F474907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 237 | 672 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10003629|Ga0157371_100036297 |
| Length | 202 |
| Sequence | MIVCEKVSKSYPMGRGRKHVLKDVDLEIRPGEHIGFLGRNGAGKTTFIKLIGGVELATSGKIRRQMSVSWPLGFGGGFQGSLTGYDNARFIARIYIRELGPQLKMPVKTYSSGMRARLAFALSLAIEFECYLIDEVIMVGDSNFQRKCHYELFDKRGDRALIFASHSTDLIREYCNRAMVLHGGTGTMYTDINQALEIYASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 3 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 4 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 5 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 6 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 7 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 8 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 9 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 229 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 230 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 231 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 232 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 233 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 234 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 236 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 237 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.24 |
| Metatranscriptomes | 0.29 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 2.79 |
| Rhizosphere | 88.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_209976 | 2162886007 | Bacteria | 2656 |
| 2 | JGI24736J21556_1000069 | 3300001904 | Bacteria | 16830 |
| 3 | JGI24752J21851_1000086 | 3300001976 | Bacteria | 12364 |
| 4 | JGI24740J21852_10003151 | 3300001979 | Bacteria | 7278 |
| 5 | JGI24740J21852_10020269 | 3300001979 | Bacteria | 2323 |
| 6 | JGI24737J22298_10001229 | 3300001990 | Bacteria | 9037 |
| 7 | JGI24737J22298_10077900 | 3300001990 | Bacteria | 988 |
| 8 | JGI24735J21928_10001501 | 3300002067 | Bacteria | 8259 |
| 9 | Ga0065704_10000277 | 3300005289 | Bacteria | 104842 |
| 10 | Ga0065704_10073718 | 3300005289 | Bacteria | 6846 |
| 11 | Ga0065704_10090188 | 3300005289 | Bacteria | 2806 |
| 12 | Ga0065707_10085857 | 3300005295 | Bacteria | 5847 |
| 13 | Ga0065707_10092635 | 3300005295 | Bacteria | 3742 |
| 14 | Ga0070658_10002371 | 3300005327 | Bacteria | 15809 |
| 15 | Ga0070658_10003386 | 3300005327 | Bacteria | 13130 |
| 16 | Ga0070658_10008650 | 3300005327 | Bacteria | 8179 |
| 17 | Ga0070658_10009192 | 3300005327 | Bacteria | 7946 |
| 18 | Ga0070658_10016647 | 3300005327 | Bacteria | 5884 |
| 19 | Ga0070658_10033089 | 3300005327 | Bacteria | 4158 |
| 20 | Ga0070658_10092331 | 3300005327 | Bacteria | 2496 |
| 21 | Ga0070658_10163673 | 3300005327 | Bacteria | 1867 |
| 22 | Ga0070676_10116723 | 3300005328 | Bacteria | 1670 |
| 23 | Ga0070676_10121621 | 3300005328 | Unclassified | 1639 |
| 24 | Ga0070683_100003584 | 3300005329 | Bacteria | 12636 |
| 25 | Ga0070683_100010674 | 3300005329 | Bacteria | 7898 |
| 26 | Ga0070690_100004211 | 3300005330 | Bacteria | 7962 |
| 27 | Ga0070670_100000215 | 3300005331 | Bacteria | 53387 |
| 28 | Ga0070670_100167033 | 3300005331 | Bacteria | 1908 |
| 29 | Ga0070670_100169353 | 3300005331 | Bacteria | 1895 |
| 30 | Ga0070666_10005604 | 3300005335 | Bacteria | 7704 |
| 31 | Ga0070666_10013523 | 3300005335 | Bacteria | 5180 |
| 32 | Ga0070666_10020911 | 3300005335 | Bacteria | 4236 |
| 33 | Ga0070666_10026096 | 3300005335 | Bacteria | 3814 |
| 34 | Ga0070666_10073215 | 3300005335 | Bacteria | 2334 |
| 35 | Ga0070680_100000271 | 3300005336 | Bacteria | 34443 |
| 36 | Ga0070680_100184717 | 3300005336 | Bacteria | 1756 |
| 37 | Ga0070680_100269167 | 3300005336 | Bacteria | 1442 |
| 38 | Ga0070680_100541703 | 3300005336 | Bacteria | 997 |
| 39 | Ga0068868_100002030 | 3300005338 | Bacteria | 13918 |
| 40 | Ga0068868_100022820 | 3300005338 | Bacteria | 4729 |
| 41 | Ga0068868_100156144 | 3300005338 | Bacteria | 1882 |
| 42 | Ga0070660_100000883 | 3300005339 | Bacteria | 20045 |
| 43 | Ga0070660_100002324 | 3300005339 | Bacteria | 13066 |
| 44 | Ga0070660_100002881 | 3300005339 | Bacteria | 11832 |
| 45 | Ga0070660_100006448 | 3300005339 | Bacteria | 8136 |
| 46 | Ga0070660_100043823 | 3300005339 | Bacteria | 3420 |
| 47 | Ga0070660_100116309 | 3300005339 | Unclassified | 2132 |
| 48 | Ga0070660_100126519 | 3300005339 | Bacteria | 2042 |
| 49 | Ga0070660_100140029 | 3300005339 | Bacteria | 1940 |
| 50 | Ga0070660_100384335 | 3300005339 | Bacteria | 1159 |
| 51 | Ga0070660_100390546 | 3300005339 | Bacteria | 1149 |
| 52 | Ga0070660_100503957 | 3300005339 | Bacteria | 1007 |
| 53 | Ga0070691_10050964 | 3300005341 | Bacteria | 1975 |
| 54 | Ga0070661_100001010 | 3300005344 | Bacteria | 19938 |
| 55 | Ga0070661_100007206 | 3300005344 | Bacteria | 7663 |
| 56 | Ga0070661_100025661 | 3300005344 | Bacteria | 4237 |
| 57 | Ga0070661_100029372 | 3300005344 | Bacteria | 3968 |
| 58 | Ga0070661_100037618 | 3300005344 | Bacteria | 3521 |
| 59 | Ga0070661_100092981 | 3300005344 | Bacteria | 2235 |
| 60 | Ga0070661_100175315 | 3300005344 | Unclassified | 1629 |
| 61 | Ga0070668_100007830 | 3300005347 | Bacteria | 7935 |
| 62 | Ga0070669_100000039 | 3300005353 | Bacteria | 135033 |
| 63 | Ga0070669_100191322 | 3300005353 | Bacteria | 1605 |
| 64 | Ga0070671_100001504 | 3300005355 | Bacteria | 17449 |
| 65 | Ga0070671_100001971 | 3300005355 | Bacteria | 15750 |
| 66 | Ga0070671_100007512 | 3300005355 | Bacteria | 8713 |
| 67 | Ga0070671_100007581 | 3300005355 | Bacteria | 8678 |
| 68 | Ga0070671_100009223 | 3300005355 | Bacteria | 7926 |
| 69 | Ga0070671_100315756 | 3300005355 | Bacteria | 1331 |
| 70 | Ga0070674_100014847 | 3300005356 | Bacteria | 4848 |
| 71 | Ga0070674_100023869 | 3300005356 | Bacteria | 3965 |
| 72 | Ga0070674_100124350 | 3300005356 | Bacteria | 1913 |
| 73 | Ga0070673_100001803 | 3300005364 | Bacteria | 12772 |
| 74 | Ga0070673_100005453 | 3300005364 | Bacteria | 8144 |
| 75 | Ga0070673_100047642 | 3300005364 | Bacteria | 3336 |
| 76 | Ga0070673_100115036 | 3300005364 | Bacteria | 2236 |
| 77 | Ga0070673_100128862 | 3300005364 | Bacteria | 2120 |
| 78 | Ga0070673_100420972 | 3300005364 | Bacteria | 1197 |
| 79 | Ga0070659_100001788 | 3300005366 | Bacteria | 15469 |
| 80 | Ga0070659_100003421 | 3300005366 | Bacteria | 11309 |
| 81 | Ga0070659_100004990 | 3300005366 | Bacteria | 9505 |
| 82 | Ga0070659_100016215 | 3300005366 | Bacteria | 5591 |
| 83 | Ga0070659_100024439 | 3300005366 | Bacteria | 4632 |
| 84 | Ga0070659_100037487 | 3300005366 | Bacteria | 3779 |
| 85 | Ga0070659_100059584 | 3300005366 | Bacteria | 3014 |
| 86 | Ga0070659_100133576 | 3300005366 | Bacteria | 2017 |
| 87 | Ga0070659_100224515 | 3300005366 | Bacteria | 1551 |
| 88 | Ga0070659_100293781 | 3300005366 | Unclassified | 1353 |
| 89 | Ga0070659_100443507 | 3300005366 | Unclassified | 1100 |
| 90 | Ga0070667_100000311 | 3300005367 | Bacteria | 54491 |
| 91 | Ga0070667_100000719 | 3300005367 | Bacteria | 31865 |
| 92 | Ga0070709_10267657 | 3300005434 | Bacteria | 1237 |
| 93 | Ga0070714_100015990 | 3300005435 | Bacteria | 6050 |
| 94 | Ga0070714_100017633 | 3300005435 | Bacteria | 5787 |
| 95 | Ga0070714_100043916 | 3300005435 | Bacteria | 3782 |
| 96 | Ga0070714_100194819 | 3300005435 | Bacteria | 1851 |
| 97 | Ga0070713_100009084 | 3300005436 | Bacteria | 7089 |
| 98 | Ga0070713_100017413 | 3300005436 | Bacteria | 5434 |
| 99 | Ga0070711_100005496 | 3300005439 | Bacteria | 7583 |
| 100 | Ga0070663_100000485 | 3300005455 | Bacteria | 20967 |
| 101 | Ga0070663_100001726 | 3300005455 | Bacteria | 12124 |
| 102 | Ga0070663_100032754 | 3300005455 | Bacteria | 3585 |
| 103 | Ga0070663_100069410 | 3300005455 | Unclassified | 2560 |
| 104 | Ga0070678_100364920 | 3300005456 | Bacteria | 1245 |
| 105 | Ga0070678_100964548 | 3300005456 | Bacteria | 782 |
| 106 | Ga0070662_100008303 | 3300005457 | Bacteria | 6765 |
| 107 | Ga0070662_100024960 | 3300005457 | Bacteria | 4124 |
| 108 | Ga0070662_100144743 | 3300005457 | Bacteria | 1845 |
| 109 | Ga0068867_100038525 | 3300005459 | Bacteria | 3480 |
| 110 | Ga0068867_100983110 | 3300005459 | Bacteria | 764 |
| 111 | Ga0070685_10067688 | 3300005466 | Bacteria | 2107 |
| 112 | Ga0070679_100258359 | 3300005530 | Bacteria | 1697 |
| 113 | Ga0070679_100278089 | 3300005530 | Bacteria | 1627 |
| 114 | Ga0070679_100622792 | 3300005530 | Bacteria | 1022 |
| 115 | Ga0070684_100008271 | 3300005535 | Bacteria | 8132 |
| 116 | Ga0070684_100059971 | 3300005535 | Bacteria | 3327 |
| 117 | Ga0068853_100000755 | 3300005539 | Bacteria | 22437 |
| 118 | Ga0068853_100002226 | 3300005539 | Bacteria | 14500 |
| 119 | Ga0068853_100002488 | 3300005539 | Bacteria | 13807 |
| 120 | Ga0068853_100069436 | 3300005539 | Bacteria | 3065 |
| 121 | Ga0068853_100154217 | 3300005539 | Bacteria | 2069 |
| 122 | Ga0068853_100248810 | 3300005539 | Bacteria | 1630 |
| 123 | Ga0068853_100318504 | 3300005539 | Bacteria | 1441 |
| 124 | Ga0070672_100050476 | 3300005543 | Bacteria | 3240 |
| 125 | Ga0070672_100071237 | 3300005543 | Bacteria | 2764 |
| 126 | Ga0070672_100229482 | 3300005543 | Bacteria | 1559 |
| 127 | Ga0070686_100196102 | 3300005544 | Bacteria | 1444 |
| 128 | Ga0070665_100003111 | 3300005548 | Bacteria | 17877 |
| 129 | Ga0070665_100064524 | 3300005548 | Bacteria | 3673 |
| 130 | Ga0068855_100006702 | 3300005563 | Bacteria | 13973 |
| 131 | Ga0068855_100010156 | 3300005563 | Bacteria | 11347 |
| 132 | Ga0068855_100014166 | 3300005563 | Bacteria | 9607 |
| 133 | Ga0068855_100017947 | 3300005563 | Bacteria | 8503 |
| 134 | Ga0068855_100018598 | 3300005563 | Bacteria | 8357 |
| 135 | Ga0068855_100029847 | 3300005563 | Bacteria | 6520 |
| 136 | Ga0068855_100050067 | 3300005563 | Plasmid | 4924 |
| 137 | Ga0068855_100112216 | 3300005563 | Unclassified | 3128 |
| 138 | Ga0068855_100164447 | 3300005563 | Bacteria | 2516 |
| 139 | Ga0068855_100212465 | 3300005563 | Bacteria | 2173 |
| 140 | Ga0070664_100022088 | 3300005564 | Bacteria | 5247 |
| 141 | Ga0070664_100059697 | 3300005564 | Bacteria | 3245 |
