 736
23 Ga0070670_102255512 3300005331 Unclassified 502
24 Ga0070677_10254100 3300005333 Bacteria 874
25 Ga0068869_100040400 3300005334 Bacteria 3336
26 Ga0068869_100081843 3300005334 Bacteria 2412
27 Ga0068869_100180234 3300005334 Bacteria 1656
28 Ga0068869_100940768 3300005334 Unclassified 750
29 Ga0068869_100943475 3300005334 Bacteria 749
30 Ga0068869_101145842 3300005334 Unclassified 682
31 Ga0068869_101316238 3300005334 Bacteria 638
32 Ga0070682_100008678 3300005337 Bacteria 5733
33 Ga0070682_100638761 3300005337 Bacteria 846
34 Ga0070682_102052114 3300005337 Unclassified 504
35 Ga0068868_100289228 3300005338 Unclassified 1389
36 Ga0068868_100638476 3300005338 Unclassified 947
37 Ga0070660_100624063 3300005339 Unclassified 902
38 Ga0070689_100000487 3300005340 Bacteria 23451
39 Ga0070689_100168478 3300005340 Bacteria 1774
40 Ga0070689_100539202 3300005340 Bacteria 1004
41 Ga0070689_100859423 3300005340 Unclassified 801
42 Ga0070689_101014875 3300005340 Bacteria 739
43 Ga0070689_101970799 3300005340 Unclassified 534
44 Ga0070691_10547251 3300005341 Unclassified 676
45 Ga0070691_10602289 3300005341 Bacteria 649
46 Ga0070687_100795244 3300005343 Bacteria 670
47 Ga0070687_100865795 3300005343 Bacteria 645
48 Ga0070692_10013846 3300005345 Unclassified 3770
49 Ga0070692_10042355 3300005345 Bacteria 2337
50 Ga0070692_10053314 3300005345 Bacteria 2108
51 Ga0070692_10631145 3300005345 Unclassified 713
52 Ga0070692_11028590 3300005345 Bacteria 578
53 Ga0070692_11357571 3300005345 Unclassified 512
54 Ga0070669_100057404 3300005353 Unclassified 2856
55 Ga0070669_100375103 3300005353 Bacteria 1159
56 Ga0070669_101199032 3300005353 Bacteria 656
57 Ga0070675_100701397 3300005354 Unclassified 922
58 Ga0070675_101015498 3300005354 Bacteria 762
59 Ga0070675_101105093 3300005354 Unclassified 729
60 Ga0070673_100173447 3300005364 Bacteria 1842
61 Ga0070673_100865442 3300005364 Unclassified 837
62 Ga0070673_102122912 3300005364 Unclassified 534
63 Ga0070667_101892342 3300005367 Bacteria 562
64 Ga0070703_10019606 3300005406 Bacteria 1961
65 Ga0070703_10418719 3300005406 Bacteria 587
66 Ga0070701_10059869 3300005438 Bacteria 2004
67 Ga0070701_10114944 3300005438 Bacteria 1509
68 Ga0070701_10184185 3300005438 Bacteria 1225
69 Ga0070701_10903367 3300005438 Unclassified 610
70 Ga0070705_100038971 3300005440 Bacteria 2693
71 Ga0070705_100053539 3300005440 Bacteria 2363
72 Ga0070705_100245427 3300005440 Bacteria 1254
73 Ga0070705_100421468 3300005440 Bacteria 994
74 Ga0070705_101564922 3300005440 Bacteria 554
75 Ga0070700_100000106 3300005441 Bacteria 53028
76 Ga0070700_100009921 3300005441 Bacteria 5239
77 Ga0070700_100749785 3300005441 Unclassified 781
78 Ga0070700_101088544 3300005441 Unclassified 662
79 Ga0070700_101396924 3300005441 Unclassified 592
80 Ga0070700_101479210 3300005441 Unclassified 577
81 Ga0070694_100004804 3300005444 Bacteria 8137
82 Ga0070694_100028414 3300005444 Unclassified 3639
83 Ga0070694_100074735 3300005444 Bacteria 2343
84 Ga0070694_100104655 3300005444 Bacteria 2007
85 Ga0070694_100266571 3300005444 Unclassified 1301
86 Ga0070694_100619434 3300005444 Unclassified 873
87 Ga0070694_100674242 3300005444 Bacteria 839
88 Ga0070694_100766797 3300005444 Bacteria 789
89 Ga0070694_101007151 3300005444 Unclassified 692
90 Ga0070708_100003716 3300005445 Bacteria 11967
91 Ga0070662_100781625 3300005457 Bacteria 811
92 Ga0070681_10140368 3300005458 Bacteria 2346
93 Ga0070681_10721072 3300005458 Unclassified 913
94 Ga0068867_100906767 3300005459 Bacteria 793
95 Ga0068867_101109031 3300005459 Unclassified 723
96 Ga0070706_100006829 3300005467 Bacteria 10774
97 Ga0070707_100568730 3300005468 Bacteria 1096
98 Ga0070698_100008079 3300005471 Bacteria 11381
99 Ga0070698_100406906 3300005471 Bacteria 1294
100 Ga0070699_100004780 3300005518 Bacteria 11972
101 Ga0070699_100021698 3300005518 Bacteria 5537
102 Ga0070699_100034623 3300005518 Unclassified 4365
103 Ga0070699_100581405 3300005518 Bacteria 1021
104 Ga0070699_101040555 3300005518 Bacteria 751
105 Ga0070679_100667659 3300005530 Unclassified 982
106 Ga0070697_100032062 3300005536 Bacteria 4226
107 Ga0070697_100456177 3300005536 Bacteria 1114
108 Ga0070697_101756665 3300005536 Unclassified 555
109 Ga0068853_100241781 3300005539 Bacteria 1655
110 Ga0068853_101199580 3300005539 Unclassified 733
111 Ga0070672_100275056 3300005543 Bacteria 1423
112 Ga0070672_100589028 3300005543 Unclassified 968
113 Ga0070672_100811119 3300005543 Bacteria 824
114 Ga0070695_100017036 3300005545 Bacteria 4408
115 Ga0070695_100186346 3300005545 Bacteria 1474
116 Ga0070695_100563958 3300005545 Bacteria 889
117 Ga0070695_100636234 3300005545 Bacteria 841
118 Ga0070695_100769862 3300005545 Unclassified 769
119 Ga0070695_100921961 3300005545 Bacteria 706
120 Ga0070696_100091298 3300005546 Bacteria 2168
121 Ga0070696_101780715 3300005546 Unclassified 532
122 Ga0070696_101838596 3300005546 Unclassified 524
123 Ga0070693_100005300 3300005547 Bacteria 6180
124 Ga0070693_100037456 3300005547 Bacteria 2705
125 Ga0070693_100751237 3300005547 Unclassified 719
126 Ga0070693_101074022 3300005547 Bacteria 613
127 Ga0070704_100013202 3300005549 Bacteria 5120
128 Ga0070704_100524819 3300005549 Bacteria 1031
129 Ga0070664_101406225 3300005564 Bacteria 660
130 Ga0070664_101771672 3300005564 Unclassified 586
131 Ga0068857_100117054 3300005577 Unclassified 2398
132 Ga0068857_100148457 3300005577 Bacteria 2123
133 Ga0068857_100419382 3300005577 Unclassified 1248
134 Ga0068857_100468486 3300005577 Bacteria 1180
135 Ga0068857_100484223 3300005577 Bacteria 1160
136 Ga0068857_100492461 3300005577 Bacteria 1150
137 Ga0068857_100742237 3300005577 Bacteria 935
138 Ga0068857_101316016 3300005577 Bacteria 701
139 Ga0068857_102222703 3300005577 Unclassified 539
140 Ga0068854_100391553 3300005578 Bacteria 1148
141 Ga0068854_100541519 3300005578 Bacteria 986
142 Ga0068854_100914167 3300005578 Bacteria 772
143 Ga0070702_100058909 3300005615 Bacteria 2227
144 Ga0070702_100061384 3300005615 Bacteria 2188
145 Ga0070702_100888235 3300005615 Unclassified 697
146 Ga0068852_100025548 3300005616 Bacteria 4787
147 Ga0068852_100182045 3300005616 Bacteria 1977
148 Ga0068852_101710069 3300005616 Unclassified 651