| 142 | Ga0068857_100000856 | 3300005577 | Bacteria | 22822 |
| 143 | Ga0068857_100010170 | 3300005577 | Bacteria | 8179 |
| 144 | Ga0068857_100012150 | 3300005577 | Bacteria | 7490 |
| 145 | Ga0068857_100190028 | 3300005577 | Bacteria | 1870 |
| 146 | Ga0068854_100001288 | 3300005578 | Bacteria | 15095 |
| 147 | Ga0068854_100001536 | 3300005578 | Bacteria | 14009 |
| 148 | Ga0068854_100003540 | 3300005578 | Bacteria | 9761 |
| 149 | Ga0068854_100009272 | 3300005578 | Bacteria | 6351 |
| 150 | Ga0068854_100009525 | 3300005578 | Bacteria | 6271 |
| 151 | Ga0068854_100020148 | 3300005578 | Bacteria | 4507 |
| 152 | Ga0068854_100060809 | 3300005578 | Bacteria | 2734 |
| 153 | Ga0068854_100100547 | 3300005578 | Unclassified | 2167 |
| 154 | Ga0068854_100205013 | 3300005578 | Bacteria | 1552 |
| 155 | Ga0068854_100313945 | 3300005578 | Bacteria | 1272 |
| 156 | Ga0068856_100009429 | 3300005614 | Bacteria | 9477 |
| 157 | Ga0068856_100010950 | 3300005614 | Bacteria | 8802 |
| 158 | Ga0068856_100020465 | 3300005614 | Bacteria | 6427 |
| 159 | Ga0068856_100031496 | 3300005614 | Bacteria | 5189 |
| 160 | Ga0068856_100103740 | 3300005614 | Unclassified | 2837 |
| 161 | Ga0068856_100326405 | 3300005614 | Bacteria | 1552 |
| 162 | Ga0068856_100677498 | 3300005614 | Bacteria | 1052 |
| 163 | Ga0068852_100000868 | 3300005616 | Bacteria | 20021 |
| 164 | Ga0068852_100003221 | 3300005616 | Bacteria | 11400 |
| 165 | Ga0068852_100005448 | 3300005616 | Bacteria | 9100 |
| 166 | Ga0068852_100013235 | 3300005616 | Bacteria | 6306 |
| 167 | Ga0068852_100016397 | 3300005616 | Bacteria | 5775 |
| 168 | Ga0068852_100068911 | 3300005616 | Bacteria | 3098 |
| 169 | Ga0068852_100094533 | 3300005616 | Bacteria | 2682 |
| 170 | Ga0068852_100098578 | 3300005616 | Bacteria | 2632 |
| 171 | Ga0068852_100194699 | 3300005616 | Bacteria | 1915 |
| 172 | Ga0068852_100317230 | 3300005616 | Bacteria | 1513 |
| 173 | Ga0068852_100317852 | 3300005616 | Bacteria | 1511 |
| 174 | Ga0068852_100327642 | 3300005616 | Bacteria | 1489 |
| 175 | Ga0068852_100403149 | 3300005616 | Bacteria | 1346 |
| 176 | Ga0068852_100485478 | 3300005616 | Unclassified | 1228 |
| 177 | Ga0068852_100513864 | 3300005616 | Bacteria | 1194 |
| 178 | Ga0068864_100000080 | 3300005618 | Bacteria | 102508 |
| 179 | Ga0068851_10042741 | 3300005834 | Bacteria | 2282 |
| 180 | Ga0068851_10162574 | 3300005834 | Bacteria | 1227 |
| 181 | Ga0068851_10215259 | 3300005834 | Bacteria | 1077 |
| 182 | Ga0068863_100000087 | 3300005841 | Bacteria | 102508 |
| 183 | Ga0068858_100034153 | 3300005842 | Bacteria | 4717 |
| 184 | Ga0068858_100472075 | 3300005842 | Bacteria | 1210 |
| 185 | Ga0068860_100029152 | 3300005843 | Bacteria | 5309 |
| 186 | Ga0068860_100393568 | 3300005843 | Bacteria | 1370 |
| 187 | Ga0068862_100000101 | 3300005844 | Bacteria | 102508 |
| 188 | Ga0068862_100032334 | 3300005844 | Bacteria | 4420 |
| 189 | Ga0075364_10089606 | 3300006051 | Bacteria | 2040 |
| 190 | Ga0075364_10400652 | 3300006051 | Bacteria | 936 |
| 191 | Ga0070712_100050193 | 3300006175 | Bacteria | 2901 |
| 192 | Ga0097621_100012206 | 3300006237 | Bacteria | 6357 |
| 193 | Ga0068871_100001517 | 3300006358 | Bacteria | 15555 |
| 194 | Ga0068871_100106748 | 3300006358 | Bacteria | 2351 |
| 195 | Ga0075429_100027480 | 3300006880 | Bacteria | 4939 |
| 196 | Ga0105251_10000248 | 3300009011 | Bacteria | 54567 |
| 197 | Ga0105251_10013886 | 3300009011 | Bacteria | 4480 |
| 198 | Ga0105250_10000748 | 3300009092 | Bacteria | 19742 |
| 199 | Ga0105250_10006791 | 3300009092 | Bacteria | 4970 |
| 200 | Ga0105240_10004406 | 3300009093 | Bacteria | 21474 |
| 201 | Ga0105240_10010132 | 3300009093 | Bacteria | 13268 |
| 202 | Ga0105240_10013114 | 3300009093 | Bacteria | 11404 |
| 203 | Ga0105240_10052477 | 3300009093 | Bacteria | 5125 |
| 204 | Ga0105240_10101719 | 3300009093 | Bacteria | 3494 |
| 205 | Ga0105240_10391088 | 3300009093 | Bacteria | 1568 |
| 206 | Ga0105240_10431847 | 3300009093 | Bacteria | 1478 |
| 207 | Ga0111539_10079611 | 3300009094 | Bacteria | 3855 |
| 208 | Ga0105245_10640480 | 3300009098 | Bacteria | 1092 |
| 209 | Ga0105243_10517388 | 3300009148 | Bacteria | 1134 |
| 210 | Ga0105241_10203413 | 3300009174 | Bacteria | 1655 |
| 211 | Ga0105248_10001316 | 3300009177 | Bacteria | 27684 |
| 212 | Ga0105248_10002296 | 3300009177 | Bacteria | 21166 |
| 213 | Ga0105248_10462855 | 3300009177 | Bacteria | 1429 |
| 214 | Ga0105237_10009761 | 3300009545 | Bacteria | 10267 |
| 215 | Ga0105237_10118442 | 3300009545 | Unclassified | 2642 |
| 216 | Ga0105237_10140536 | 3300009545 | Bacteria | 2409 |
| 217 | Ga0105238_10005484 | 3300009551 | Bacteria | 12532 |
| 218 | Ga0105238_10015201 | 3300009551 | Bacteria | 7794 |
| 219 | Ga0105238_10028914 | 3300009551 | Bacteria | 5646 |
| 220 | Ga0105249_10000024 | 3300009553 | Bacteria | 232947 |
| 221 | Ga0099796_10009055 | 3300010159 | Bacteria | 2679 |
| 222 | Ga0105239_10054386 | 3300010375 | Bacteria | 4391 |
| 223 | Ga0157373_10001108 | 3300013100 | Bacteria | 20667 |
| 224 | Ga0157373_10001147 | 3300013100 | Bacteria | 20292 |
| 225 | Ga0157373_10005029 | 3300013100 | Bacteria | 9931 |
| 226 | Ga0157373_10011635 | 3300013100 | Bacteria | 6464 |
| 227 | Ga0157373_10044617 | 3300013100 | Bacteria | 3165 |
| 228 | Ga0157371_10002246 | 3300013102 | Bacteria | 18652 |
| 229 | Ga0157371_10003592 | 3300013102 | Bacteria | 13972 |
| 230 | Ga0157371_10003629 | 3300013102 | Bacteria | 13896 |
| 231 | Ga0157371_10007364 | 3300013102 | Bacteria | 8919 |
| 232 | Ga0157371_10013147 | 3300013102 | Bacteria | 6301 |
| 233 | Ga0157371_10026267 | 3300013102 | Bacteria | 4234 |
| 234 | Ga0157371_10040325 | 3300013102 | Bacteria | 3335 |
| 235 | Ga0157371_10070695 | 3300013102 | Bacteria | 2471 |
| 236 | Ga0157371_10147044 | 3300013102 | Bacteria | 1679 |
| 237 | Ga0157371_10466350 | 3300013102 | Bacteria | 930 |
| 238 | Ga0157370_10001164 | 3300013104 | Bacteria | 32793 |
| 239 | Ga0157370_10005590 | 3300013104 | Bacteria | 14081 |
| 240 | Ga0157370_10013290 | 3300013104 | Bacteria | 8484 |
| 241 | Ga0157370_10014274 | 3300013104 | Bacteria | 8131 |
| 242 | Ga0157370_10019835 | 3300013104 | Bacteria | 6728 |
| 243 | Ga0157370_10026941 | 3300013104 | Bacteria | 5669 |
| 244 | Ga0157370_10053269 | 3300013104 | Plasmid | 3859 |
| 245 | Ga0157370_10068120 | 3300013104 | Bacteria | 3364 |
| 246 | Ga0157370_10135175 | 3300013104 | Bacteria | 2299 |
| 247 | Ga0157370_10170694 | 3300013104 | Bacteria | 2022 |
| 248 | Ga0157369_10001780 | 3300013105 | Bacteria | 26094 |
| 249 | Ga0157369_10001785 | 3300013105 | Bacteria | 26034 |
| 250 | Ga0157369_10005452 | 3300013105 | Bacteria | 14796 |
| 251 | Ga0157369_10007104 | 3300013105 | Bacteria | 12913 |
| 252 | Ga0157369_10010023 | 3300013105 | Bacteria | 10823 |
| 253 | Ga0157369_10015692 | 3300013105 | Bacteria | 8536 |
| 254 | Ga0157369_10015860 | 3300013105 | Bacteria | 8484 |
| 255 | Ga0157369_10025891 | 3300013105 | Bacteria | 6508 |
| 256 | Ga0157369_10037455 | 3300013105 | Bacteria | 5310 |
| 257 | Ga0157369_10054658 | 3300013105 | Bacteria | 4311 |
| 258 | Ga0157374_10004052 | 3300013296 | Bacteria | 12310 |
| 259 | Ga0157374_10012763 | 3300013296 | Bacteria | 7320 |
| 260 | Ga0157374_10091224 | 3300013296 | Bacteria | 2905 |
| 261 | Ga0157378_10004743 | 3300013297 | Bacteria | 11917 |
| 262 | Ga0157378_10006970 | 3300013297 | Bacteria | 9857 |
| 263 | Ga0157378_11168367 | 3300013297 | Bacteria | 808 |
| 264 | Ga0163162_10029816 | 3300013306 | Bacteria | 5401 |
| 265 | Ga0163162_10071299 | 3300013306 | Bacteria | 3527 |
| 266 | Ga0163162_10542209 | 3300013306 | Bacteria | 1292 |
| 267 | Ga0157372_10001545 | 3300013307 | Bacteria | 25066 |
| 268 | Ga0157372_10002393 | 3300013307 | Bacteria | 20313 |
| 269 | Ga0157372_10007486 | 3300013307 | Bacteria | 11609 |
| 270 | Ga0157372_10060097 | 3300013307 | Bacteria | 4252 |
| 271 | Ga0157372_10091507 | 3300013307 | Bacteria | 3459 |
| 272 | Ga0157372_10242097 | 3300013307 | Unclassified | 2093 |
| 273 | Ga0157372_10405748 | 3300013307 | Bacteria | 1588 |
| 274 | Ga0157372_10889359 | 3300013307 | Bacteria | 1033 |
| 275 | Ga0157375_10026420 | 3300013308 | Bacteria | 5410 |
| 276 | Ga0163163_10052244 | 3300014325 | Bacteria | 4031 |
| 277 | Ga0157379_10033358 | 3300014968 | Bacteria | 4591 |
| 278 | Ga0157379_10059439 | 3300014968 | Bacteria | 3418 |
| 279 | Ga0157379_10076747 | 3300014968 | Bacteria | 2992 |
| 280 | Ga0157379_10115571 | 3300014968 | Bacteria | 2412 |
| 281 | Ga0157379_10313915 | 3300014968 | Bacteria | 1430 |
| 282 | Ga0224712_10125287 | 3300022467 | Bacteria | 1116 |
| 283 | Ga0209674_107553 | 3300025226 | Bacteria | 1362 |
| 284 | Ga0209646_1002515 | 3300025246 | Bacteria | 4015 |
| 285 | Ga0209677_104671 | 3300025253 | Bacteria | 3866 |
| 286 | Ga0207656_10001317 | 3300025321 | Bacteria | 8172 |
| 287 | Ga0207656_10166279 | 3300025321 | Bacteria | 1052 |
| 288 | Ga0207696_1001183 | 3300025711 | Bacteria | 14868 |
| 289 | Ga0207696_1005967 | 3300025711 | Bacteria | 4974 |
| 290 | Ga0207713_1001574 | 3300025735 | Bacteria | 17889 |
| 291 | Ga0207713_1002972 | 3300025735 | Bacteria | 11847 |
| 292 | Ga0207713_1004528 | 3300025735 | Bacteria | 8998 |
| 293 | Ga0207680_10020201 | 3300025903 | Bacteria | 3579 |
| 294 | Ga0207680_10042236 | 3300025903 | Bacteria | 2666 |
| 295 | Ga0207680_10042436 | 3300025903 | Bacteria | 2661 |
| 296 | Ga0207680_10121902 | 3300025903 | Bacteria | 1706 |
| 297 | Ga0207680_10589050 | 3300025903 | Unclassified | 795 |
| 298 | Ga0207647_10000533 | 3300025904 | Bacteria | 30383 |
| 299 | Ga0207647_10001255 | 3300025904 | Bacteria | 19519 |
| 300 | Ga0207647_10001287 | 3300025904 | Bacteria | 19279 |
| 301 | Ga0207647_10004812 | 3300025904 | Bacteria | 9990 |
| 302 | Ga0207647_10009302 | 3300025904 | Bacteria | 6986 |
| 303 | Ga0207647_10034680 | 3300025904 | Bacteria | 3219 |
| 304 | Ga0207647_10073308 | 3300025904 | Bacteria | 2063 |
| 305 | Ga0207699_10055032 | 3300025906 | Bacteria | 2366 |
| 306 | Ga0207699_10075082 | 3300025906 | Bacteria | 2078 |
| 307 | Ga0207645_10099008 | 3300025907 | Bacteria | 1880 |
| 308 | Ga0207705_10000183 | 3300025909 | Bacteria | 65457 |
| 309 | Ga0207705_10003164 | 3300025909 | Bacteria | 12524 |
| 310 | Ga0207705_10005143 | 3300025909 | Bacteria | 9805 |
| 311 | Ga0207705_10006347 | 3300025909 | Bacteria | 8771 |
| 312 | Ga0207705_10014072 | 3300025909 | Bacteria | 5764 |
| 313 | Ga0207705_10016263 | 3300025909 | Bacteria | 5335 |
| 314 | Ga0207705_10021461 | 3300025909 | Bacteria | 4609 |
| 315 | Ga0207705_10024673 | 3300025909 | Plasmid | 4290 |
| 316 | Ga0207705_10039743 | 3300025909 | Bacteria | 3372 |
| 317 | Ga0207705_10068819 | 3300025909 | Unclassified | 2564 |
| 318 | Ga0207705_10126101 | 3300025909 | Bacteria | 1903 |
| 319 | Ga0207695_10007371 | 3300025913 | Bacteria | 14036 |
| 320 | Ga0207695_10009491 | 3300025913 | Bacteria | 12032 |
| 321 | Ga0207695_10009677 | 3300025913 | Bacteria | 11872 |
| 322 | Ga0207695_10073646 | 3300025913 | Bacteria | 3479 |
| 323 | Ga0207695_10540722 | 3300025913 | Bacteria | 1046 |
| 324 | Ga0207671_10066875 | 3300025914 | Unclassified | 2675 |
| 325 | Ga0207671_10477718 | 3300025914 | Bacteria | 993 |
| 326 | Ga0207693_10024751 | 3300025915 | Bacteria | 4760 |
| 327 | Ga0207660_10000226 | 3300025917 | Bacteria | 36360 |
| 328 | Ga0207660_10259849 | 3300025917 | Bacteria | 1373 |
| 329 | Ga0207660_10478004 | 3300025917 | Bacteria | 1009 |
| 330 | Ga0207660_10639778 | 3300025917 | Bacteria | 867 |
| 331 | Ga0207657_10000783 | 3300025919 | Bacteria | 33822 |
| 332 | Ga0207657_10005227 | 3300025919 | Bacteria | 13596 |
| 333 | Ga0207657_10006755 | 3300025919 | Bacteria | 11853 |
| 334 | Ga0207657_10010296 | 3300025919 | Bacteria | 9336 |
| 335 | Ga0207657_10010572 | 3300025919 | Bacteria | 9203 |
| 336 | Ga0207657_10027322 | 3300025919 | Bacteria | 5227 |
| 337 | Ga0207657_10117272 | 3300025919 | Unclassified | 2193 |
| 338 | Ga0207657_10308190 | 3300025919 | Bacteria | 1253 |
| 339 | Ga0207657_10365857 | 3300025919 | Bacteria | 1136 |
| 340 | Ga0207657_10414281 | 3300025919 | Bacteria | 1059 |
| 341 | Ga0207657_10424743 | 3300025919 | Bacteria | 1044 |
| 342 | Ga0207657_10451695 | 3300025919 | Bacteria | 1008 |
| 343 | Ga0207649_10001886 | 3300025920 | Bacteria | 11958 |
| 344 | Ga0207649_10002637 | 3300025920 | Bacteria | 9959 |
| 345 | Ga0207649_10137033 | 3300025920 | Bacteria | 1670 |
| 346 | Ga0207649_10456364 | 3300025920 | Bacteria | 965 |
| 347 | Ga0207652_10332398 | 3300025921 | Bacteria | 1372 |
| 348 | Ga0207681_10000144 | 3300025923 | Bacteria | 59200 |
| 349 | Ga0207681_10178111 | 3300025923 | Bacteria | 1617 |
| 350 | Ga0207694_10023835 | 3300025924 | Bacteria | 4647 |
| 351 | Ga0207694_10072118 | 3300025924 | Bacteria | 2700 |
| 352 | Ga0207694_10349244 | 3300025924 | Unclassified | 1224 |
| 353 | Ga0207650_10000261 | 3300025925 | Bacteria | 56610 |
| 354 | Ga0207650_10086559 | 3300025925 | Bacteria | 2386 |
| 355 | Ga0207650_10343460 | 3300025925 | Bacteria | 1226 |
| 356 | Ga0207650_10404487 | 3300025925 | Bacteria | 1130 |
| 357 | Ga0207700_10131690 | 3300025928 | Bacteria | 2042 |
| 358 | Ga0207664_10019747 | 3300025929 | Bacteria | 4988 |
| 359 | Ga0207644_10000640 | 3300025931 | Bacteria | 22180 |
| 360 | Ga0207644_10001358 | 3300025931 | Bacteria | 15739 |
| 361 | Ga0207644_10001973 | 3300025931 | Bacteria | 13264 |
| 362 | Ga0207644_10002363 | 3300025931 | Bacteria | 12182 |
| 363 | Ga0207690_10001590 | 3300025932 | Bacteria | 14187 |
| 364 | Ga0207690_10012337 | 3300025932 | Bacteria | 5113 |
| 365 | Ga0207690_10017889 | 3300025932 | Bacteria | 4337 |
| 366 | Ga0207690_10029935 | 3300025932 | Bacteria | 3466 |
| 367 | Ga0207690_10053419 | 3300025932 | Bacteria | 2711 |
| 368 | Ga0207690_10086578 | 3300025932 | Bacteria | 2202 |
| 369 | Ga0207690_10093288 | 3300025932 | Bacteria | 2133 |
| 370 | Ga0207690_10216335 | 3300025932 | Bacteria | 1464 |
| 371 | Ga0207690_10250873 | 3300025932 | Unclassified | 1367 |
| 372 | Ga0207706_10002940 | 3300025933 | Bacteria | 16464 |
| 373 | Ga0207706_10014667 | 3300025933 | Bacteria | 7096 |
| 374 | Ga0207706_10037255 | 3300025933 | Bacteria | 4319 |
| 375 | Ga0207706_10216527 | 3300025933 | Bacteria | 1678 |
| 376 | Ga0207706_10339361 | 3300025933 | Bacteria | 1307 |
| 377 | Ga0207706_10429320 | 3300025933 | Bacteria | 1144 |
| 378 | Ga0207706_10646154 | 3300025933 | Bacteria | 906 |
| 379 | Ga0207706_10716967 | 3300025933 | Bacteria | 854 |
| 380 | Ga0207669_10000155 | 3300025937 | Bacteria | 32382 |
| 381 | Ga0207669_10027134 | 3300025937 | Bacteria | 3129 |
| 382 | Ga0207669_10033144 | 3300025937 | Bacteria | 2911 |
| 383 | Ga0207711_10000943 | 3300025941 | Bacteria | 27943 |
| 384 | Ga0207711_10627136 | 3300025941 | Bacteria | 1003 |
| 385 | Ga0207711_10848837 | 3300025941 | Bacteria | 850 |
| 386 | Ga0207661_10164582 | 3300025944 | Bacteria | 1926 |
| 387 | Ga0207679_10005401 | 3300025945 | Bacteria | 8005 |
| 388 | Ga0207679_10109470 | 3300025945 | Bacteria | 2177 |
| 389 | Ga0207667_10004992 | 3300025949 | Bacteria | 16207 |
| 390 | Ga0207667_10011952 | 3300025949 | Bacteria | 10051 |
| 391 | Ga0207667_10013439 | 3300025949 | Bacteria | 9369 |
| 392 | Ga0207667_10019030 | 3300025949 | Bacteria | 7676 |
| 393 | Ga0207667_10019463 | 3300025949 | Bacteria | 7578 |
| 394 | Ga0207667_10024535 | 3300025949 | Bacteria | 6619 |
| 395 | Ga0207667_10025101 | 3300025949 | Bacteria | 6532 |
| 396 | Ga0207667_10038970 | 3300025949 | Bacteria | 5067 |
| 397 | Ga0207651_10001400 | 3300025960 | Bacteria | 10943 |
| 398 | Ga0207651_10227381 | 3300025960 | Bacteria | 1512 |
| 399 | Ga0207712_10000034 | 3300025961 | Bacteria | 202320 |
| 400 | Ga0207668_10062973 | 3300025972 | Bacteria | 2614 |
| 401 | Ga0207640_10000484 | 3300025981 | Bacteria | 24196 |
| 402 | Ga0207640_10000660 | 3300025981 | Bacteria | 20197 |
| 403 | Ga0207640_10001733 | 3300025981 | Bacteria | 11708 |
| 404 | Ga0207640_10002573 | 3300025981 | Bacteria | 9724 |
| 405 | Ga0207640_10007730 | 3300025981 | Bacteria | 5941 |
| 406 | Ga0207640_10013483 | 3300025981 | Bacteria | 4687 |
| 407 | Ga0207640_10018957 | 3300025981 | Plasmid | 4054 |
| 408 | Ga0207640_10086643 | 3300025981 | Unclassified | 2157 |
| 409 | Ga0207640_10155331 | 3300025981 | Bacteria | 1686 |
| 410 | Ga0207658_10000216 | 3300025986 | Bacteria | 60563 |
| 411 | Ga0207658_10000239 | 3300025986 | Bacteria | 57662 |
| 412 | Ga0207703_10280398 | 3300026035 | Bacteria | 1513 |
| 413 | Ga0207639_10000621 | 3300026041 | Bacteria | 24436 |
| 414 | Ga0207639_10000721 | 3300026041 | Bacteria | 22595 |
| 415 | Ga0207639_10000839 | 3300026041 | Bacteria | 20858 |
| 416 | Ga0207639_10161603 | 3300026041 | Bacteria | 1888 |
| 417 | Ga0207639_10180422 | 3300026041 | Bacteria | 1796 |
| 418 | Ga0207639_10535474 | 3300026041 | Bacteria | 1074 |
| 419 | Ga0207678_10001376 | 3300026067 | Bacteria | 22393 |
| 420 | Ga0207678_10035183 | 3300026067 | Bacteria | 4361 |
| 421 | Ga0207678_10098127 | 3300026067 | Plasmid | 2503 |
| 422 | Ga0207678_10267213 | 3300026067 | Bacteria | 1466 |
| 423 | Ga0207702_10006922 | 3300026078 | Bacteria | 9711 |
| 424 | Ga0207702_10007750 | 3300026078 | Bacteria | 9119 |
| 425 | Ga0207702_10011419 | 3300026078 | Bacteria | 7404 |
| 426 | Ga0207702_10027294 | 3300026078 | Bacteria | 4741 |
| 427 | Ga0207702_10273248 | 3300026078 | Bacteria | 1595 |
| 428 | Ga0207648_10118145 | 3300026089 | Bacteria | 2330 |
| 429 | Ga0207676_10000036 | 3300026095 | Bacteria | 198447 |
| 430 | Ga0207674_10001997 | 3300026116 | Bacteria | 25875 |
| 431 | Ga0207674_10015692 | 3300026116 | Bacteria | 8313 |
| 432 | Ga0207674_10034227 | 3300026116 | Bacteria | 5314 |
| 433 | Ga0207683_10375251 | 3300026121 | Bacteria | 1307 |
| 434 | Ga0207698_10000814 | 3300026142 | Bacteria | 18122 |
| 435 | Ga0207698_10001384 | 3300026142 | Bacteria | 14102 |
| 436 | Ga0207698_10012925 | 3300026142 | Bacteria | 5487 |
| 437 | Ga0207698_10023612 | 3300026142 | Plasmid | 4299 |
| 438 | Ga0207698_10025849 | 3300026142 | Bacteria | 4144 |
| 439 | Ga0207698_10192973 | 3300026142 | Bacteria | 1816 |
| 440 | Ga0207698_10230474 | 3300026142 | Bacteria | 1681 |
| 441 | Ga0207698_10249883 | 3300026142 | Bacteria | 1622 |
| 442 | Ga0207698_10276123 | 3300026142 | Bacteria | 1552 |
| 443 | Ga0207698_10287481 | 3300026142 | Bacteria | 1524 |
| 444 | Ga0207698_10349043 | 3300026142 | Unclassified | 1397 |
| 445 | Ga0207698_10352644 | 3300026142 | Bacteria | 1390 |
| 446 | Ga0268266_10001825 | 3300028379 | Bacteria | 24081 |
| 447 | Ga0268266_10047375 | 3300028379 | Bacteria | 3682 |
| 448 | Ga0268265_10000059 | 3300028380 | Bacteria | 152531 |
| 449 | Ga0268265_10516327 | 3300028380 | Bacteria | 1128 |
| 450 | Ga0268264_10018435 | 3300028381 | Bacteria | 5708 |
| 451 | Ga0268264_10369870 | 3300028381 | Bacteria | 1370 |
| 452 | Ga0307408_100003693 | 3300031548 | Bacteria | 10423 |
| 453 | Ga0307408_100032581 | 3300031548 | Bacteria | 3634 |
| 454 | Ga0307408_100104155 | 3300031548 | Bacteria | 2167 |
| 455 | Ga0307408_100392564 | 3300031548 | Bacteria | 1189 |
| 456 | Ga0307408_100754635 | 3300031548 | Bacteria | 879 |
| 457 | Ga0307405_10000174 | 3300031731 | Bacteria | 23496 |
| 458 | Ga0307405_10001858 | 3300031731 | Bacteria | 9063 |
| 459 | Ga0307405_10001976 | 3300031731 | Bacteria | 8865 |
| 460 | Ga0307413_10012203 | 3300031824 | Bacteria | 4267 |
| 461 | Ga0307410_10007381 | 3300031852 | Bacteria | 6015 |
| 462 | Ga0307410_10053954 | 3300031852 | Bacteria | 2722 |
| 463 | Ga0307406_10004487 | 3300031901 | Bacteria | 7600 |
| 464 | Ga0307406_10007389 | 3300031901 | Bacteria | 6090 |
| 465 | Ga0307406_10109431 | 3300031901 | Unclassified | 1899 |
| 466 | Ga0307407_10014063 | 3300031903 | Bacteria | 3906 |
| 467 | Ga0307412_10000500 | 3300031911 | Bacteria | 23370 |
| 468 | Ga0307412_10003675 | 3300031911 | Bacteria | 8521 |
| 469 | Ga0307412_10006740 | 3300031911 | Bacteria | 6510 |
| 470 | Ga0307412_10085419 | 3300031911 | Unclassified | 2193 |