149 Ga0068852_102429712 3300005616 Unclassified 544
150 Ga0068859_100000546 3300005617 Bacteria 37260
151 Ga0068859_100079750 3300005617 Unclassified 3314
152 Ga0068859_100105270 3300005617 Bacteria 2880
153 Ga0068859_100114072 3300005617 Bacteria 2766
154 Ga0068859_100171361 3300005617 Bacteria 2251
155 Ga0068859_100190768 3300005617 Bacteria 2134
156 Ga0068859_100295312 3300005617 Bacteria 1713
157 Ga0068859_100396922 3300005617 Bacteria 1475
158 Ga0068859_100530075 3300005617 Bacteria 1272
159 Ga0068859_100545261 3300005617 Bacteria 1254
160 Ga0068859_100712840 3300005617 Bacteria 1094
161 Ga0068859_100743901 3300005617 Bacteria 1070
162 Ga0068859_100842098 3300005617 Bacteria 1003
163 Ga0068859_101094153 3300005617 Unclassified 877
164 Ga0068859_101170212 3300005617 Bacteria 847
165 Ga0068859_101835213 3300005617 Unclassified 670
166 Ga0068859_102075565 3300005617 Bacteria 627
167 Ga0068859_102262608 3300005617 Bacteria 600
168 Ga0068864_100009488 3300005618 Bacteria 8029
169 Ga0068864_100288871 3300005618 Bacteria 1533
170 Ga0068864_100353014 3300005618 Bacteria 1388
171 Ga0068864_100508053 3300005618 Unclassified 1160
172 Ga0068864_100588583 3300005618 Bacteria 1079
173 Ga0068864_101174351 3300005618 Unclassified 765
174 Ga0068864_101731475 3300005618 Unclassified 630
175 Ga0068864_102389886 3300005618 Unclassified 535
176 Ga0068866_10449047 3300005718 Bacteria 843
177 Ga0068861_100470864 3300005719 Bacteria 1130
178 Ga0068861_100697868 3300005719 Bacteria 943
179 Ga0068861_101493708 3300005719 Unclassified 663
180 Ga0068870_10008899 3300005840 Bacteria 4535
181 Ga0068870_10262127 3300005840 Unclassified 1076
182 Ga0068870_10406098 3300005840 Bacteria 887
183 Ga0068870_10448784 3300005840 Unclassified 850
184 Ga0068870_10685333 3300005840 Unclassified 705
185 Ga0068863_100061586 3300005841 Bacteria 3548
186 Ga0068863_100258307 3300005841 Bacteria 1684
187 Ga0068863_100294695 3300005841 Unclassified 1573
188 Ga0068863_100452171 3300005841 Bacteria 1261
189 Ga0068863_100474508 3300005841 Bacteria 1229
190 Ga0068863_100509367 3300005841 Unclassified 1186
191 Ga0068863_100571420 3300005841 Bacteria 1117
192 Ga0068863_101256605 3300005841 Bacteria 747
193 Ga0068863_101638918 3300005841 Bacteria 653
194 Ga0068863_101684418 3300005841 Bacteria 644
195 Ga0068863_102166941 3300005841 Unclassified 566
196 Ga0068858_100030984 3300005842 Unclassified 4967
197 Ga0068858_100046366 3300005842 Bacteria 4029
198 Ga0068858_100079608 3300005842 Bacteria 3044
199 Ga0068858_100106766 3300005842 Bacteria 2613
200 Ga0068858_100186420 3300005842 Bacteria 1960
201 Ga0068858_100384637 3300005842 Bacteria 1347
202 Ga0068858_100569072 3300005842 Bacteria 1098
203 Ga0068858_102249855 3300005842 Unclassified 539
204 Ga0068860_100033327 3300005843 Unclassified 4944
205 Ga0068860_100045762 3300005843 Bacteria 4172
206 Ga0068860_100227383 3300005843 Bacteria 1812
207 Ga0068860_100252773 3300005843 Bacteria 1717
208 Ga0068860_100522734 3300005843 Bacteria 1187
209 Ga0068860_101475871 3300005843 Unclassified 701
210 Ga0068860_101504526 3300005843 Unclassified 695
211 Ga0068862_100209592 3300005844 Bacteria 1760
212 Ga0068862_100725742 3300005844 Bacteria 965
213 Ga0068862_102510593 3300005844 Unclassified 527
214 Ga0081539_10000043 3300005985 Bacteria 288108
215 Ga0081539_10101717 3300005985 Bacteria 1463
216 Ga0075432_10022168 3300006058 Bacteria 2172
217 Ga0070712_100736473 3300006175 Bacteria 843
218 Ga0097621_100024689 3300006237 Bacteria 4697
219 Ga0097621_100126380 3300006237 Bacteria 2172
220 Ga0097621_101036173 3300006237 Unclassified 768
221 Ga0068871_100000781 3300006358 Bacteria 21419
222 Ga0068871_100733901 3300006358 Bacteria 907
223 Ga0068871_100745803 3300006358 Unclassified 900
224 Ga0075428_100195622 3300006844 Unclassified 2186
225 Ga0075431_100430388 3300006847 Unclassified 1318
226 Ga0075433_10058896 3300006852 Unclassified 3360
227 Ga0075433_10094534 3300006852 Bacteria 2645
228 Ga0075433_10308997 3300006852 Bacteria 1399
229 Ga0075433_10325907 3300006852 Bacteria 1359
230 Ga0075433_10514056 3300006852 Bacteria 1054
231 Ga0075433_10524692 3300006852 Unclassified 1042
232 Ga0075434_100024472 3300006871 Bacteria 5902
233 Ga0075434_100040537 3300006871 Bacteria 4611
234 Ga0075434_100209327 3300006871 Unclassified 1970
235 Ga0075434_100247590 3300006871 Bacteria 1802
236 Ga0075434_102053110 3300006871 Unclassified 577
237 Ga0075429_100978757 3300006880 Bacteria 740
238 Ga0075429_101316245 3300006880 Unclassified 630
239 Ga0068865_101110035 3300006881 Bacteria 697
240 Ga0068865_101114623 3300006881 Bacteria 696
241 Ga0075436_100066677 3300006914 Bacteria 2488
242 Ga0097620_100000546 3300006931 Bacteria 37260
243 Ga0097620_100079741 3300006931 Unclassified 3314
244 Ga0097620_100105277 3300006931 Bacteria 2880
245 Ga0097620_100114072 3300006931 Bacteria 2766
246 Ga0097620_100171365 3300006931 Bacteria 2251
247 Ga0097620_100190763 3300006931 Bacteria 2134
248 Ga0097620_100295320 3300006931 Bacteria 1713
249 Ga0097620_100396908 3300006931 Bacteria 1475
250 Ga0097620_100530064 3300006931 Bacteria 1272
251 Ga0097620_100545218 3300006931 Bacteria 1254
252 Ga0097620_100712856 3300006931 Bacteria 1094
253 Ga0097620_100743861 3300006931 Bacteria 1070
254 Ga0097620_100842066 3300006931 Bacteria 1003
255 Ga0097620_101094137 3300006931 Unclassified 877
256 Ga0097620_101170208 3300006931 Bacteria 847
257 Ga0097620_101835284 3300006931 Unclassified 670
258 Ga0097620_102075604 3300006931 Bacteria 627
259 Ga0097620_102262541 3300006931 Bacteria 600
260 Ga0075435_100015569 3300007076 Bacteria 5721
261 Ga0075435_101133459 3300007076 Unclassified 684
262 Ga0105251_10138530 3300009011 Unclassified 1101
263 Ga0105240_10194975 3300009093 Bacteria 2379
264 Ga0105240_11356381 3300009093 Bacteria 749
265 Ga0105240_11574963 3300009093 Unclassified 688
266 Ga0105240_12171503 3300009093 Unclassified 576
267 Ga0105240_12408804 3300009093 Unclassified 545
268 Ga0111539_10000627 3300009094 Bacteria 45686
269 Ga0111539_10128885 3300009094 Unclassified 2963
270 Ga0111539_11461728 3300009094 Unclassified 793
271 Ga0111539_11773506 3300009094 Bacteria 716
272 Ga0105245_10667086 3300009098 Bacteria 1071
273 Ga0105245_10992686 3300009098 Unclassified 884
274 Ga0105245_11438801 3300009098 Bacteria 740