| 471 | Ga0307409_100004973 | 3300031995 | Bacteria | 7566 |
| 472 | Ga0307409_100012521 | 3300031995 | Bacteria | 5410 |
| 473 | Ga0307409_100056801 | 3300031995 | Bacteria | 3029 |
| 474 | Ga0307416_100004298 | 3300032002 | Bacteria | 8554 |
| 475 | Ga0307416_100032322 | 3300032002 | Bacteria | 3952 |
| 476 | Ga0307416_100087623 | 3300032002 | Bacteria | 2658 |
| 477 | Ga0307414_10000935 | 3300032004 | Bacteria | 14921 |
| 478 | Ga0307414_10065845 | 3300032004 | Bacteria | 2587 |
| 479 | Ga0307411_10010420 | 3300032005 | Bacteria | 4955 |
| 480 | Ga0307411_10026299 | 3300032005 | Bacteria | 3503 |
| 481 | Ga0307411_10079588 | 3300032005 | Bacteria | 2251 |
| 482 | Ga0307411_10372986 | 3300032005 | Bacteria | 1171 |
| 483 | Ga0307415_100022584 | 3300032126 | Bacteria | 3886 |
| 484 | Ga0307415_100074490 | 3300032126 | Bacteria | 2399 |
| 485 | Ga0307415_100288666 | 3300032126 | Bacteria | 1353 |
| 486 | Ga0307415_100589085 | 3300032126 | Bacteria | 988 |
| 487 | Ga0307510_10020209 | 3300033180 | Bacteria | 7789 |
| 488 | Ga0373946_0041007 | 3300035171 | Bacteria | 1897 |
| 489 | Ga0373947_0031262 | 3300035725 | Bacteria | 3132 |
| 490 | Ga0373925_0034706 | 3300037068 | Bacteria | 3719 |
| 491 | Ga0395899_0000931 | 3300037312 | Bacteria | 27577 |
| 492 | Ga0395899_0002700 | 3300037312 | Bacteria | 14310 |
| 493 | Ga0395899_0007403 | 3300037312 | Bacteria | 8483 |
| 494 | Ga0395899_0009872 | 3300037312 | Bacteria | 7320 |
| 495 | Ga0395899_0014455 | 3300037312 | Bacteria | 6025 |
| 496 | Ga0395899_0019600 | 3300037312 | Bacteria | 5135 |
| 497 | Ga0395899_0030693 | 3300037312 | Bacteria | 4041 |
| 498 | Ga0395899_0037168 | 3300037312 | Plasmid | 3651 |
| 499 | Ga0395899_0066777 | 3300037312 | Bacteria | 2640 |
| 500 | Ga0395899_0074654 | 3300037312 | Bacteria | 2477 |
| 501 | Ga0395899_0120433 | 3300037312 | Unclassified | 1880 |
| 502 | Ga0395900_0001129 | 3300037418 | Bacteria | 33757 |
| 503 | Ga0395900_0007480 | 3300037418 | Bacteria | 11286 |
| 504 | Ga0395900_0010107 | 3300037418 | Bacteria | 9650 |
| 505 | Ga0395900_0010785 | 3300037418 | Bacteria | 9348 |
| 506 | Ga0395900_0012806 | 3300037418 | Bacteria | 8573 |
| 507 | Ga0395900_0029934 | 3300037418 | Bacteria | 5587 |
| 508 | Ga0395900_0052238 | 3300037418 | Plasmid | 4207 |
| 509 | Ga0395900_0062174 | 3300037418 | Bacteria | 3838 |
| 510 | Ga0395900_0067773 | 3300037418 | Plasmid | 3666 |
| 511 | Ga0395900_0093843 | 3300037418 | Unclassified | 3082 |
| 512 | Ga0395900_0100262 | 3300037418 | Bacteria | 2975 |
| 513 | Ga0395900_0131136 | 3300037418 | Bacteria | 2569 |
| 514 | Ga0395900_0189883 | 3300037418 | Bacteria | 2084 |
| 515 | Ga0395900_0431123 | 3300037418 | Bacteria | 1277 |
| 516 | Ga0395900_0457429 | 3300037418 | Bacteria | 1232 |
| 517 | Ga0395898_0001152 | 3300037466 | Bacteria | 40373 |
| 518 | Ga0395898_0001704 | 3300037466 | Bacteria | 29248 |
| 519 | Ga0395898_0009910 | 3300037466 | Bacteria | 9982 |
| 520 | Ga0395898_0045237 | 3300037466 | Bacteria | 4327 |
| 521 | Ga0395898_0093909 | 3300037466 | Bacteria | 2882 |
| 522 | Ga0395898_0101651 | 3300037466 | Bacteria | 2760 |
| 523 | Ga0395898_0102378 | 3300037466 | Unclassified | 2749 |
| 524 | Ga0395898_0515742 | 3300037466 | Unclassified | 1137 |
| 525 | Ga0395905_0001384 | 3300037471 | Bacteria | 29378 |
| 526 | Ga0395905_0002955 | 3300037471 | Bacteria | 18464 |
| 527 | Ga0395905_0006991 | 3300037471 | Bacteria | 11280 |
| 528 | Ga0395905_0007880 | 3300037471 | Bacteria | 10545 |
| 529 | Ga0395905_0013174 | 3300037471 | Bacteria | 7936 |
| 530 | Ga0395905_0017879 | 3300037471 | Bacteria | 6736 |
| 531 | Ga0395905_0032999 | 3300037471 | Plasmid | 4867 |
| 532 | Ga0395905_0035368 | 3300037471 | Bacteria | 4691 |
| 533 | Ga0395905_0053985 | 3300037471 | Bacteria | 3761 |
| 534 | Ga0395905_0057964 | 3300037471 | Bacteria | 3622 |
| 535 | Ga0395905_0085437 | 3300037471 | Bacteria | 2956 |
| 536 | Ga0395905_0614794 | 3300037471 | Bacteria | 988 |
| 537 | Ga0395905_0966875 | 3300037471 | Bacteria | 754 |
| 538 | Ga0395905_1122887 | 3300037471 | Bacteria | 689 |
| 539 | Ga0436364_1142878 | 3300037853 | Bacteria | 875 |
| 540 | Ga0395901_0000386 | 3300038443 | Bacteria | 52804 |
| 541 | Ga0395901_0006002 | 3300038443 | Bacteria | 12304 |
| 542 | Ga0395901_0010596 | 3300038443 | Bacteria | 9339 |
| 543 | Ga0395901_0017423 | 3300038443 | Bacteria | 7333 |
| 544 | Ga0395901_0018457 | 3300038443 | Bacteria | 7120 |
| 545 | Ga0395901_0026413 | 3300038443 | Bacteria | 5961 |
| 546 | Ga0395901_0037743 | 3300038443 | Plasmid | 4996 |
| 547 | Ga0395901_0114106 | 3300038443 | Bacteria | 2838 |
| 548 | Ga0395901_0182610 | 3300038443 | Bacteria | 2200 |
| 549 | Ga0395901_0387353 | 3300038443 | Bacteria | 1438 |
| 550 | Ga0395901_0499546 | 3300038443 | Bacteria | 1238 |
| 551 | Ga0395901_0525542 | 3300038443 | Unclassified | 1202 |
| 552 | Ga0395901_0542402 | 3300038443 | Bacteria | 1179 |
| 553 | Ga0466966_0037161 | 3300044684 | Unclassified | 3142 |
| 554 | Ga0466961_0025260 | 3300044693 | Unclassified | 3821 |
| 555 | Ga0466961_0041607 | 3300044693 | Bacteria | 2946 |
| 556 | Ga0466963_0001398 | 3300044694 | Bacteria | 12940 |
| 557 | Ga0466963_0581091 | 3300044694 | Bacteria | 791 |
| 558 | Ga0466957_0001787 | 3300044842 | Bacteria | 11323 |
| 559 | Ga0466957_0022732 | 3300044842 | Bacteria | 3702 |
| 560 | Ga0466959_0231731 | 3300045049 | Bacteria | 1278 |
| 561 | Ga0466958_0042568 | 3300045836 | Plasmid | 2735 |
| 562 | Ga0466958_0155080 | 3300045836 | Bacteria | 1445 |
| 563 | Ga0466967_0123450 | 3300045976 | Bacteria | 2396 |
| 564 | Ga0466967_0238487 | 3300045976 | Bacteria | 1734 |
| 565 | Ga0466967_0424086 | 3300045976 | Bacteria | 1297 |
| 566 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 567 | Ga0495638_0422830 | 3300046460 | Bacteria | 686 |
| 568 | Ga0495650_0000196 | 3300046471 | Bacteria | 131306 |
| 569 | Ga0495585_0071943 | 3300046492 | Bacteria | 1885 |
| 570 | Ga0495583_0000269 | 3300046506 | Bacteria | 85380 |
| 571 | Ga0495583_0006855 | 3300046506 | Bacteria | 7341 |
| 572 | Ga0495606_0034686 | 3300046507 | Bacteria | 3460 |
| 573 | Ga0495606_0036990 | 3300046507 | Bacteria | 3319 |
| 574 | Ga0495610_0000082 | 3300046512 | Bacteria | 113066 |
| 575 | Ga0495610_0000243 | 3300046512 | Bacteria | 57521 |
| 576 | Ga0495610_0026748 | 3300046512 | Bacteria | 3076 |
| 577 | Ga0495620_0003625 | 3300046515 | Bacteria | 8813 |
| 578 | Ga0495631_0019572 | 3300046518 | Bacteria | 3173 |
| 579 | Ga0495632_0005949 | 3300046519 | Bacteria | 7949 |
| 580 | Ga0495637_0021113 | 3300046520 | Bacteria | 2988 |
| 581 | Ga0495643_0000561 | 3300046522 | Bacteria | 45970 |
| 582 | Ga0495648_0000046 | 3300046524 | Bacteria | 167725 |
| 583 | Ga0495633_0001488 | 3300046558 | Bacteria | 18170 |
| 584 | Ga0495633_0003456 | 3300046558 | Bacteria | 10503 |
| 585 | Ga0495633_0005860 | 3300046558 | Bacteria | 7394 |
| 586 | Ga0495633_0019674 | 3300046558 | Bacteria | 3411 |
| 587 | Ga0495625_0000832 | 3300046660 | Bacteria | 42398 |
| 588 | Ga0495625_0146707 | 3300046660 | Bacteria | 1588 |
| 589 | Ga0495661_0181232 | 3300046665 | Bacteria | 1116 |
| 590 | Ga0495669_0000023 | 3300046684 | Bacteria | 117158 |
| 591 | Ga0495671_0000057 | 3300046692 | Bacteria | 114166 |
| 592 | Ga0495672_0038842 | 3300047320 | Bacteria | 2900 |
| 593 | Ga0495683_0005724 | 3300047323 | Bacteria | 6855 |
| 594 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 595 | Ga0495673_0000110 | 3300047469 | Bacteria | 166127 |
| 596 | Ga0495626_0001225 | 3300048091 | Bacteria | 21121 |
| 597 | Ga0496100_0001143 | 3300048903 | Bacteria | 12894 |
| 598 | Ga0496101_0004565 | 3300048904 | Bacteria | 8746 |
| 599 | Ga0496101_0006709 | 3300048904 | Bacteria | 7423 |
| 600 | Ga0496102_0000698 | 3300048905 | Bacteria | 33409 |
| 601 | Ga0496103_0000258 | 3300048906 | Bacteria | 50941 |
| 602 | Ga0496104_0000675 | 3300048907 | Bacteria | 29310 |
| 603 | Ga0496104_0017956 | 3300048907 | Bacteria | 6449 |
| 604 | Ga0496105_0000184 | 3300048908 | Bacteria | 41790 |
| 605 | Ga0496105_0003801 | 3300048908 | Bacteria | 11263 |
| 606 | Ga0496107_0277459 | 3300048910 | Bacteria | 1248 |
| 607 | Ga0496107_0355793 | 3300048910 | Bacteria | 1090 |
| 608 | Ga0496109_0002925 | 3300048912 | Bacteria | 14275 |
| 609 | Ga0496109_0005801 | 3300048912 | Bacteria | 10339 |
| 610 | Ga0496111_0012485 | 3300048914 | Bacteria | 5753 |
| 611 | Ga0496112_0001054 | 3300048915 | Bacteria | 20330 |
| 612 | Ga0496112_0015723 | 3300048915 | Bacteria | 7068 |
| 613 | Ga0496112_0025699 | 3300048915 | Bacteria | 5657 |
| 614 | Ga0496113_0001048 | 3300048916 | Bacteria | 14914 |
| 615 | Ga0496114_0213160 | 3300048917 | Bacteria | 1694 |
| 616 | Ga0496116_0001606 | 3300048919 | Bacteria | 24832 |
| 617 | Ga0496116_0004390 | 3300048919 | Bacteria | 13490 |
| 618 | Ga0496116_0006963 | 3300048919 | Bacteria | 10131 |
| 619 | Ga0496116_0019186 | 3300048919 | Bacteria | 5242 |
| 620 | Ga0496117_0001983 | 3300048920 | Bacteria | 27190 |
| 621 | Ga0496117_0006616 | 3300048920 | Bacteria | 11647 |
| 622 | Ga0496117_0047668 | 3300048920 | Bacteria | 3070 |
| 623 | Ga0496118_0000335 | 3300048921 | Bacteria | 80253 |
| 624 | Ga0496118_0002186 | 3300048921 | Bacteria | 27190 |
| 625 | Ga0496118_0007403 | 3300048921 | Bacteria | 11647 |
| 626 | Ga0496118_0076912 | 3300048921 | Bacteria | 2370 |
| 627 | Ga0496119_0001028 | 3300048922 | Bacteria | 35759 |
| 628 | Ga0496119_0006485 | 3300048922 | Bacteria | 10807 |
| 629 | Ga0496120_0000961 | 3300048923 | Bacteria | 39309 |
| 630 | Ga0496120_0039250 | 3300048923 | Bacteria | 2795 |
| 631 | Ga0496121_0006115 | 3300048924 | Bacteria | 15131 |
| 632 | Ga0496121_0006397 | 3300048924 | Bacteria | 14645 |
| 633 | Ga0496121_0012699 | 3300048924 | Bacteria | 9138 |
| 634 | Ga0496122_0001573 | 3300048925 | Bacteria | 35934 |
| 635 | Ga0496122_0002945 | 3300048925 | Bacteria | 23213 |
| 636 | Ga0496122_0054532 | 3300048925 | Bacteria | 3001 |
| 637 | Ga0496123_0000428 | 3300048926 | Bacteria | 75893 |
| 638 | Ga0496123_0003956 | 3300048926 | Bacteria | 16060 |