275 Ga0105245_12974819 3300009098 Unclassified 525
276 Ga0105247_10000592 3300009101 Bacteria 29439
277 Ga0105247_10061902 3300009101 Bacteria 2321
278 Ga0105247_10090286 3300009101 Bacteria 1943
279 Ga0105247_10169367 3300009101 Bacteria 1451
280 Ga0105247_11241927 3300009101 Unclassified 595
281 Ga0114129_10160644 3300009147 Bacteria 3070
282 Ga0114129_10332230 3300009147 Bacteria 2018
283 Ga0114129_11094227 3300009147 Bacteria 998
284 Ga0105243_10034114 3300009148 Bacteria 3938
285 Ga0105243_10034816 3300009148 Bacteria 3901
286 Ga0105243_10496339 3300009148 Bacteria 1156
287 Ga0105243_10632462 3300009148 Bacteria 1035
288 Ga0105243_11110079 3300009148 Unclassified 800
289 Ga0105243_11188385 3300009148 Unclassified 775
290 Ga0105243_11280866 3300009148 Bacteria 749
291 Ga0105243_12673996 3300009148 Unclassified 539
292 Ga0105241_10077327 3300009174 Bacteria 2597
293 Ga0105241_10233422 3300009174 Bacteria 1552
294 Ga0105241_10240554 3300009174 Bacteria 1530
295 Ga0105241_10336126 3300009174 Unclassified 1307
296 Ga0105241_10427424 3300009174 Bacteria 1167
297 Ga0105241_10521618 3300009174 Bacteria 1062
298 Ga0105241_10527297 3300009174 Bacteria 1057
299 Ga0105241_10896729 3300009174 Unclassified 823
300 Ga0105241_11323154 3300009174 Bacteria 687
301 Ga0105241_11502668 3300009174 Unclassified 648
302 Ga0105241_11870605 3300009174 Unclassified 587
303 Ga0105242_10251279 3300009176 Bacteria 1593
304 Ga0105248_10036913 3300009177 Bacteria 5465
305 Ga0105248_10081375 3300009177 Bacteria 3640
306 Ga0105248_10179822 3300009177 Bacteria 2383
307 Ga0105248_10292197 3300009177 Bacteria 1835
308 Ga0105248_10435011 3300009177 Bacteria 1478
309 Ga0105248_10507363 3300009177 Bacteria 1360
310 Ga0105248_10959999 3300009177 Bacteria 965
311 Ga0105248_12056858 3300009177 Unclassified 649
312 Ga0105237_10009719 3300009545 Bacteria 10290
313 Ga0105237_10035165 3300009545 Bacteria 5071
314 Ga0105237_10939266 3300009545 Bacteria 872
315 Ga0105237_12600252 3300009545 Bacteria 517
316 Ga0105238_10016298 3300009551 Bacteria 7522
317 Ga0105238_10170628 3300009551 Unclassified 2151
318 Ga0105238_10770434 3300009551 Unclassified 977
319 Ga0105238_11555589 3300009551 Unclassified 691
320 Ga0105249_10007469 3300009553 Bacteria 9537
321 Ga0105249_10432447 3300009553 Bacteria 1352
322 Ga0105249_11642603 3300009553 Bacteria 715
323 Ga0105249_11785514 3300009553 Bacteria 688
324 Ga0105239_10966206 3300010375 Bacteria 979
325 Ga0105239_11068906 3300010375 Bacteria 929
326 Ga0105239_11461596 3300010375 Bacteria 790
327 Ga0105239_11874425 3300010375 Bacteria 695
328 Ga0105239_13173317 3300010375 Unclassified 535
329 Ga0105246_10041787 3300011119 Bacteria 3101
330 Ga0105246_10121088 3300011119 Bacteria 1939
331 Ga0105246_10194633 3300011119 Bacteria 1572
332 Ga0105246_10241560 3300011119 Bacteria 1428
333 Ga0105246_10438962 3300011119 Bacteria 1094
334 Ga0105246_10470606 3300011119 Bacteria 1061
335 Ga0105246_11928027 3300011119 Unclassified 568
336 Ga0157373_10001400 3300013100 Bacteria 18481
337 Ga0157373_10095347 3300013100 Bacteria 2094
338 Ga0157373_10523395 3300013100 Bacteria 858
339 Ga0157373_10557344 3300013100 Bacteria 831
340 Ga0157373_10735210 3300013100 Unclassified 725
341 Ga0157371_10990031 3300013102 Unclassified 641
342 Ga0157371_11647083 3300013102 Bacteria 503
343 Ga0157369_12462823 3300013105 Bacteria 527
344 Ga0157374_11938152 3300013296 Unclassified 615
345 Ga0157378_10070079 3300013297 Bacteria 3147
346 Ga0157378_10618760 3300013297 Unclassified 1096
347 Ga0157378_11170794 3300013297 Bacteria 807
348 Ga0157378_11722919 3300013297 Bacteria 674
349 Ga0157378_12222404 3300013297 Unclassified 600
350 Ga0157378_12502313 3300013297 Unclassified 568
351 Ga0163162_10124317 3300013306 Bacteria 2685
352 Ga0163162_10184965 3300013306 Bacteria 2210
353 Ga0163162_10223667 3300013306 Bacteria 2012
354 Ga0163162_10535443 3300013306 Bacteria 1300
355 Ga0163162_10656251 3300013306 Bacteria 1173
356 Ga0157372_10001564 3300013307 Bacteria 24928
357 Ga0157372_12994186 3300013307 Unclassified 540
358 Ga0157375_10034484 3300013308 Bacteria 4822
359 Ga0157375_10653114 3300013308 Bacteria 1208
360 Ga0157375_10681710 3300013308 Bacteria 1182
361 Ga0157375_10952490 3300013308 Bacteria 1000
362 Ga0157375_12762673 3300013308 Unclassified 587
363 Ga0163163_10000862 3300014325 Bacteria 25852
364 Ga0163163_10086335 3300014325 Bacteria 3147
365 Ga0163163_10151138 3300014325 Unclassified 2365
366 Ga0163163_10378535 3300014325 Bacteria 1473
367 Ga0163163_11316459 3300014325 Bacteria 784
368 Ga0157380_10249138 3300014326 Bacteria 1607
369 Ga0157380_10597319 3300014326 Bacteria 1091
370 Ga0157380_11123057 3300014326 Bacteria 826
371 Ga0157380_11464143 3300014326 Bacteria 735
372 Ga0157380_12375867 3300014326 Unclassified 595
373 Ga0157380_12521096 3300014326 Unclassified 580
374 Ga0182008_10249726 3300014497 Unclassified 915
375 Ga0157377_10120747 3300014745 Unclassified 1588
376 Ga0157377_10413569 3300014745 Unclassified 922
377 Ga0157377_10415315 3300014745 Unclassified 920
378 Ga0157377_10541019 3300014745 Bacteria 821
379 Ga0157377_10705083 3300014745 Unclassified 733
380 Ga0157379_10081679 3300014968 Bacteria 2895
381 Ga0157379_10295609 3300014968 Bacteria 1475
382 Ga0157379_10335700 3300014968 Bacteria 1382
383 Ga0157376_11871338 3300014969 Bacteria 637
384 Ga0207713_1165460 3300025735 Unclassified 702
385 Ga0207653_10010519 3300025885 Bacteria 2885
386 Ga0207642_10391734 3300025899 Unclassified 829
387 Ga0207710_10001345 3300025900 Bacteria 12343
388 Ga0207710_10095722 3300025900 Bacteria 1395
389 Ga0207710_10152845 3300025900 Bacteria 1120
390 Ga0207680_10606359 3300025903 Unclassified 783
391 Ga0207647_10000385 3300025904 Bacteria 35983
392 Ga0207647_10043769 3300025904 Bacteria 2799
393 Ga0207647_10097531 3300025904 Bacteria 1748
394 Ga0207647_10386112 3300025904 Unclassified 790
395 Ga0207643_10000804 3300025908 Bacteria 19099
396 Ga0207643_10084026 3300025908 Unclassified 1848
397 Ga0207643_10328359 3300025908 Bacteria 957
398 Ga0207643_10388653 3300025908 Unclassified 881
399 Ga0207643_10577374 3300025908 Bacteria 723
400 Ga0207643_10902947 3300025908 Bacteria 572
401 Ga0207684_10186211 3300025910 Bacteria 1790
402 Ga0207654_10013752 3300025911 Bacteria 4170
403 Ga0207654_10749253 3300025911 Bacteria 704
404 Ga0207654_10753358 3300025911 Bacteria 702
405 Ga0207654_10773846 3300025911 Bacteria 692
406 Ga0207654_11226271 3300025911 Unclassified 547
407 Ga0207707_10550041 3300025912 Unclassified 981
408 Ga0207707_11621503 3300025912 Unclassified 509
409 Ga0207695_10108480 3300025913 Bacteria 2760
410 Ga0207695_10596272 3300025913 Bacteria 986
411 Ga0207671_10002718 3300025914 Bacteria 18529
412 Ga0207671_10137148 3300025914 Bacteria 1882
413 Ga0207671_10733224 3300025914 Bacteria 785
414 Ga0207660_10934225 3300025917 Unclassified 708
415 Ga0207662_10110589 3300025918 Bacteria 1712
416 Ga0207662_10316182 3300025918 Unclassified 1041
417 Ga0207662_10494390 3300025918 Bacteria 842
418 Ga0207662_10637372 3300025918 Bacteria 744
419 Ga0207657_10510239 3300025919 Unclassified 941
420 Ga0207646_10213646 3300025922 Unclassified 1742
421 Ga0207646_10452503 3300025922 Unclassified 1158
422 Ga0207681_11290927 3300025923 Unclassified 613
423 Ga0207694_10013903 3300025924 Bacteria 6068
424 Ga0207650_10000005 3300025925 Bacteria 663190
425 Ga0207650_10077950 3300025925 Bacteria 2506
426 Ga0207650_10711302 3300025925 Unclassified 849
427 Ga0207650_11429753 3300025925 Bacteria 588
428 Ga0207650_11728116 3300025925 Unclassified 530
429 Ga0207650_11899681 3300025925 Bacteria 503
430 Ga0207659_10190781 3300025926 Bacteria 1631
431 Ga0207659_10479173 3300025926 Bacteria 1051
432 Ga0207659_10525290 3300025926 Unclassified 1004
433 Ga0207687_10929265 3300025927 Bacteria 745
434 Ga0207687_10961994 3300025927 Bacteria 732
435 Ga0207687_11318932 3300025927 Unclassified 620
436 Ga0207690_11850888 3300025932 Unclassified 504
437 Ga0207706_10184766 3300025933 Bacteria 1831
438 Ga0207686_10231423 3300025934 Bacteria 1340
439 Ga0207709_10002239 3300025935 Bacteria 12329
440 Ga0207709_10396818 3300025935 Bacteria 1054
441 Ga0207709_10725600 3300025935 Unclassified 797
442 Ga0207670_10003397 3300025936 Bacteria 8456
443 Ga0207670_10156747 3300025936 Bacteria 1696
444 Ga0207670_10606625 3300025936 Bacteria 899
445 Ga0207670_11387931 3300025936 Bacteria 596
446 Ga0207704_11066370 3300025938 Unclassified 686
447 Ga0207691_10192748 3300025940 Unclassified 1777
448 Ga0207691_10631399 3300025940 Unclassified 906
449 Ga0207691_10908983 3300025940 Bacteria 737
450 Ga0207711_10018181 3300025941 Bacteria 5843
451 Ga0207711_10028936 3300025941 Unclassified 4669
452 Ga0207711_10104033 3300025941 Bacteria 2515
453 Ga0207689_10030554 3300025942 Bacteria 4489
454 Ga0207689_10150190 3300025942 Bacteria 1920
455 Ga0207689_10301140 3300025942 Bacteria 1329
456 Ga0207689_10315598 3300025942 Unclassified 1297
457 Ga0207689_10424215 3300025942 Bacteria 1110
458 Ga0207689_10573739 3300025942 Bacteria 948
459 Ga0207689_10838619 3300025942 Bacteria 776
460 Ga0207679_10535082 3300025945 Bacteria 1049
461 Ga0207679_10959756 3300025945 Bacteria 783
462 Ga0207679_11613633 3300025945 Unclassified 594
463 Ga0207651_10090863 3300025960 Bacteria 2234
464 Ga0207651_10177459 3300025960 Bacteria 1686
465 Ga0207651_10554289 3300025960 Bacteria 1000
466 Ga0207651_10818521 3300025960 Bacteria 826
467 Ga0207651_10839882 3300025960 Bacteria 816
468 Ga0207712_10004141 3300025961 Bacteria 9158
469 Ga0207712_10409248 3300025961 Archaea 1142
470 Ga0207712_11820580 3300025961 Unclassified 545
471 Ga0207640_10193277 3300025981 Bacteria 1536
472 Ga0207640_10254334 3300025981 Bacteria 1365
473 Ga0207640_10502575 3300025981 Bacteria 1010
474 Ga0207640_11576209 3300025981 Unclassified 591
475 Ga0207677_10237575 3300026023 Unclassified 1472
476 Ga0207677_11719108 3300026023 Bacteria 582
477 Ga0207703_10029743 3300026035 Unclassified 4312
478 Ga0207703_10068780 3300026035 Bacteria 2918
479 Ga0207703_10230240 3300026035 Bacteria 1661
480 Ga0207703_10290851 3300026035 Bacteria 1487
481 Ga0207703_10359337 3300026035 Bacteria 1343
482 Ga0207703_11057361 3300026035 Unclassified 779
483 Ga0207639_10835703 3300026041 Unclassified 859
484 Ga0207708_10000043 3300026075 Bacteria 121725
485 Ga0207708_10003192 3300026075 Bacteria 12078
486 Ga0207708_10045193 3300026075 Bacteria 3356
487 Ga0207708_10065362 3300026075 Bacteria 2780
488 Ga0207708_10538184 3300026075 Bacteria 983
489 Ga0207708_10657614 3300026075 Bacteria 892
490 Ga0207708_10821746 3300026075 Bacteria 801
491 Ga0207641_10060659 3300026088 Unclassified 3224
492 Ga0207641_10150738 3300026088 Unclassified 2106
493 Ga0207641_10168290 3300026088 Bacteria 1998
494 Ga0207641_10275465 3300026088 Bacteria 1580
495 Ga0207641_10344924 3300026088 Bacteria 1418
496 Ga0207641_10524726 3300026088 Bacteria 1152
497 Ga0207641_10766559 3300026088 Bacteria 953
498 Ga0207641_11804888 3300026088 Bacteria 613
499 Ga0207648_10252864 3300026089 Bacteria 1571
500 Ga0207648_10351568 3300026089 Bacteria 1329
501 Ga0207648_10354923 3300026089 Unclassified 1322
502 Ga0207648_11882862 3300026089 Bacteria 560
503 Ga0207676_10063780 3300026095 Bacteria 2927
504 Ga0207676_10170330 3300026095 Bacteria 1896
505 Ga0207676_10176302 3300026095 Bacteria 1868
506 Ga0207676_10282444 3300026095 Bacteria 1508
507 Ga0207676_10529585 3300026095 Bacteria 1123
508 Ga0207676_10556377 3300026095 Bacteria 1096
509 Ga0207676_10781229 3300026095 Unclassified 930
510 Ga0207676_10934061 3300026095 Unclassified 852
511 Ga0207676_11042607 3300026095 Bacteria 807
512 Ga0207676_11623122 3300026095 Unclassified 644
513 Ga0207676_11924473 3300026095 Unclassified 590
514 Ga0207674_10040324 3300026116 Unclassified 4837
515 Ga0207674_10075540 3300026116 Bacteria 3379
516 Ga0207674_10087926 3300026116 Bacteria 3100
517 Ga0207674_10141815 3300026116 Unclassified 2362
518 Ga0207674_10180402 3300026116 Bacteria 2063
519 Ga0207674_10297325 3300026116 Bacteria 1563
520 Ga0207674_10399867 3300026116 Bacteria 1328
521 Ga0207674_10412275 3300026116 Bacteria 1305
522 Ga0207674_10482528 3300026116 Bacteria 1198
523 Ga0207674_10782652 3300026116 Unclassified 921
524 Ga0207675_100370388 3300026118 Bacteria 1407
525 Ga0207675_100524039 3300026118 Bacteria 1182
526 Ga0207675_100782261 3300026118 Bacteria 967
527 Ga0207675_101098557 3300026118 Unclassified 815
528 Ga0207675_101220305 3300026118 Bacteria 772
529 Ga0207698_10091876 3300026142 Unclassified 2486