| 639 | Ga0496124_0002149 | 3300048927 | Bacteria | 26478 |
| 640 | Ga0496124_0004303 | 3300048927 | Bacteria | 16719 |
| 641 | Ga0496124_0007434 | 3300048927 | Bacteria | 11642 |
| 642 | Ga0496124_0014032 | 3300048927 | Bacteria | 7773 |
| 643 | Ga0496125_0003189 | 3300048928 | Bacteria | 20284 |
| 644 | Ga0496125_0004588 | 3300048928 | Bacteria | 15796 |
| 645 | Ga0496125_0018222 | 3300048928 | Bacteria | 6672 |
| 646 | Ga0496125_0046502 | 3300048928 | Bacteria | 3640 |
| 647 | Ga0496125_0133927 | 3300048928 | Bacteria | 1737 |
| 648 | Ga0496126_0000158 | 3300048929 | Bacteria | 156032 |
| 649 | Ga0496126_0002026 | 3300048929 | Bacteria | 28605 |
| 650 | Ga0501335_000249 | 3300049551 | Bacteria | 3110 |
| 651 | Ga0501038_0003137 | 3300049574 | Bacteria | 15417 |
| 652 | Ga0501067_0147579 | 3300049583 | Bacteria | 1310 |
| 653 | Ga0501206_000989 | 3300049653 | Bacteria | 3538 |
| 654 | Ga0501224_004528 | 3300049664 | Bacteria | 1975 |
| 655 | Ga0501235_000092 | 3300049669 | Bacteria | 14201 |
| 656 | Ga0501236_000884 | 3300049670 | Bacteria | 3355 |
| 657 | Ga0501225_0002260 | 3300049705 | Bacteria | 5957 |
| 658 | Ga0501245_000867 | 3300049708 | Bacteria | 3823 |
| 659 | nmdc:mga00v17_19848_c1 | 3300050491 | Bacteria | 3843 |
| 660 | nmdc:mga0yw44_435499_c1 | 3300050492 | Bacteria | 888 |
| 661 | nmdc:mga09592_36160_c1 | 3300050508 | Bacteria | 4137 |
| 662 | Ga0500610_0000549 | 3300053079 | Bacteria | 11566 |
| 663 | Ga0500644_0116068 | 3300053088 | Bacteria | 1037 |
| 664 | Ga0500594_0001846 | 3300053118 | Bacteria | 4586 |
| 665 | Ga0500608_058548 | 3300053122 | Unclassified | 1844 |
| 666 | Ga0500559_0056486 | 3300053136 | Bacteria | 1742 |
| 667 | Ga0500590_003777 | 3300053148 | Bacteria | 7043 |
| 668 | Ga0500622_0028672 | 3300053156 | Bacteria | 2930 |
| 669 | Ga0500624_000361 | 3300053157 | Bacteria | 14695 |
| 670 | Ga0500645_005047 | 3300053730 | Bacteria | 4934 |
| 671 | Ga0500596_000488 | 3300053735 | Bacteria | 7424 |
| 672 | Ga0466962_0108093 | 3300061719 | Bacteria | 1338 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0025260 | Ga0466961_0025260_3121_3768 | 168 |
| 2 | 3300044842 | Ga0466957_0022732 | Ga0466957_0022732_804_1451 | 168 |
| 3 | 3300045049 | Ga0466959_0231731 | Ga0466959_0231731_423_1070 | 168 |
| 4 | 3300045836 | Ga0466958_0155080 | Ga0466958_0155080_90_737 | 168 |
| 5 | 3300049583 | Ga0501067_0147579 | Ga0501067_0147579_298_945 | 176 |
| 6 | 3300005563 | Ga0068855_100050067 | Ga0068855_1000500673 | 180 |
| 7 | 3300005578 | Ga0068854_100205013 | Ga0068854_1002050132 | 180 |
| 8 | 3300005616 | Ga0068852_100194699 | Ga0068852_1001946992 | 180 |
| 9 | 3300013104 | Ga0157370_10135175 | Ga0157370_101351751 | 180 |
| 10 | 3300013105 | Ga0157369_10054658 | Ga0157369_100546583 | 180 |
| 11 | 3300025949 | Ga0207667_10038970 | Ga0207667_100389703 | 180 |
| 12 | 3300025981 | Ga0207640_10155331 | Ga0207640_101553312 | 180 |
| 13 | 3300026142 | Ga0207698_10230474 | Ga0207698_102304742 | 180 |
| 14 | 3300037312 | Ga0395899_0037168 | Ga0395899_0037168_955_1602 | 180 |
| 15 | 3300037418 | Ga0395900_0093843 | Ga0395900_0093843_281_928 | 180 |
| 16 | 3300037471 | Ga0395905_0032999 | Ga0395905_0032999_1541_2188 | 180 |
| 17 | 3300038443 | Ga0395901_0037743 | Ga0395901_0037743_1670_2317 | 180 |
| 18 | 3300013104 | Ga0157370_10019835 | Ga0157370_100198352 | 195 |
| 19 | 3300005327 | Ga0070658_10033089 | Ga0070658_100330893 | 201 |
| 20 | 3300005339 | Ga0070660_100000883 | Ga0070660_10000088318 | 201 |
| 21 | 3300005344 | Ga0070661_100025661 | Ga0070661_1000256613 | 201 |
| 22 | 3300005366 | Ga0070659_100016215 | Ga0070659_1000162154 | 201 |
| 23 | 3300005455 | Ga0070663_100032754 | Ga0070663_1000327544 | 201 |
| 24 | 3300005564 | Ga0070664_100022088 | Ga0070664_1000220883 | 201 |
| 25 | 3300025909 | Ga0207705_10003164 | Ga0207705_100031646 | 201 |
| 26 | 3300025919 | Ga0207657_10000783 | Ga0207657_1000078313 | 201 |
| 27 | 3300025933 | Ga0207706_10002940 | Ga0207706_1000294014 | 201 |
| 28 | 3300025945 | Ga0207679_10109470 | Ga0207679_101094703 | 201 |
| 29 | 3300026067 | Ga0207678_10035183 | Ga0207678_100351835 | 201 |
| 30 | 3300013102 | Ga0157371_10003629 | Ga0157371_100036297 | 202 |
| 31 | 3300037418 | Ga0395900_0131136 | Ga0395900_0131136_1616_2263 | 202 |
| 32 | 3300005327 | Ga0070658_10092331 | Ga0070658_100923313 | 203 |
| 33 | 3300005339 | Ga0070660_100126519 | Ga0070660_1001265192 | 203 |
| 34 | 3300005355 | Ga0070671_100007581 | Ga0070671_1000075811 | 203 |
| 35 | 3300005364 | Ga0070673_100001803 | Ga0070673_1000018037 | 203 |
| 36 | 3300005366 | Ga0070659_100443507 | Ga0070659_1004435072 | 203 |
| 37 | 3300006358 | Ga0068871_100106748 | Ga0068871_1001067482 | 203 |
| 38 | 3300009177 | Ga0105248_10002296 | Ga0105248_100022967 | 203 |
| 39 | 3300013105 | Ga0157369_10001785 | Ga0157369_100017853 | 203 |
| 40 | 3300013297 | Ga0157378_11168367 | Ga0157378_111683672 | 203 |
| 41 | 3300014968 | Ga0157379_10059439 | Ga0157379_100594395 | 203 |
| 42 | 3300025321 | Ga0207656_10166279 | Ga0207656_101662792 | 203 |
| 43 | 3300025903 | Ga0207680_10042236 | Ga0207680_100422363 | 203 |
| 44 | 3300025919 | Ga0207657_10451695 | Ga0207657_104516951 | 203 |
| 45 | 3300035171 | Ga0373946_0041007 | Ga0373946_0041007_434_1045 | 203 |
| 46 | 3300035725 | Ga0373947_0031262 | Ga0373947_0031262_2196_2807 | 203 |
| 47 | 3300037068 | Ga0373925_0034706 | Ga0373925_0034706_1437_2048 | 203 |
| 48 | 3300037312 | Ga0395899_0014455 | Ga0395899_0014455_2971_3582 | 203 |
| 49 | 3300037312 | Ga0395899_0120433 | Ga0395899_0120433_970_1581 | 203 |
| 50 | 3300037418 | Ga0395900_0007480 | Ga0395900_0007480_8767_9378 | 203 |
| 51 | 3300037418 | Ga0395900_0052238 | Ga0395900_0052238_3150_3761 | 203 |
| 52 | 3300037466 | Ga0395898_0102378 | Ga0395898_0102378_354_965 | 203 |
| 53 | 3300037466 | Ga0395898_0515742 | Ga0395898_0515742_324_935 | 203 |
| 54 | 3300037471 | Ga0395905_0006991 | Ga0395905_0006991_1909_2520 | 203 |
| 55 | 3300037471 | Ga0395905_0017879 | Ga0395905_0017879_304_915 | 203 |
| 56 | 3300038443 | Ga0395901_0018457 | Ga0395901_0018457_1909_2520 | 203 |
| 57 | 3300038443 | Ga0395901_0525542 | Ga0395901_0525542_354_965 | 203 |
| 58 | 3300048910 | Ga0496107_0277459 | Ga0496107_0277459_361_981 | 203 |
| 59 | 3300048919 | Ga0496116_0004390 | Ga0496116_0004390_2723_3334 | 203 |
| 60 | 3300050492 | nmdc:mga0yw44_435499_c1 | nmdc:mga0yw44_435499_c1_135_746 | 203 |
| 61 | 3300053136 | Ga0500559_0056486 | Ga0500559_0056486_911_1522 | 203 |
| 62 | 3300044694 | Ga0466963_0001398 | Ga0466963_0001398_3319_3966 | 207 |
| 63 | 3300045976 | Ga0466967_0123450 | Ga0466967_0123450_352_999 | 207 |
| 64 | 3300046471 | Ga0495650_0000196 | Ga0495650_0000196_94343_94966 | 207 |
| 65 | 3300046506 | Ga0495583_0006855 | Ga0495583_0006855_3753_4376 | 207 |
| 66 | 3300046507 | Ga0495606_0034686 | Ga0495606_0034686_851_1474 | 207 |
| 67 | 3300046518 | Ga0495631_0019572 | Ga0495631_0019572_200_823 | 207 |
| 68 | 3300046520 | Ga0495637_0021113 | Ga0495637_0021113_1309_1932 | 207 |
| 69 | 3300046558 | Ga0495633_0003456 | Ga0495633_0003456_6837_7460 | 207 |
| 70 | 3300046660 | Ga0495625_0146707 | Ga0495625_0146707_226_849 | 207 |
| 71 | 3300046665 | Ga0495661_0181232 | Ga0495661_0181232_236_859 | 207 |
| 72 | 3300046684 | Ga0495669_0000023 | Ga0495669_0000023_41743_42366 | 207 |
| 73 | 3300053079 | Ga0500610_0000549 | Ga0500610_0000549_9728_10351 | 207 |
| 74 | 3300046512 | Ga0495610_0026748 | Ga0495610_0026748_1875_2522 | 209 |
| 75 | 3300046558 | Ga0495633_0001488 | Ga0495633_0001488_8644_9291 | 210 |
| 76 | iso_pu_bacteria | 2738541301 | 2738849518 | 211 |
| 77 | iso_pu_bacteria | 2738541304 | 2738865247 | 211 |
| 78 | iso_pu_bacteria | 2738543022 | 2739297765 | 211 |
| 79 | iso_pu_bacteria | 2738543033 | 2739359443 | 211 |
| 80 | iso_pu_bacteria | 2808606404 | 2809081368 | 211 |
| 81 | iso_pu_bacteria | 2879163058 | 2879163647 | 211 |
| 82 | iso_pu_bacteria | 2880518877 | 2880523798 | 211 |
| 83 | iso_pu_bacteria | 2919138771 | 2919138879 | 211 |
| 84 | iso_pu_bacteria | 2919138771 | 2919139590 | 211 |
| 85 | 3300005436 | Ga0070713_100017413 | Ga0070713_1000174134 | 214 |
| 86 | 3300005439 | Ga0070711_100005496 | Ga0070711_1000054964 | 214 |
| 87 | 3300006175 | Ga0070712_100050193 | Ga0070712_1000501931 | 214 |
| 88 | 3300010159 | Ga0099796_10009055 | Ga0099796_100090553 | 214 |
| 89 | 3300025906 | Ga0207699_10075082 | Ga0207699_100750821 | 214 |
| 90 | 3300025915 | Ga0207693_10024751 | Ga0207693_100247513 | 214 |
| 91 | 3300037853 | Ga0436364_1142878 | Ga0436364_1142878_69_716 | 214 |
| 92 | 3300045976 | Ga0466967_0238487 | Ga0466967_0238487_543_1190 | 214 |
| 93 | 3300053730 | Ga0500645_005047 | Ga0500645_005047_2651_3295 | 214 |
| 94 | 2162886007 | SwRhRL2b_contig_209976 | SwRhRL2b_0898.00001110 | 215 |
| 95 | 3300001904 | JGI24736J21556_1000069 | JGI24736J21556_10000698 | 215 |
| 96 | 3300001976 | JGI24752J21851_1000086 | JGI24752J21851_10000864 | 215 |
| 97 | 3300001979 | JGI24740J21852_10003151 | JGI24740J21852_100031512 | 215 |
| 98 | 3300001979 | JGI24740J21852_10020269 | JGI24740J21852_100202692 | 215 |
| 99 | 3300001990 | JGI24737J22298_10001229 | JGI24737J22298_100012296 | 215 |
| 100 | 3300001990 | JGI24737J22298_10077900 | JGI24737J22298_100779001 | 215 |
| 101 | 3300002067 | JGI24735J21928_10001501 | JGI24735J21928_100015014 | 215 |
| 102 | 3300005289 | Ga0065704_10000277 | Ga0065704_1000027740 | 215 |
| 103 | 3300005289 | Ga0065704_10073718 | Ga0065704_100737187 | 215 |
| 104 | 3300005289 | Ga0065704_10090188 | Ga0065704_100901882 | 215 |
| 105 | 3300005295 | Ga0065707_10085857 | Ga0065707_100858578 | 215 |
| 106 | 3300005295 | Ga0065707_10092635 | Ga0065707_100926353 | 215 |
| 107 | 3300005327 | Ga0070658_10002371 | Ga0070658_100023716 | 215 |
| 108 | 3300005327 | Ga0070658_10003386 | Ga0070658_100033867 | 215 |
| 109 | 3300005327 | Ga0070658_10008650 | Ga0070658_100086502 | 215 |
| 110 | 3300005327 | Ga0070658_10009192 | Ga0070658_100091927 | 215 |
| 111 | 3300005327 | Ga0070658_10016647 | Ga0070658_100166473 | 215 |