530 Ga0207698_10148823 3300026142 Unclassified 2029
531 Ga0207698_10706474 3300026142 Bacteria 1004
532 Ga0207698_10847126 3300026142 Bacteria 919
533 Ga0207698_11773924 3300026142 Bacteria 632
534 Ga0207428_10022474 3300027907 Bacteria 5323
535 Ga0268265_10168154 3300028380 Bacteria 1871
536 Ga0268265_10192955 3300028380 Bacteria 1761
537 Ga0268265_11381421 3300028380 Unclassified 706
538 Ga0268265_11603173 3300028380 Bacteria 656
539 Ga0268264_10120319 3300028381 Bacteria 2313
540 Ga0268264_10126146 3300028381 Bacteria 2262
541 Ga0268264_10128081 3300028381 Bacteria 2246
542 Ga0268264_10384385 3300028381 Bacteria 1345
543 Ga0268264_10943770 3300028381 Bacteria 867
544 Ga0268264_11824726 3300028381 Unclassified 618
545 Ga0268264_12297528 3300028381 Bacteria 546
546 Ga0268264_12567794 3300028381 Bacteria 514
547 Ga0307408_100055328 3300031548 Bacteria 2872
548 Ga0307408_100255390 3300031548 Bacteria 1448
549 Ga0307405_10017215 3300031731 Unclassified 3961
550 Ga0307405_10194313 3300031731 Bacteria 1468
551 Ga0307405_11648061 3300031731 Unclassified 567
552 Ga0307410_10041242 3300031852 Bacteria 3043
553 Ga0307410_10180106 3300031852 Bacteria 1600
554 Ga0307406_10005794 3300031901 Bacteria 6770
555 Ga0307406_10452011 3300031901 Bacteria 1031
556 Ga0307406_11137981 3300031901 Bacteria 675
557 Ga0307412_10506019 3300031911 Bacteria 1006
558 Ga0307412_10880460 3300031911 Bacteria 783
559 Ga0307409_101509221 3300031995 Unclassified 699
560 Ga0307409_102008455 3300031995 Unclassified 608
561 Ga0307409_102131983 3300031995 Unclassified 590
562 Ga0307416_100011073 3300032002 Bacteria 5995
563 Ga0307416_101377392 3300032002 Unclassified 811
564 Ga0307416_101672150 3300032002 Bacteria 741
565 Ga0307416_102254581 3300032002 Unclassified 645
566 Ga0307414_10054568 3300032004 Bacteria 2793
567 Ga0307414_10347969 3300032004 Bacteria 1271
568 Ga0307411_10027293 3300032005 Bacteria 3452
569 Ga0307411_10109569 3300032005 Unclassified 1973
570 Ga0307411_12307877 3300032005 Unclassified 505
571 Ga0307415_100042628 3300032126 Bacteria 3021
572 Ga0373951_0178246 3300035091 Unclassified 609
573 Ga0373952_0060555 3300035092 Bacteria 925
574 Ga0373939_0060957 3300035114 Bacteria 1201
575 Ga0373941_0167231 3300035115 Unclassified 817
576 Ga0373931_1054181 3300035691 Bacteria 552
577 Ga0395899_0285360 3300037312 Unclassified 1122
578 Ga0395900_0146563 3300037418 Bacteria 2414
579 Ga0395898_0817452 3300037466 Bacteria 872
580 Ga0395898_0934198 3300037466 Bacteria 805
581 Ga0395901_1054194 3300038443 Bacteria 786
582 Ga0242419_009039 3300038698 Bacteria 751
583 Ga0242422_02224 3300038699 Bacteria 1319
584 Ga0242420_008256 3300038996 Bacteria 1685
585 Ga0242420_134741 3300038996 Unclassified 546
586 Ga0439455_0016572 3300042012 Bacteria 1706
587 Ga0450889_019863 3300042144 Bacteria 741
588 Ga0439458_0003851 3300042157 Bacteria 3469
589 Ga0451577_1406032 3300042876 Bacteria 619
590 Ga0453683_0382749 3300044673 Unclassified 906
591 Ga0451576_0263226 3300045051 Bacteria 1803
592 Ga0451576_0837592 3300045051 Bacteria 966
593 Ga0496106_0111858 3300048909 Bacteria 2127
594 Ga0496106_0122114 3300048909 Bacteria 2037
595 Ga0496112_0174187 3300048915 Bacteria 2117
596 Ga0496112_1448079 3300048915 Bacteria 601
597 Ga0496113_0326606 3300048916 Bacteria 1230
598 Ga0496113_0864329 3300048916 Bacteria 716
599 Ga0501290_022814 3300049513 Unclassified 865
600 Ga0501292_028408 3300049515 Unclassified 931
601 Ga0501293_015237 3300049516 Bacteria 706
602 Ga0501296_004610 3300049519 Bacteria 1511
603 Ga0501296_008675 3300049519 Bacteria 1183
604 Ga0501298_049668 3300049521 Unclassified 868
605 Ga0501298_094021 3300049521 Bacteria 675
606 Ga0501299_052018 3300049522 Bacteria 848
607 Ga0501198_002901 3300049649 Bacteria 2334
608 Ga0501198_031234 3300049649 Unclassified 890
609 Ga0501202_038352 3300049652 Bacteria 1026
610 Ga0501202_038651 3300049652 Bacteria 1023
611 Ga0501206_053326 3300049653 Unclassified 649
612 Ga0501207_000863 3300049654 Bacteria 3621
613 Ga0501209_087447 3300049656 Bacteria 904
614 Ga0501209_172218 3300049656 Unclassified 658
615 Ga0501216_016508 3300049660 Bacteria 1254
616 Ga0501217_000939 3300049661 Bacteria 5223
617 Ga0501217_036195 3300049661 Bacteria 1238
618 Ga0501217_222036 3300049661 Unclassified 598
619 Ga0501223_006755 3300049663 Bacteria 2363
620 Ga0501223_038441 3300049663 Unclassified 929
621 Ga0501223_142413 3300049663 Unclassified 516
622 Ga0501224_010660 3300049664 Bacteria 1347
623 Ga0501227_003113 3300049665 Bacteria 3605
624 Ga0501227_005885 3300049665 Bacteria 2631
625 Ga0501227_069664 3300049665 Unclassified 911
626 Ga0501227_134078 3300049665 Unclassified 676
627 Ga0501230_016807 3300049667 Bacteria 1231
628 Ga0501233_013724 3300049668 Bacteria 1647
629 Ga0501233_135187 3300049668 Unclassified 677
630 Ga0501235_005733 3300049669 Bacteria 2701
631 Ga0501235_011500 3300049669 Bacteria 1942
632 Ga0501235_028152 3300049669 Bacteria 1262
633 Ga0501235_037543 3300049669 Bacteria 1102
634 Ga0501239_012469 3300049672 Unclassified 962
635 Ga0501240_031167 3300049673 Unclassified 853
636 Ga0501243_025390 3300049675 Unclassified 993
637 Ga0501249_028744 3300049679 Unclassified 1234
638 Ga0501249_109174 3300049679 Unclassified 667
639 Ga0501251_015654 3300049681 Unclassified 956
640 Ga0501255_060484 3300049684 Unclassified 600
641 Ga0501256_013058 3300049685 Unclassified 815
642 Ga0501257_005358 3300049686 Bacteria 2825
643 Ga0501257_029469 3300049686 Unclassified 1319
644 Ga0501260_002294 3300049689 Unclassified 1647
645 Ga0501261_034923 3300049690 Unclassified 773
646 Ga0501261_080054 3300049690 Unclassified 589
647 Ga0501221_020786 3300049704 Unclassified 1286
648 Ga0501225_0026570 3300049705 Bacteria 1591
649 Ga0501225_0075325 3300049705 Unclassified 963
650 Ga0501225_0138803 3300049705 Bacteria 733
651 Ga0501229_081955 3300049706 Unclassified 518
652 Ga0501234_002085 3300049707 Bacteria 3160
653 Ga0501234_013793 3300049707 Bacteria 1268
654 Ga0501234_040479 3300049707 Unclassified 762
655 Ga0501241_117227 3300049758 Unclassified 588
656 Ga0501273_048942 3300049770 Unclassified 642
657 Ga0501278_034974 3300049774 Unclassified 526
658 Ga0501280_111003 3300049776 Unclassified 536
659 Ga0501204_001827 3300049850 Bacteria 2132
660 Ga0501204_009274 3300049850 Bacteria 1134
661 Ga0501212_032949 3300049851 Bacteria 840
662 Ga0501226_011918 3300049853 Bacteria 963
663 nmdc:mga05p37_225873_c1 3300050507 Unclassified 2258
664 nmdc:mga05p37_298279_c1 3300050507 Bacteria 1916
665 nmdc:mga05p37_371752_c1 3300050507 Bacteria 1677
666 nmdc:mga05p37_948592_c1 3300050507 Bacteria 921
667 nmdc:mga09592_548995_c1 3300050508 Unclassified 992
668 nmdc:mga08y16_163270_c1 3300050511 Unclassified 2314
669 nmdc:mga08y16_6810_c1 3300050511 Bacteria 11991
670 nmdc:mga0n895_182919_c1 3300050512 Bacteria 2127
671 nmdc:mga0n895_199602_c1 3300050512 Bacteria 2032
672 nmdc:mga0n895_347977_c1 3300050512 Bacteria 1501
673 nmdc:mga0n895_540945_c1 3300050512 Bacteria 1171
674 nmdc:mga0rr50_1070197_c1 3300050513 Unclassified 686
675 nmdc:mga0rr50_242047_c1 3300050513 Bacteria 1496
676 nmdc:mga08x19_18316_c1 3300050514 Unclassified 4292
677 nmdc:mga0a205_134902_c1 3300050515 Unclassified 2369
678 nmdc:mga0a205_140199_c1 3300050515 Bacteria 2318
679 nmdc:mga0a205_307425_c1 3300050515 Bacteria 1458
680 nmdc:mga0a205_673704_c1 3300050515 Unclassified 885
681 nmdc:mga0a205_69510_c1 3300050515 Unclassified 3400
682 nmdc:mga0a205_71493_c1 3300050515 Bacteria 3351
683 Ga0207707_10667144
684 JGI24751J29686_10000017
685 JGI25406J46586_10023153
686 Ga0065712_10000804
687 Ga0065712_10024692
688 Ga0065712_10067902
689 Ga0065715_10064535
690 Ga0065715_10092791
691 Ga0065715_10120772
692 Ga0065715_10127414
693 Ga0065715_10374820
694 Ga0065715_10555770
695 Ga0065715_10805417
696 Ga0065715_10872451
697 Ga0065707_10064352
698 Ga0065707_10119732
699 Ga0065707_10562871
700 Ga0070670_100134332
701 Ga0070670_100188844
702 Ga0070670_100516237
703 Ga0070670_100771535
704 Ga0070670_101067850
705 Ga0070670_102255512
706 Ga0070677_10254100
707 Ga0068869_100040400
708 Ga0068869_100081843
709 Ga0068869_100180234
710 Ga0068869_100940768
711 Ga0068869_100943475
712 Ga0068869_101145842
713 Ga0068869_101316238
714 Ga0070682_100008678
715 Ga0070682_100638761
716 Ga0070682_102052114
717 Ga0068868_100289228
718 Ga0068868_100638476
719 Ga0070660_100624063
720 Ga0070689_100000487
721 Ga0070689_100168478
722 Ga0070689_100539202
723 Ga0070689_100859423
724 Ga0070689_101014875
725 Ga0070689_101970799
726 Ga0070691_10547251
727 Ga0070691_10602289
728 Ga0070687_100795244
729 Ga0070687_100865795
730 Ga0070692_10013846
731 Ga0070692_10042355
732 Ga0070692_10053314
733 Ga0070692_10631145
734 Ga0070692_11028590
735 Ga0070692_11357571
736 Ga0070669_100057404
737 Ga0070669_100375103
738 Ga0070669_101199032
739 Ga0070675_100701397
740 Ga0070675_101015498
741 Ga0070675_101105093
742 Ga0070673_100173447
743 Ga0070673_100865442
744 Ga0070673_102122912
745 Ga0070667_101892342
746 Ga0070703_10019606
747 Ga0070703_10418719
748 Ga0070701_10059869
749 Ga0070701_10114944
750 Ga0070701_10184185
751 Ga0070701_10903367
752 Ga0070705_100038971
753 Ga0070705_100053539
754 Ga0070705_100245427
755 Ga0070705_100421468
756 Ga0070705_101564922
757 Ga0070700_100000106
758 Ga0070700_100009921
759 Ga0070700_100749785
760 Ga0070700_101088544
761 Ga0070700_101396924
762 Ga0070700_101479210
763 Ga0070694_100004804
764 Ga0070694_100028414
765 Ga0070694_100074735
766 Ga0070694_100104655
767 Ga0070694_100266571
768 Ga0070694_100619434
769 Ga0070694_100674242
770 Ga0070694_100766797
771 Ga0070694_101007151
772 Ga0070708_100003716
773 Ga0070662_100781625
774 Ga0070681_10140368
775 Ga0070681_10721072
776 Ga0068867_100906767
777 Ga0068867_101109031
778 Ga0070706_100006829
779 Ga0070707_100568730
780 Ga0070698_100008079
781 Ga0070698_100406906
782 Ga0070699_100004780
783 Ga0070699_100021698
784 Ga0070699_100034623
785 Ga0070699_100581405
786 Ga0070699_101040555
787 Ga0070679_100667659
788 Ga0070697_100032062
789 Ga0070697_100456177
790 Ga0070697_101756665
791 Ga0068853_100241781
792 Ga0068853_101199580
793 Ga0070672_100275056
794 Ga0070672_100589028
795 Ga0070672_100811119
796 Ga0070695_100017036
797 Ga0070695_100186346
798 Ga0070695_100563958
799 Ga0070695_100636234
800 Ga0070695_100769862
801 Ga0070695_100921961
802 Ga0070696_100091298
803 Ga0070696_101780715
804 Ga0070696_101838596
805 Ga0070693_100005300
806 Ga0070693_100037456
807 Ga0070693_100751237
808 Ga0070693_101074022
809 Ga0070704_100013202
810 Ga0070704_100524819
811 Ga0070664_101406225
812 Ga0070664_101771672
813 Ga0068857_100117054
814 Ga0068857_100148457
815 Ga0068857_100419382
816 Ga0068857_100468486
817 Ga0068857_100484223
818 Ga0068857_100492461
819 Ga0068857_100742237
820 Ga0068857_101316016
821 Ga0068857_102222703
822 Ga0068854_100391553
823 Ga0068854_100541519
824 Ga0068854_100914167
825 Ga0070702_100058909
826 Ga0070702_100061384
827 Ga0070702_100888235
828 Ga0068852_100025548
829 Ga0068852_100182045
830 Ga0068852_101710069
831 Ga0068852_102429712
832 Ga0068859_100000546
833 Ga0068859_100079750
834 Ga0068859_100105270
835 Ga0068859_100114072
836 Ga0068859_100171361
837 Ga0068859_100190768
838 Ga0068859_100295312
839 Ga0068859_100396922
840 Ga0068859_100530075
841 Ga0068859_100545261
842 Ga0068859_100712840
843 Ga0068859_100743901
844 Ga0068859_100842098
845 Ga0068859_101094153
846 Ga0068859_101170212
847 Ga0068859_101835213
848 Ga0068859_102075565
849 Ga0068859_102262608
850 Ga0068864_100009488
851 Ga0068864_100288871
852 Ga0068864_100353014
853 Ga0068864_100508053
854 Ga0068864_100588583
855 Ga0068864_101174351
856 Ga0068864_101731475
857 Ga0068864_102389886
858 Ga0068866_10449047
859 Ga0068861_100470864
860 Ga0068861_100697868
861 Ga0068861_101493708
862 Ga0068870_10008899
863 Ga0068870_10262127
864 Ga0068870_10406098
865 Ga0068870_10448784
866 Ga0068870_10685333
867 Ga0068863_100061586
868 Ga0068863_100258307
869 Ga0068863_100294695
870 Ga0068863_100452171
871 Ga0068863_100474508
872 Ga0068863_100509367
873 Ga0068863_100571420
874 Ga0068863_101256605
875 Ga0068863_101638918
876 Ga0068863_101684418
877 Ga0068863_102166941
878 Ga0068858_100030984
879 Ga0068858_100046366
880 Ga0068858_100079608
881 Ga0068858_100106766
882 Ga0068858_100186420
883 Ga0068858_100384637
884 Ga0068858_100569072
885 Ga0068858_102249855
886 Ga0068860_100033327
887 Ga0068860_100045762
888 Ga0068860_100227383
889 Ga0068860_100252773
890 Ga0068860_100522734
891 Ga0068860_101475871