| 112 | 3300005327 | Ga0070658_10163673 | Ga0070658_101636732 | 215 |
| 113 | 3300005328 | Ga0070676_10116723 | Ga0070676_101167232 | 215 |
| 114 | 3300005328 | Ga0070676_10121621 | Ga0070676_101216211 | 215 |
| 115 | 3300005329 | Ga0070683_100003584 | Ga0070683_1000035846 | 215 |
| 116 | 3300005329 | Ga0070683_100010674 | Ga0070683_1000106748 | 215 |
| 117 | 3300005330 | Ga0070690_100004211 | Ga0070690_1000042113 | 215 |
| 118 | 3300005331 | Ga0070670_100000215 | Ga0070670_1000002154 | 215 |
| 119 | 3300005331 | Ga0070670_100167033 | Ga0070670_1001670333 | 215 |
| 120 | 3300005331 | Ga0070670_100169353 | Ga0070670_1001693532 | 215 |
| 121 | 3300005335 | Ga0070666_10005604 | Ga0070666_100056043 | 215 |
| 122 | 3300005335 | Ga0070666_10013523 | Ga0070666_100135234 | 215 |
| 123 | 3300005335 | Ga0070666_10020911 | Ga0070666_100209113 | 215 |
| 124 | 3300005335 | Ga0070666_10026096 | Ga0070666_100260964 | 215 |
| 125 | 3300005335 | Ga0070666_10073215 | Ga0070666_100732151 | 215 |
| 126 | 3300005336 | Ga0070680_100000271 | Ga0070680_10000027112 | 215 |
| 127 | 3300005336 | Ga0070680_100184717 | Ga0070680_1001847171 | 215 |
| 128 | 3300005336 | Ga0070680_100269167 | Ga0070680_1002691672 | 215 |
| 129 | 3300005336 | Ga0070680_100541703 | Ga0070680_1005417031 | 215 |
| 130 | 3300005338 | Ga0068868_100002030 | Ga0068868_1000020307 | 215 |
| 131 | 3300005338 | Ga0068868_100022820 | Ga0068868_1000228203 | 215 |
| 132 | 3300005338 | Ga0068868_100156144 | Ga0068868_1001561442 | 215 |
| 133 | 3300005339 | Ga0070660_100002324 | Ga0070660_1000023248 | 215 |
| 134 | 3300005339 | Ga0070660_100002881 | Ga0070660_1000028815 | 215 |
| 135 | 3300005339 | Ga0070660_100006448 | Ga0070660_1000064486 | 215 |
| 136 | 3300005339 | Ga0070660_100043823 | Ga0070660_1000438231 | 215 |
| 137 | 3300005339 | Ga0070660_100116309 | Ga0070660_1001163092 | 215 |
| 138 | 3300005339 | Ga0070660_100140029 | Ga0070660_1001400293 | 215 |
| 139 | 3300005339 | Ga0070660_100384335 | Ga0070660_1003843352 | 215 |
| 140 | 3300005339 | Ga0070660_100390546 | Ga0070660_1003905462 | 215 |
| 141 | 3300005339 | Ga0070660_100503957 | Ga0070660_1005039571 | 215 |
| 142 | 3300005341 | Ga0070691_10050964 | Ga0070691_100509642 | 215 |
| 143 | 3300005344 | Ga0070661_100001010 | Ga0070661_1000010104 | 215 |
| 144 | 3300005344 | Ga0070661_100007206 | Ga0070661_1000072064 | 215 |
| 145 | 3300005344 | Ga0070661_100029372 | Ga0070661_1000293723 | 215 |
| 146 | 3300005344 | Ga0070661_100037618 | Ga0070661_1000376183 | 215 |
| 147 | 3300005344 | Ga0070661_100092981 | Ga0070661_1000929811 | 215 |
| 148 | 3300005344 | Ga0070661_100175315 | Ga0070661_1001753152 | 215 |
| 149 | 3300005347 | Ga0070668_100007830 | Ga0070668_1000078303 | 215 |
| 150 | 3300005353 | Ga0070669_100000039 | Ga0070669_10000003976 | 215 |
| 151 | 3300005353 | Ga0070669_100191322 | Ga0070669_1001913222 | 215 |
| 152 | 3300005355 | Ga0070671_100001504 | Ga0070671_10000150413 | 215 |
| 153 | 3300005355 | Ga0070671_100001971 | Ga0070671_1000019715 | 215 |
| 154 | 3300005355 | Ga0070671_100007512 | Ga0070671_1000075126 | 215 |
| 155 | 3300005355 | Ga0070671_100009223 | Ga0070671_1000092232 | 215 |
| 156 | 3300005355 | Ga0070671_100315756 | Ga0070671_1003157561 | 215 |
| 157 | 3300005356 | Ga0070674_100014847 | Ga0070674_1000148471 | 215 |
| 158 | 3300005356 | Ga0070674_100023869 | Ga0070674_1000238692 | 215 |
| 159 | 3300005356 | Ga0070674_100124350 | Ga0070674_1001243503 | 215 |
| 160 | 3300005364 | Ga0070673_100005453 | Ga0070673_1000054535 | 215 |
| 161 | 3300005364 | Ga0070673_100047642 | Ga0070673_1000476424 | 215 |
| 162 | 3300005364 | Ga0070673_100115036 | Ga0070673_1001150362 | 215 |
| 163 | 3300005364 | Ga0070673_100128862 | Ga0070673_1001288622 | 215 |
| 164 | 3300005364 | Ga0070673_100420972 | Ga0070673_1004209722 | 215 |
| 165 | 3300005366 | Ga0070659_100001788 | Ga0070659_10000178810 | 215 |
| 166 | 3300005366 | Ga0070659_100003421 | Ga0070659_1000034214 | 215 |
| 167 | 3300005366 | Ga0070659_100004990 | Ga0070659_1000049908 | 215 |
| 168 | 3300005366 | Ga0070659_100024439 | Ga0070659_1000244391 | 215 |
| 169 | 3300005366 | Ga0070659_100037487 | Ga0070659_1000374874 | 215 |
| 170 | 3300005366 | Ga0070659_100059584 | Ga0070659_1000595843 | 215 |
| 171 | 3300005366 | Ga0070659_100133576 | Ga0070659_1001335762 | 215 |
| 172 | 3300005366 | Ga0070659_100224515 | Ga0070659_1002245151 | 215 |
| 173 | 3300005366 | Ga0070659_100293781 | Ga0070659_1002937812 | 215 |
| 174 | 3300005367 | Ga0070667_100000311 | Ga0070667_1000003114 | 215 |
| 175 | 3300005367 | Ga0070667_100000719 | Ga0070667_10000071922 | 215 |
| 176 | 3300005434 | Ga0070709_10267657 | Ga0070709_102676572 | 215 |
| 177 | 3300005435 | Ga0070714_100015990 | Ga0070714_1000159903 | 215 |
| 178 | 3300005435 | Ga0070714_100017633 | Ga0070714_1000176332 | 215 |
| 179 | 3300005435 | Ga0070714_100043916 | Ga0070714_1000439162 | 215 |
| 180 | 3300005435 | Ga0070714_100194819 | Ga0070714_1001948192 | 215 |
| 181 | 3300005436 | Ga0070713_100009084 | Ga0070713_1000090845 | 215 |
| 182 | 3300005455 | Ga0070663_100000485 | Ga0070663_10000048512 | 215 |
| 183 | 3300005455 | Ga0070663_100001726 | Ga0070663_1000017265 | 215 |
| 184 | 3300005455 | Ga0070663_100069410 | Ga0070663_1000694103 | 215 |
| 185 | 3300005456 | Ga0070678_100364920 | Ga0070678_1003649201 | 215 |
| 186 | 3300005456 | Ga0070678_100964548 | Ga0070678_1009645481 | 215 |
| 187 | 3300005457 | Ga0070662_100008303 | Ga0070662_1000083037 | 215 |
| 188 | 3300005457 | Ga0070662_100024960 | Ga0070662_1000249603 | 215 |
| 189 | 3300005457 | Ga0070662_100144743 | Ga0070662_1001447432 | 215 |
| 190 | 3300005459 | Ga0068867_100038525 | Ga0068867_1000385253 | 215 |
| 191 | 3300005459 | Ga0068867_100983110 | Ga0068867_1009831101 | 215 |
| 192 | 3300005466 | Ga0070685_10067688 | Ga0070685_100676883 | 215 |
| 193 | 3300005530 | Ga0070679_100258359 | Ga0070679_1002583592 | 215 |
| 194 | 3300005530 | Ga0070679_100278089 | Ga0070679_1002780891 | 215 |
| 195 | 3300005530 | Ga0070679_100622792 | Ga0070679_1006227922 | 215 |
| 196 | 3300005535 | Ga0070684_100008271 | Ga0070684_1000082712 | 215 |
| 197 | 3300005535 | Ga0070684_100059971 | Ga0070684_1000599712 | 215 |
| 198 | 3300005539 | Ga0068853_100000755 | Ga0068853_10000075512 | 215 |
| 199 | 3300005539 | Ga0068853_100002226 | Ga0068853_1000022263 | 215 |
| 200 | 3300005539 | Ga0068853_100002488 | Ga0068853_1000024884 | 215 |
| 201 | 3300005539 | Ga0068853_100069436 | Ga0068853_1000694363 | 215 |
| 202 | 3300005539 | Ga0068853_100154217 | Ga0068853_1001542173 | 215 |
| 203 | 3300005539 | Ga0068853_100248810 | Ga0068853_1002488102 | 215 |
| 204 | 3300005539 | Ga0068853_100318504 | Ga0068853_1003185042 | 215 |
| 205 | 3300005543 | Ga0070672_100050476 | Ga0070672_1000504763 | 215 |
| 206 | 3300005543 | Ga0070672_100071237 | Ga0070672_1000712372 | 215 |
| 207 | 3300005543 | Ga0070672_100229482 | Ga0070672_1002294822 | 215 |
| 208 | 3300005544 | Ga0070686_100196102 | Ga0070686_1001961022 | 215 |
| 209 | 3300005548 | Ga0070665_100003111 | Ga0070665_1000031118 | 215 |
| 210 | 3300005548 | Ga0070665_100064524 | Ga0070665_1000645243 | 215 |
| 211 | 3300005563 | Ga0068855_100006702 | Ga0068855_1000067025 | 215 |
| 212 | 3300005563 | Ga0068855_100010156 | Ga0068855_1000101568 | 215 |
| 213 | 3300005563 | Ga0068855_100014166 | Ga0068855_1000141668 | 215 |
| 214 | 3300005563 | Ga0068855_100017947 | Ga0068855_1000179476 | 215 |
| 215 | 3300005563 | Ga0068855_100018598 | Ga0068855_1000185982 | 215 |
| 216 | 3300005563 | Ga0068855_100029847 | Ga0068855_1000298475 | 215 |
| 217 | 3300005563 | Ga0068855_100112216 | Ga0068855_1001122163 | 215 |
| 218 | 3300005563 | Ga0068855_100164447 | Ga0068855_1001644473 | 215 |
| 219 | 3300005563 | Ga0068855_100212465 | Ga0068855_1002124653 | 215 |
| 220 | 3300005564 | Ga0070664_100059697 | Ga0070664_1000596972 | 215 |
| 221 | 3300005577 | Ga0068857_100000856 | Ga0068857_1000008566 | 215 |
| 222 | 3300005577 | Ga0068857_100010170 | Ga0068857_1000101706 | 215 |
| 223 | 3300005577 | Ga0068857_100012150 | Ga0068857_1000121503 | 215 |
| 224 | 3300005577 | Ga0068857_100190028 | Ga0068857_1001900282 | 215 |
| 225 | 3300005578 | Ga0068854_100001288 | Ga0068854_10000128811 | 215 |
| 226 | 3300005578 | Ga0068854_100001536 | Ga0068854_1000015364 | 215 |
| 227 | 3300005578 | Ga0068854_100003540 | Ga0068854_1000035408 | 215 |
| 228 | 3300005578 | Ga0068854_100009272 | Ga0068854_1000092724 | 215 |
| 229 | 3300005578 | Ga0068854_100009525 | Ga0068854_1000095252 | 215 |
| 230 | 3300005578 | Ga0068854_100020148 | Ga0068854_1000201483 | 215 |
| 231 | 3300005578 | Ga0068854_100060809 | Ga0068854_1000608093 | 215 |
| 232 | 3300005578 | Ga0068854_100100547 | Ga0068854_1001005473 | 215 |
| 233 | 3300005578 | Ga0068854_100313945 | Ga0068854_1003139452 | 215 |
| 234 | 3300005614 | Ga0068856_100009429 | Ga0068856_1000094298 | 215 |
| 235 | 3300005614 | Ga0068856_100010950 | Ga0068856_1000109503 | 215 |
| 236 | 3300005614 | Ga0068856_100020465 | Ga0068856_1000204652 | 215 |
| 237 | 3300005614 | Ga0068856_100031496 | Ga0068856_1000314962 | 215 |
| 238 | 3300005614 | Ga0068856_100103740 | Ga0068856_1001037402 | 215 |
| 239 | 3300005614 | Ga0068856_100326405 | Ga0068856_1003264051 | 215 |
| 240 | 3300005614 | Ga0068856_100677498 | Ga0068856_1006774982 | 215 |
| 241 | 3300005616 | Ga0068852_100000868 | Ga0068852_10000086810 | 215 |
| 242 | 3300005616 | Ga0068852_100003221 | Ga0068852_1000032212 | 215 |
| 243 | 3300005616 | Ga0068852_100005448 | Ga0068852_1000054484 | 215 |
| 244 | 3300005616 | Ga0068852_100013235 | Ga0068852_1000132352 | 215 |
| 245 | 3300005616 | Ga0068852_100016397 | Ga0068852_1000163974 | 215 |
| 246 | 3300005616 | Ga0068852_100068911 | Ga0068852_1000689112 | 215 |
| 247 | 3300005616 | Ga0068852_100094533 | Ga0068852_1000945332 | 215 |
| 248 | 3300005616 | Ga0068852_100098578 | Ga0068852_1000985782 | 215 |
| 249 | 3300005616 | Ga0068852_100317230 | Ga0068852_1003172302 | 215 |
| 250 | 3300005616 | Ga0068852_100317852 | Ga0068852_1003178522 | 215 |