892 Ga0068860_101504526
893 Ga0068862_100209592
894 Ga0068862_100725742
895 Ga0068862_102510593
896 Ga0081539_10000043
897 Ga0081539_10101717
898 Ga0075432_10022168
899 Ga0070712_100736473
900 Ga0097621_100024689
901 Ga0097621_100126380
902 Ga0097621_101036173
903 Ga0068871_100000781
904 Ga0068871_100733901
905 Ga0068871_100745803
906 Ga0075428_100195622
907 Ga0075431_100430388
908 Ga0075433_10058896
909 Ga0075433_10094534
910 Ga0075433_10308997
911 Ga0075433_10325907
912 Ga0075433_10514056
913 Ga0075433_10524692
914 Ga0075434_100024472
915 Ga0075434_100040537
916 Ga0075434_100209327
917 Ga0075434_100247590
918 Ga0075434_102053110
919 Ga0075429_100978757
920 Ga0075429_101316245
921 Ga0068865_101110035
922 Ga0068865_101114623
923 Ga0075436_100066677
924 Ga0097620_100000546
925 Ga0097620_100079741
926 Ga0097620_100105277
927 Ga0097620_100114072
928 Ga0097620_100171365
929 Ga0097620_100190763
930 Ga0097620_100295320
931 Ga0097620_100396908
932 Ga0097620_100530064
933 Ga0097620_100545218
934 Ga0097620_100712856
935 Ga0097620_100743861
936 Ga0097620_100842066
937 Ga0097620_101094137
938 Ga0097620_101170208
939 Ga0097620_101835284
940 Ga0097620_102075604
941 Ga0097620_102262541
942 Ga0075435_100015569
943 Ga0075435_101133459
944 Ga0105251_10138530
945 Ga0105240_10194975
946 Ga0105240_11356381
947 Ga0105240_11574963
948 Ga0105240_12171503
949 Ga0105240_12408804
950 Ga0111539_10000627
951 Ga0111539_10128885
952 Ga0111539_11461728
953 Ga0111539_11773506
954 Ga0105245_10667086
955 Ga0105245_10992686
956 Ga0105245_11438801
957 Ga0105245_12974819
958 Ga0105247_10000592
959 Ga0105247_10061902
960 Ga0105247_10090286
961 Ga0105247_10169367
962 Ga0105247_11241927
963 Ga0114129_10160644
964 Ga0114129_10332230
965 Ga0114129_11094227
966 Ga0105243_10034114
967 Ga0105243_10034816
968 Ga0105243_10496339
969 Ga0105243_10632462
970 Ga0105243_11110079
971 Ga0105243_11188385
972 Ga0105243_11280866
973 Ga0105243_12673996
974 Ga0105241_10077327
975 Ga0105241_10233422
976 Ga0105241_10240554
977 Ga0105241_10336126
978 Ga0105241_10427424
979 Ga0105241_10521618
980 Ga0105241_10527297
981 Ga0105241_10896729
982 Ga0105241_11323154
983 Ga0105241_11502668
984 Ga0105241_11870605
985 Ga0105242_10251279
986 Ga0105248_10036913
987 Ga0105248_10081375
988 Ga0105248_10179822
989 Ga0105248_10292197
990 Ga0105248_10435011
991 Ga0105248_10507363
992 Ga0105248_10959999
993 Ga0105248_12056858
994 Ga0105237_10009719
995 Ga0105237_10035165
996 Ga0105237_10939266
997 Ga0105237_12600252
998 Ga0105238_10016298
999 Ga0105238_10170628
1000 Ga0105238_10770434
1001 Ga0105238_11555589
1002 Ga0105249_10007469
1003 Ga0105249_10432447
1004 Ga0105249_11642603
1005 Ga0105249_11785514
1006 Ga0105239_10966206
1007 Ga0105239_11068906
1008 Ga0105239_11461596
1009 Ga0105239_11874425
1010 Ga0105239_13173317
1011 Ga0105246_10041787
1012 Ga0105246_10121088
1013 Ga0105246_10194633
1014 Ga0105246_10241560
1015 Ga0105246_10438962
1016 Ga0105246_10470606
1017 Ga0105246_11928027
1018 Ga0157373_10001400
1019 Ga0157373_10095347
1020 Ga0157373_10523395
1021 Ga0157373_10557344
1022 Ga0157373_10735210
1023 Ga0157371_10990031
1024 Ga0157371_11647083
1025 Ga0157369_12462823
1026 Ga0157374_11938152
1027 Ga0157378_10070079
1028 Ga0157378_10618760
1029 Ga0157378_11170794
1030 Ga0157378_11722919
1031 Ga0157378_12222404
1032 Ga0157378_12502313
1033 Ga0163162_10124317
1034 Ga0163162_10184965
1035 Ga0163162_10223667
1036 Ga0163162_10535443
1037 Ga0163162_10656251
1038 Ga0157372_10001564
1039 Ga0157372_12994186
1040 Ga0157375_10034484
1041 Ga0157375_10653114
1042 Ga0157375_10681710
1043 Ga0157375_10952490
1044 Ga0157375_12762673
1045 Ga0163163_10000862
1046 Ga0163163_10086335
1047 Ga0163163_10151138
1048 Ga0163163_10378535
1049 Ga0163163_11316459
1050 Ga0157380_10249138
1051 Ga0157380_10597319
1052 Ga0157380_11123057
1053 Ga0157380_11464143
1054 Ga0157380_12375867
1055 Ga0157380_12521096
1056 Ga0182008_10249726
1057 Ga0157377_10120747
1058 Ga0157377_10413569
1059 Ga0157377_10415315
1060 Ga0157377_10541019
1061 Ga0157377_10705083
1062 Ga0157379_10081679
1063 Ga0157379_10295609
1064 Ga0157379_10335700
1065 Ga0157376_11871338
1066 Ga0207713_1165460
1067 Ga0207653_10010519
1068 Ga0207642_10391734
1069 Ga0207710_10001345
1070 Ga0207710_10095722
1071 Ga0207710_10152845
1072 Ga0207680_10606359
1073 Ga0207647_10000385
1074 Ga0207647_10043769
1075 Ga0207647_10097531
1076 Ga0207647_10386112
1077 Ga0207643_10000804
1078 Ga0207643_10084026
1079 Ga0207643_10328359
1080 Ga0207643_10388653
1081 Ga0207643_10577374
1082 Ga0207643_10902947
1083 Ga0207684_10186211
1084 Ga0207654_10013752
1085 Ga0207654_10749253
1086 Ga0207654_10753358
1087 Ga0207654_10773846
1088 Ga0207654_11226271
1089 Ga0207707_10550041
1090 Ga0207707_11621503
1091 Ga0207695_10108480
1092 Ga0207695_10596272
1093 Ga0207671_10002718
1094 Ga0207671_10137148
1095 Ga0207671_10733224
1096 Ga0207660_10934225
1097 Ga0207662_10110589
1098 Ga0207662_10316182
1099 Ga0207662_10494390
1100 Ga0207662_10637372
1101 Ga0207657_10510239
1102 Ga0207646_10213646
1103 Ga0207646_10452503
1104 Ga0207681_11290927
1105 Ga0207694_10013903
1106 Ga0207650_10000005
1107 Ga0207650_10077950
1108 Ga0207650_10711302
1109 Ga0207650_11429753
1110 Ga0207650_11728116
1111 Ga0207650_11899681
1112 Ga0207659_10190781
1113 Ga0207659_10479173
1114 Ga0207659_10525290
1115 Ga0207687_10929265
1116 Ga0207687_10961994
1117 Ga0207687_11318932
1118 Ga0207690_11850888
1119 Ga0207706_10184766
1120 Ga0207686_10231423
1121 Ga0207709_10002239
1122 Ga0207709_10396818
1123 Ga0207709_10725600
1124 Ga0207670_10003397
1125 Ga0207670_10156747
1126 Ga0207670_10606625
1127 Ga0207670_11387931
1128 Ga0207704_11066370
1129 Ga0207691_10192748
1130 Ga0207691_10631399
1131 Ga0207691_10908983
1132 Ga0207711_10018181
1133 Ga0207711_10028936
1134 Ga0207711_10104033
1135 Ga0207689_10030554
1136 Ga0207689_10150190
1137 Ga0207689_10301140
1138 Ga0207689_10315598
1139 Ga0207689_10424215
1140 Ga0207689_10573739
1141 Ga0207689_10838619
1142 Ga0207679_10535082
1143 Ga0207679_10959756
1144 Ga0207679_11613633
1145 Ga0207651_10090863
1146 Ga0207651_10177459
1147 Ga0207651_10554289
1148 Ga0207651_10818521
1149 Ga0207651_10839882
1150 Ga0207712_10004141
1151 Ga0207712_10409248
1152 Ga0207712_11820580
1153 Ga0207640_10193277