| 251 | 3300005616 | Ga0068852_100327642 | Ga0068852_1003276422 | 215 |
| 252 | 3300005616 | Ga0068852_100403149 | Ga0068852_1004031492 | 215 |
| 253 | 3300005616 | Ga0068852_100485478 | Ga0068852_1004854782 | 215 |
| 254 | 3300005616 | Ga0068852_100513864 | Ga0068852_1005138641 | 215 |
| 255 | 3300005618 | Ga0068864_100000080 | Ga0068864_10000008094 | 215 |
| 256 | 3300005834 | Ga0068851_10042741 | Ga0068851_100427413 | 215 |
| 257 | 3300005834 | Ga0068851_10162574 | Ga0068851_101625741 | 215 |
| 258 | 3300005834 | Ga0068851_10215259 | Ga0068851_102152592 | 215 |
| 259 | 3300005841 | Ga0068863_100000087 | Ga0068863_10000008794 | 215 |
| 260 | 3300005842 | Ga0068858_100034153 | Ga0068858_1000341533 | 215 |
| 261 | 3300005842 | Ga0068858_100472075 | Ga0068858_1004720752 | 215 |
| 262 | 3300005843 | Ga0068860_100029152 | Ga0068860_1000291523 | 215 |
| 263 | 3300005843 | Ga0068860_100393568 | Ga0068860_1003935682 | 215 |
| 264 | 3300005844 | Ga0068862_100000101 | Ga0068862_10000010194 | 215 |
| 265 | 3300005844 | Ga0068862_100032334 | Ga0068862_1000323345 | 215 |
| 266 | 3300006051 | Ga0075364_10089606 | Ga0075364_100896063 | 215 |
| 267 | 3300006051 | Ga0075364_10400652 | Ga0075364_104006521 | 215 |
| 268 | 3300006237 | Ga0097621_100012206 | Ga0097621_1000122063 | 215 |
| 269 | 3300006358 | Ga0068871_100001517 | Ga0068871_1000015175 | 215 |
| 270 | 3300006880 | Ga0075429_100027480 | Ga0075429_1000274802 | 215 |
| 271 | 3300009011 | Ga0105251_10000248 | Ga0105251_1000024847 | 215 |
| 272 | 3300009011 | Ga0105251_10013886 | Ga0105251_100138865 | 215 |
| 273 | 3300009092 | Ga0105250_10000748 | Ga0105250_100007487 | 215 |
| 274 | 3300009092 | Ga0105250_10006791 | Ga0105250_100067913 | 215 |
| 275 | 3300009093 | Ga0105240_10004406 | Ga0105240_100044063 | 215 |
| 276 | 3300009093 | Ga0105240_10010132 | Ga0105240_100101325 | 215 |
| 277 | 3300009093 | Ga0105240_10013114 | Ga0105240_100131148 | 215 |
| 278 | 3300009093 | Ga0105240_10052477 | Ga0105240_100524771 | 215 |
| 279 | 3300009093 | Ga0105240_10101719 | Ga0105240_101017192 | 215 |
| 280 | 3300009093 | Ga0105240_10391088 | Ga0105240_103910882 | 215 |
| 281 | 3300009093 | Ga0105240_10431847 | Ga0105240_104318472 | 215 |
| 282 | 3300009094 | Ga0111539_10079611 | Ga0111539_100796112 | 215 |
| 283 | 3300009098 | Ga0105245_10640480 | Ga0105245_106404801 | 215 |
| 284 | 3300009148 | Ga0105243_10517388 | Ga0105243_105173882 | 215 |
| 285 | 3300009174 | Ga0105241_10203413 | Ga0105241_102034132 | 215 |
| 286 | 3300009177 | Ga0105248_10001316 | Ga0105248_1000131614 | 215 |
| 287 | 3300009177 | Ga0105248_10462855 | Ga0105248_104628552 | 215 |
| 288 | 3300009545 | Ga0105237_10009761 | Ga0105237_100097616 | 215 |
| 289 | 3300009545 | Ga0105237_10118442 | Ga0105237_101184421 | 215 |
| 290 | 3300009545 | Ga0105237_10140536 | Ga0105237_101405362 | 215 |
| 291 | 3300009551 | Ga0105238_10005484 | Ga0105238_1000548410 | 215 |
| 292 | 3300009551 | Ga0105238_10015201 | Ga0105238_100152014 | 215 |
| 293 | 3300009551 | Ga0105238_10028914 | Ga0105238_100289145 | 215 |
| 294 | 3300009553 | Ga0105249_10000024 | Ga0105249_10000024143 | 215 |
| 295 | 3300010375 | Ga0105239_10054386 | Ga0105239_100543863 | 215 |
| 296 | 3300013100 | Ga0157373_10001108 | Ga0157373_100011087 | 215 |
| 297 | 3300013100 | Ga0157373_10001147 | Ga0157373_1000114712 | 215 |
| 298 | 3300013100 | Ga0157373_10005029 | Ga0157373_100050292 | 215 |
| 299 | 3300013100 | Ga0157373_10011635 | Ga0157373_100116355 | 215 |
| 300 | 3300013100 | Ga0157373_10044617 | Ga0157373_100446173 | 215 |
| 301 | 3300013102 | Ga0157371_10002246 | Ga0157371_100022468 | 215 |
| 302 | 3300013102 | Ga0157371_10003592 | Ga0157371_100035923 | 215 |
| 303 | 3300013102 | Ga0157371_10007364 | Ga0157371_100073644 | 215 |
| 304 | 3300013102 | Ga0157371_10013147 | Ga0157371_100131474 | 215 |
| 305 | 3300013102 | Ga0157371_10026267 | Ga0157371_100262675 | 215 |
| 306 | 3300013102 | Ga0157371_10040325 | Ga0157371_100403254 | 215 |
| 307 | 3300013102 | Ga0157371_10070695 | Ga0157371_100706952 | 215 |
| 308 | 3300013102 | Ga0157371_10147044 | Ga0157371_101470441 | 215 |
| 309 | 3300013102 | Ga0157371_10466350 | Ga0157371_104663502 | 215 |
| 310 | 3300013104 | Ga0157370_10001164 | Ga0157370_100011648 | 215 |
| 311 | 3300013104 | Ga0157370_10005590 | Ga0157370_100055907 | 215 |
| 312 | 3300013104 | Ga0157370_10013290 | Ga0157370_100132907 | 215 |
| 313 | 3300013104 | Ga0157370_10014274 | Ga0157370_100142744 | 215 |
| 314 | 3300013104 | Ga0157370_10026941 | Ga0157370_100269414 | 215 |
| 315 | 3300013104 | Ga0157370_10053269 | Ga0157370_100532694 | 215 |
| 316 | 3300013104 | Ga0157370_10068120 | Ga0157370_100681202 | 215 |
| 317 | 3300013104 | Ga0157370_10170694 | Ga0157370_101706941 | 215 |
| 318 | 3300013105 | Ga0157369_10001780 | Ga0157369_100017804 | 215 |
| 319 | 3300013105 | Ga0157369_10005452 | Ga0157369_100054527 | 215 |
| 320 | 3300013105 | Ga0157369_10007104 | Ga0157369_100071042 | 215 |
| 321 | 3300013105 | Ga0157369_10010023 | Ga0157369_100100238 | 215 |
| 322 | 3300013105 | Ga0157369_10015692 | Ga0157369_100156926 | 215 |
| 323 | 3300013105 | Ga0157369_10015860 | Ga0157369_100158607 | 215 |
| 324 | 3300013105 | Ga0157369_10025891 | Ga0157369_100258915 | 215 |
| 325 | 3300013105 | Ga0157369_10037455 | Ga0157369_100374555 | 215 |
| 326 | 3300013296 | Ga0157374_10004052 | Ga0157374_100040525 | 215 |
| 327 | 3300013296 | Ga0157374_10012763 | Ga0157374_100127636 | 215 |
| 328 | 3300013296 | Ga0157374_10091224 | Ga0157374_100912242 | 215 |
| 329 | 3300013297 | Ga0157378_10004743 | Ga0157378_100047435 | 215 |
| 330 | 3300013297 | Ga0157378_10006970 | Ga0157378_100069708 | 215 |
| 331 | 3300013306 | Ga0163162_10029816 | Ga0163162_100298165 | 215 |
| 332 | 3300013306 | Ga0163162_10071299 | Ga0163162_100712993 | 215 |
| 333 | 3300013306 | Ga0163162_10542209 | Ga0163162_105422092 | 215 |
| 334 | 3300013307 | Ga0157372_10001545 | Ga0157372_1000154514 | 215 |
| 335 | 3300013307 | Ga0157372_10002393 | Ga0157372_1000239312 | 215 |
| 336 | 3300013307 | Ga0157372_10007486 | Ga0157372_100074869 | 215 |
| 337 | 3300013307 | Ga0157372_10060097 | Ga0157372_100600974 | 215 |
| 338 | 3300013307 | Ga0157372_10091507 | Ga0157372_100915072 | 215 |
| 339 | 3300013307 | Ga0157372_10242097 | Ga0157372_102420972 | 215 |
| 340 | 3300013307 | Ga0157372_10405748 | Ga0157372_104057482 | 215 |
| 341 | 3300013307 | Ga0157372_10889359 | Ga0157372_108893592 | 215 |
| 342 | 3300013308 | Ga0157375_10026420 | Ga0157375_100264204 | 215 |
| 343 | 3300014325 | Ga0163163_10052244 | Ga0163163_100522444 | 215 |
| 344 | 3300014968 | Ga0157379_10033358 | Ga0157379_100333584 | 215 |
| 345 | 3300014968 | Ga0157379_10076747 | Ga0157379_100767473 | 215 |
| 346 | 3300014968 | Ga0157379_10115571 | Ga0157379_101155712 | 215 |
| 347 | 3300014968 | Ga0157379_10313915 | Ga0157379_103139152 | 215 |
| 348 | 3300022467 | Ga0224712_10125287 | Ga0224712_101252871 | 215 |
| 349 | 3300025226 | Ga0209674_107553 | Ga0209674_1075532 | 215 |
| 350 | 3300025246 | Ga0209646_1002515 | Ga0209646_10025152 | 215 |
| 351 | 3300025253 | Ga0209677_104671 | Ga0209677_1046713 | 215 |
| 352 | 3300025321 | Ga0207656_10001317 | Ga0207656_100013179 | 215 |
| 353 | 3300025711 | Ga0207696_1001183 | Ga0207696_10011837 | 215 |
| 354 | 3300025711 | Ga0207696_1005967 | Ga0207696_10059673 | 215 |
| 355 | 3300025735 | Ga0207713_1001574 | Ga0207713_100157412 | 215 |
| 356 | 3300025735 | Ga0207713_1002972 | Ga0207713_10029726 | 215 |
| 357 | 3300025735 | Ga0207713_1004528 | Ga0207713_10045284 | 215 |
| 358 | 3300025903 | Ga0207680_10020201 | Ga0207680_100202012 | 215 |
| 359 | 3300025903 | Ga0207680_10042436 | Ga0207680_100424362 | 215 |
| 360 | 3300025903 | Ga0207680_10121902 | Ga0207680_101219022 | 215 |
| 361 | 3300025903 | Ga0207680_10589050 | Ga0207680_105890501 | 215 |
| 362 | 3300025904 | Ga0207647_10000533 | Ga0207647_100005336 | 215 |
| 363 | 3300025904 | Ga0207647_10001255 | Ga0207647_100012557 | 215 |
| 364 | 3300025904 | Ga0207647_10001287 | Ga0207647_100012877 | 215 |
| 365 | 3300025904 | Ga0207647_10004812 | Ga0207647_100048128 | 215 |
| 366 | 3300025904 | Ga0207647_10009302 | Ga0207647_100093024 | 215 |
| 367 | 3300025904 | Ga0207647_10034680 | Ga0207647_100346801 | 215 |
| 368 | 3300025904 | Ga0207647_10073308 | Ga0207647_100733082 | 215 |
| 369 | 3300025906 | Ga0207699_10055032 | Ga0207699_100550322 | 215 |
| 370 | 3300025907 | Ga0207645_10099008 | Ga0207645_100990083 | 215 |
| 371 | 3300025909 | Ga0207705_10000183 | Ga0207705_1000018317 | 215 |
| 372 | 3300025909 | Ga0207705_10005143 | Ga0207705_100051439 | 215 |
| 373 | 3300025909 | Ga0207705_10006347 | Ga0207705_100063472 | 215 |
| 374 | 3300025909 | Ga0207705_10014072 | Ga0207705_100140724 | 215 |
| 375 | 3300025909 | Ga0207705_10016263 | Ga0207705_100162633 | 215 |
| 376 | 3300025909 | Ga0207705_10021461 | Ga0207705_100214615 | 215 |
| 377 | 3300025909 | Ga0207705_10024673 | Ga0207705_100246732 | 215 |
| 378 | 3300025909 | Ga0207705_10039743 | Ga0207705_100397432 | 215 |
| 379 | 3300025909 | Ga0207705_10068819 | Ga0207705_100688193 | 215 |
| 380 | 3300025909 | Ga0207705_10126101 | Ga0207705_101261012 | 215 |
| 381 | 3300025913 | Ga0207695_10007371 | Ga0207695_100073716 | 215 |
| 382 | 3300025913 | Ga0207695_10009491 | Ga0207695_100094919 | 215 |
| 383 | 3300025913 | Ga0207695_10009677 | Ga0207695_100096778 | 215 |
| 384 | 3300025913 | Ga0207695_10073646 | Ga0207695_100736464 | 215 |
| 385 | 3300025913 | Ga0207695_10540722 | Ga0207695_105407222 | 215 |
| 386 | 3300025914 | Ga0207671_10066875 | Ga0207671_100668751 | 215 |
| 387 | 3300025914 | Ga0207671_10477718 | Ga0207671_104777181 | 215 |
| 388 | 3300025917 | Ga0207660_10000226 | Ga0207660_1000022629 | 215 |
| 389 | 3300025917 | Ga0207660_10259849 | Ga0207660_102598492 | 215 |
| 390 | 3300025917 | Ga0207660_10478004 | Ga0207660_104780041 | 215 |
| 391 | 3300025917 | Ga0207660_10639778 | Ga0207660_106397782 | 215 |
| 392 | 3300025919 | Ga0207657_10005227 | Ga0207657_100052278 | 215 |