1154 Ga0207640_10254334
1155 Ga0207640_10502575
1156 Ga0207640_11576209
1157 Ga0207677_10237575
1158 Ga0207677_11719108
1159 Ga0207703_10029743
1160 Ga0207703_10068780
1161 Ga0207703_10230240
1162 Ga0207703_10290851
1163 Ga0207703_10359337
1164 Ga0207703_11057361
1165 Ga0207639_10835703
1166 Ga0207708_10000043
1167 Ga0207708_10003192
1168 Ga0207708_10045193
1169 Ga0207708_10065362
1170 Ga0207708_10538184
1171 Ga0207708_10657614
1172 Ga0207708_10821746
1173 Ga0207641_10060659
1174 Ga0207641_10150738
1175 Ga0207641_10168290
1176 Ga0207641_10275465
1177 Ga0207641_10344924
1178 Ga0207641_10524726
1179 Ga0207641_10766559
1180 Ga0207641_11804888
1181 Ga0207648_10252864
1182 Ga0207648_10351568
1183 Ga0207648_10354923
1184 Ga0207648_11882862
1185 Ga0207676_10063780
1186 Ga0207676_10170330
1187 Ga0207676_10176302
1188 Ga0207676_10282444
1189 Ga0207676_10529585
1190 Ga0207676_10556377
1191 Ga0207676_10781229
1192 Ga0207676_10934061
1193 Ga0207676_11042607
1194 Ga0207676_11623122
1195 Ga0207676_11924473
1196 Ga0207674_10040324
1197 Ga0207674_10075540
1198 Ga0207674_10087926
1199 Ga0207674_10141815
1200 Ga0207674_10180402
1201 Ga0207674_10297325
1202 Ga0207674_10399867
1203 Ga0207674_10412275
1204 Ga0207674_10482528
1205 Ga0207674_10782652
1206 Ga0207675_100370388
1207 Ga0207675_100524039
1208 Ga0207675_100782261
1209 Ga0207675_101098557
1210 Ga0207675_101220305
1211 Ga0207698_10091876
1212 Ga0207698_10148823
1213 Ga0207698_10706474
1214 Ga0207698_10847126
1215 Ga0207698_11773924
1216 Ga0207428_10022474
1217 Ga0268265_10168154
1218 Ga0268265_10192955
1219 Ga0268265_11381421
1220 Ga0268265_11603173
1221 Ga0268264_10120319
1222 Ga0268264_10126146
1223 Ga0268264_10128081
1224 Ga0268264_10384385
1225 Ga0268264_10943770
1226 Ga0268264_11824726
1227 Ga0268264_12297528
1228 Ga0268264_12567794
1229 Ga0307408_100055328
1230 Ga0307408_100255390
1231 Ga0307405_10017215
1232 Ga0307405_10194313
1233 Ga0307405_11648061
1234 Ga0307410_10041242
1235 Ga0307410_10180106
1236 Ga0307406_10005794
1237 Ga0307406_10452011
1238 Ga0307406_11137981
1239 Ga0307412_10506019
1240 Ga0307412_10880460
1241 Ga0307409_101509221
1242 Ga0307409_102008455
1243 Ga0307409_102131983
1244 Ga0307416_100011073
1245 Ga0307416_101377392
1246 Ga0307416_101672150
1247 Ga0307416_102254581
1248 Ga0307414_10054568
1249 Ga0307414_10347969
1250 Ga0307411_10027293
1251 Ga0307411_10109569
1252 Ga0307411_12307877
1253 Ga0307415_100042628
1254 Ga0373951_0178246
1255 Ga0373952_0060555
1256 Ga0373939_0060957
1257 Ga0373941_0167231
1258 Ga0373931_1054181
1259 Ga0395899_0285360
1260 Ga0395900_0146563
1261 Ga0395898_0817452
1262 Ga0395898_0934198
1263 Ga0395901_1054194
1264 Ga0242419_009039
1265 Ga0242422_02224
1266 Ga0242420_008256
1267 Ga0242420_134741
1268 Ga0439455_0016572
1269 Ga0450889_019863
1270 Ga0439458_0003851
1271 Ga0451577_1406032
1272 Ga0453683_0382749
1273 Ga0451576_0263226
1274 Ga0451576_0837592
1275 Ga0496106_0111858
1276 Ga0496106_0122114
1277 Ga0496112_0174187
1278 Ga0496112_1448079
1279 Ga0496113_0326606
1280 Ga0496113_0864329
1281 Ga0501290_022814
1282 Ga0501292_028408
1283 Ga0501293_015237
1284 Ga0501296_004610
1285 Ga0501296_008675
1286 Ga0501298_049668
1287 Ga0501298_094021
1288 Ga0501299_052018
1289 Ga0501198_002901
1290 Ga0501198_031234
1291 Ga0501202_038352
1292 Ga0501202_038651
1293 Ga0501206_053326
1294 Ga0501207_000863
1295 Ga0501209_087447
1296 Ga0501209_172218
1297 Ga0501216_016508
1298 Ga0501217_000939
1299 Ga0501217_036195
1300 Ga0501217_222036
1301 Ga0501223_006755
1302 Ga0501223_038441
1303 Ga0501223_142413
1304 Ga0501224_010660
1305 Ga0501227_003113
1306 Ga0501227_005885
1307 Ga0501227_069664
1308 Ga0501227_134078
1309 Ga0501230_016807
1310 Ga0501233_013724
1311 Ga0501233_135187
1312 Ga0501235_005733
1313 Ga0501235_011500
1314 Ga0501235_028152
1315 Ga0501235_037543
1316 Ga0501239_012469
1317 Ga0501240_031167
1318 Ga0501243_025390
1319 Ga0501249_028744
1320 Ga0501249_109174
1321 Ga0501251_015654
1322 Ga0501255_060484
1323 Ga0501256_013058
1324 Ga0501257_005358
1325 Ga0501257_029469
1326 Ga0501260_002294
1327 Ga0501261_034923
1328 Ga0501261_080054
1329 Ga0501221_020786
1330 Ga0501225_0026570
1331 Ga0501225_0075325
1332 Ga0501225_0138803
1333 Ga0501229_081955
1334 Ga0501234_002085
1335 Ga0501234_013793
1336 Ga0501234_040479
1337 Ga0501241_117227
1338 Ga0501273_048942
1339 Ga0501278_034974
1340 Ga0501280_111003
1341 Ga0501204_001827
1342 Ga0501204_009274
1343 Ga0501212_032949
1344 Ga0501226_011918
1345 nmdc:mga05p37_225873_c1
1346 nmdc:mga05p37_298279_c1
1347 nmdc:mga05p37_371752_c1
1348 nmdc:mga05p37_948592_c1
1349 nmdc:mga09592_548995_c1
1350 nmdc:mga08y16_163270_c1
1351 nmdc:mga08y16_6810_c1
1352 nmdc:mga0n895_182919_c1
1353 nmdc:mga0n895_199602_c1
1354 nmdc:mga0n895_347977_c1
1355 nmdc:mga0n895_540945_c1
1356 nmdc:mga0rr50_1070197_c1
1357 nmdc:mga0rr50_242047_c1
1358 nmdc:mga08x19_18316_c1
1359 nmdc:mga0a205_134902_c1
1360 nmdc:mga0a205_140199_c1
1361 nmdc:mga0a205_307425_c1
1362 nmdc:mga0a205_673704_c1
1363 nmdc:mga0a205_69510_c1
1364 nmdc:mga0a205_71493_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.9163 10 63
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.9145 10 63
7uwy-assembly1.cif.gz_A nmr solution structure of the de novo designed small beta-barrel protein 29_bp_sh3 0.8847 5 63
2x4j-assembly1.cif.gz_A crystal structure of orf137 from pyrobaculum spherical virus 0.878 14 63
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.8476 5 64
ID Description Score Start End Superfamily
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.9166 13 64 2.30.30.100
4x9dF00 Mainly Beta;Roll;SH3 type barrels.; 0.9109 10 63 2.30.30.100
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9054 15 68 2.30.30.60
af_P9WH17_92_157_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8916 7 68 2.30.30.100
af_Q2G117_134_187_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8875 14 67 2.30.30.60
ID Description Score Start End GO Terms
AF-E0I6R1-F1-model_v4 Uncharacterized protein 0.9771 2 65
AF-A0A109CBT1-F1-model_v4 deleted 0.9676 6 64
AF-A0A2V6FUC7-F1-model_v4 Uncharacterized protein 0.9623 6 66 GO:0016020
AF-A0A2V5YRM9-F1-model_v4 DUF5666 domain-containing protein 0.9593 6 65
AF-A0A1W9M2V8-F1-model_v4 Uncharacterized protein 0.956 6 68

Map