| 393 | 3300025919 | Ga0207657_10006755 | Ga0207657_100067556 | 215 |
| 394 | 3300025919 | Ga0207657_10010296 | Ga0207657_100102968 | 215 |
| 395 | 3300025919 | Ga0207657_10010572 | Ga0207657_100105729 | 215 |
| 396 | 3300025919 | Ga0207657_10027322 | Ga0207657_100273224 | 215 |
| 397 | 3300025919 | Ga0207657_10117272 | Ga0207657_101172722 | 215 |
| 398 | 3300025919 | Ga0207657_10308190 | Ga0207657_103081901 | 215 |
| 399 | 3300025919 | Ga0207657_10365857 | Ga0207657_103658572 | 215 |
| 400 | 3300025919 | Ga0207657_10414281 | Ga0207657_104142812 | 215 |
| 401 | 3300025919 | Ga0207657_10424743 | Ga0207657_104247431 | 215 |
| 402 | 3300025920 | Ga0207649_10001886 | Ga0207649_100018865 | 215 |
| 403 | 3300025920 | Ga0207649_10002637 | Ga0207649_100026372 | 215 |
| 404 | 3300025920 | Ga0207649_10137033 | Ga0207649_101370332 | 215 |
| 405 | 3300025920 | Ga0207649_10456364 | Ga0207649_104563641 | 215 |
| 406 | 3300025921 | Ga0207652_10332398 | Ga0207652_103323982 | 215 |
| 407 | 3300025923 | Ga0207681_10000144 | Ga0207681_1000014418 | 215 |
| 408 | 3300025923 | Ga0207681_10178111 | Ga0207681_101781112 | 215 |
| 409 | 3300025924 | Ga0207694_10023835 | Ga0207694_100238352 | 215 |
| 410 | 3300025924 | Ga0207694_10072118 | Ga0207694_100721183 | 215 |
| 411 | 3300025924 | Ga0207694_10349244 | Ga0207694_103492442 | 215 |
| 412 | 3300025925 | Ga0207650_10000261 | Ga0207650_100002618 | 215 |
| 413 | 3300025925 | Ga0207650_10086559 | Ga0207650_100865593 | 215 |
| 414 | 3300025925 | Ga0207650_10343460 | Ga0207650_103434602 | 215 |
| 415 | 3300025925 | Ga0207650_10404487 | Ga0207650_104044872 | 215 |
| 416 | 3300025928 | Ga0207700_10131690 | Ga0207700_101316903 | 215 |
| 417 | 3300025929 | Ga0207664_10019747 | Ga0207664_100197473 | 215 |
| 418 | 3300025931 | Ga0207644_10000640 | Ga0207644_100006405 | 215 |
| 419 | 3300025931 | Ga0207644_10001358 | Ga0207644_100013584 | 215 |
| 420 | 3300025931 | Ga0207644_10001973 | Ga0207644_1000197311 | 215 |
| 421 | 3300025931 | Ga0207644_10002363 | Ga0207644_100023632 | 215 |
| 422 | 3300025932 | Ga0207690_10001590 | Ga0207690_100015907 | 215 |
| 423 | 3300025932 | Ga0207690_10012337 | Ga0207690_100123373 | 215 |
| 424 | 3300025932 | Ga0207690_10017889 | Ga0207690_100178893 | 215 |
| 425 | 3300025932 | Ga0207690_10029935 | Ga0207690_100299352 | 215 |
| 426 | 3300025932 | Ga0207690_10053419 | Ga0207690_100534193 | 215 |
| 427 | 3300025932 | Ga0207690_10086578 | Ga0207690_100865782 | 215 |
| 428 | 3300025932 | Ga0207690_10093288 | Ga0207690_100932882 | 215 |
| 429 | 3300025932 | Ga0207690_10216335 | Ga0207690_102163352 | 215 |
| 430 | 3300025932 | Ga0207690_10250873 | Ga0207690_102508732 | 215 |
| 431 | 3300025933 | Ga0207706_10014667 | Ga0207706_100146677 | 215 |
| 432 | 3300025933 | Ga0207706_10037255 | Ga0207706_100372553 | 215 |
| 433 | 3300025933 | Ga0207706_10216527 | Ga0207706_102165272 | 215 |
| 434 | 3300025933 | Ga0207706_10339361 | Ga0207706_103393612 | 215 |
| 435 | 3300025933 | Ga0207706_10429320 | Ga0207706_104293202 | 215 |
| 436 | 3300025933 | Ga0207706_10646154 | Ga0207706_106461542 | 215 |
| 437 | 3300025933 | Ga0207706_10716967 | Ga0207706_107169672 | 215 |
| 438 | 3300025937 | Ga0207669_10000155 | Ga0207669_1000015522 | 215 |
| 439 | 3300025937 | Ga0207669_10027134 | Ga0207669_100271343 | 215 |
| 440 | 3300025937 | Ga0207669_10033144 | Ga0207669_100331443 | 215 |
| 441 | 3300025941 | Ga0207711_10000943 | Ga0207711_1000094314 | 215 |
| 442 | 3300025941 | Ga0207711_10627136 | Ga0207711_106271362 | 215 |
| 443 | 3300025941 | Ga0207711_10848837 | Ga0207711_108488371 | 215 |
| 444 | 3300025944 | Ga0207661_10164582 | Ga0207661_101645822 | 215 |
| 445 | 3300025945 | Ga0207679_10005401 | Ga0207679_100054015 | 215 |
| 446 | 3300025949 | Ga0207667_10004992 | Ga0207667_100049928 | 215 |
| 447 | 3300025949 | Ga0207667_10011952 | Ga0207667_100119522 | 215 |
| 448 | 3300025949 | Ga0207667_10013439 | Ga0207667_100134392 | 215 |
| 449 | 3300025949 | Ga0207667_10019030 | Ga0207667_100190303 | 215 |
| 450 | 3300025949 | Ga0207667_10019463 | Ga0207667_100194634 | 215 |
| 451 | 3300025949 | Ga0207667_10024535 | Ga0207667_100245355 | 215 |
| 452 | 3300025949 | Ga0207667_10025101 | Ga0207667_100251013 | 215 |
| 453 | 3300025960 | Ga0207651_10001400 | Ga0207651_100014005 | 215 |
| 454 | 3300025960 | Ga0207651_10227381 | Ga0207651_102273812 | 215 |
| 455 | 3300025961 | Ga0207712_10000034 | Ga0207712_10000034143 | 215 |
| 456 | 3300025972 | Ga0207668_10062973 | Ga0207668_100629733 | 215 |
| 457 | 3300025981 | Ga0207640_10000484 | Ga0207640_100004848 | 215 |
| 458 | 3300025981 | Ga0207640_10000660 | Ga0207640_1000066011 | 215 |
| 459 | 3300025981 | Ga0207640_10001733 | Ga0207640_100017339 | 215 |
| 460 | 3300025981 | Ga0207640_10002573 | Ga0207640_100025737 | 215 |
| 461 | 3300025981 | Ga0207640_10007730 | Ga0207640_100077304 | 215 |
| 462 | 3300025981 | Ga0207640_10013483 | Ga0207640_100134834 | 215 |
| 463 | 3300025981 | Ga0207640_10018957 | Ga0207640_100189573 | 215 |
| 464 | 3300025981 | Ga0207640_10086643 | Ga0207640_100866432 | 215 |
| 465 | 3300025986 | Ga0207658_10000216 | Ga0207658_1000021626 | 215 |
| 466 | 3300025986 | Ga0207658_10000239 | Ga0207658_100002398 | 215 |
| 467 | 3300026035 | Ga0207703_10280398 | Ga0207703_102803982 | 215 |
| 468 | 3300026041 | Ga0207639_10000621 | Ga0207639_100006216 | 215 |
| 469 | 3300026041 | Ga0207639_10000721 | Ga0207639_100007216 | 215 |
| 470 | 3300026041 | Ga0207639_10000839 | Ga0207639_1000083914 | 215 |
| 471 | 3300026041 | Ga0207639_10161603 | Ga0207639_101616032 | 215 |
| 472 | 3300026041 | Ga0207639_10180422 | Ga0207639_101804222 | 215 |
| 473 | 3300026041 | Ga0207639_10535474 | Ga0207639_105354742 | 215 |
| 474 | 3300026067 | Ga0207678_10001376 | Ga0207678_100013768 | 215 |
| 475 | 3300026067 | Ga0207678_10098127 | Ga0207678_100981272 | 215 |
| 476 | 3300026067 | Ga0207678_10267213 | Ga0207678_102672132 | 215 |
| 477 | 3300026078 | Ga0207702_10006922 | Ga0207702_100069227 | 215 |
| 478 | 3300026078 | Ga0207702_10007750 | Ga0207702_100077507 | 215 |
| 479 | 3300026078 | Ga0207702_10011419 | Ga0207702_100114196 | 215 |
| 480 | 3300026078 | Ga0207702_10027294 | Ga0207702_100272946 | 215 |
| 481 | 3300026078 | Ga0207702_10273248 | Ga0207702_102732482 | 215 |
| 482 | 3300026089 | Ga0207648_10118145 | Ga0207648_101181453 | 215 |
| 483 | 3300026095 | Ga0207676_10000036 | Ga0207676_1000003651 | 215 |
| 484 | 3300026116 | Ga0207674_10001997 | Ga0207674_100019976 | 215 |
| 485 | 3300026116 | Ga0207674_10015692 | Ga0207674_100156922 | 215 |
| 486 | 3300026116 | Ga0207674_10034227 | Ga0207674_100342274 | 215 |
| 487 | 3300026121 | Ga0207683_10375251 | Ga0207683_103752512 | 215 |
| 488 | 3300026142 | Ga0207698_10000814 | Ga0207698_1000081410 | 215 |
| 489 | 3300026142 | Ga0207698_10001384 | Ga0207698_100013846 | 215 |
| 490 | 3300026142 | Ga0207698_10012925 | Ga0207698_100129254 | 215 |
| 491 | 3300026142 | Ga0207698_10023612 | Ga0207698_100236122 | 215 |
| 492 | 3300026142 | Ga0207698_10025849 | Ga0207698_100258493 | 215 |
| 493 | 3300026142 | Ga0207698_10192973 | Ga0207698_101929732 | 215 |
| 494 | 3300026142 | Ga0207698_10249883 | Ga0207698_102498832 | 215 |
| 495 | 3300026142 | Ga0207698_10276123 | Ga0207698_102761232 | 215 |
| 496 | 3300026142 | Ga0207698_10287481 | Ga0207698_102874812 | 215 |
| 497 | 3300026142 | Ga0207698_10349043 | Ga0207698_103490432 | 215 |
| 498 | 3300026142 | Ga0207698_10352644 | Ga0207698_103526442 | 215 |
| 499 | 3300028379 | Ga0268266_10001825 | Ga0268266_100018256 | 215 |
| 500 | 3300028379 | Ga0268266_10047375 | Ga0268266_100473753 | 215 |
| 501 | 3300028380 | Ga0268265_10000059 | Ga0268265_100000594 | 215 |
| 502 | 3300028380 | Ga0268265_10516327 | Ga0268265_105163271 | 215 |
| 503 | 3300028381 | Ga0268264_10018435 | Ga0268264_100184353 | 215 |
| 504 | 3300028381 | Ga0268264_10369870 | Ga0268264_103698702 | 215 |
| 505 | 3300031548 | Ga0307408_100003693 | Ga0307408_1000036938 | 215 |
| 506 | 3300031548 | Ga0307408_100032581 | Ga0307408_1000325814 | 215 |
| 507 | 3300031548 | Ga0307408_100104155 | Ga0307408_1001041551 | 215 |
| 508 | 3300031548 | Ga0307408_100392564 | Ga0307408_1003925641 | 215 |
| 509 | 3300031548 | Ga0307408_100754635 | Ga0307408_1007546351 | 215 |
| 510 | 3300031731 | Ga0307405_10000174 | Ga0307405_1000017412 | 215 |
| 511 | 3300031731 | Ga0307405_10001858 | Ga0307405_100018583 | 215 |
| 512 | 3300031731 | Ga0307405_10001976 | Ga0307405_100019766 | 215 |
| 513 | 3300031824 | Ga0307413_10012203 | Ga0307413_100122032 | 215 |
| 514 | 3300031852 | Ga0307410_10007381 | Ga0307410_100073812 | 215 |
| 515 | 3300031852 | Ga0307410_10053954 | Ga0307410_100539542 | 215 |
| 516 | 3300031901 | Ga0307406_10004487 | Ga0307406_100044876 | 215 |
| 517 | 3300031901 | Ga0307406_10007389 | Ga0307406_100073895 | 215 |
| 518 | 3300031901 | Ga0307406_10109431 | Ga0307406_101094312 | 215 |
| 519 | 3300031903 | Ga0307407_10014063 | Ga0307407_100140634 | 215 |
| 520 | 3300031911 | Ga0307412_10000500 | Ga0307412_1000050012 | 215 |
| 521 | 3300031911 | Ga0307412_10003675 | Ga0307412_1000367511 | 215 |
| 522 | 3300031911 | Ga0307412_10006740 | Ga0307412_100067405 | 215 |
| 523 | 3300031911 | Ga0307412_10085419 | Ga0307412_100854192 | 215 |
| 524 | 3300031995 | Ga0307409_100004973 | Ga0307409_1000049735 | 215 |
| 525 | 3300031995 | Ga0307409_100012521 | Ga0307409_1000125214 | 215 |
| 526 | 3300031995 | Ga0307409_100056801 | Ga0307409_1000568012 | 215 |
| 527 | 3300032002 | Ga0307416_100004298 | Ga0307416_1000042986 | 215 |
| 528 | 3300032002 | Ga0307416_100032322 | Ga0307416_1000323222 | 215 |
| 529 | 3300032002 | Ga0307416_100087623 | Ga0307416_1000876233 | 215 |
| 530 | 3300032004 | Ga0307414_10000935 | Ga0307414_1000093511 | 215 |
| 531 | 3300032004 | Ga0307414_10065845 | Ga0307414_100658452 | 215 |
| 532 | 3300032005 | Ga0307411_10010420 | Ga0307411_100104202 | 215 |
| 533 | 3300032005 | Ga0307411_10026299 | Ga0307411_100262993 | 215 |
| 534 | 3300032005 | Ga0307411_10079588 | Ga0307411_100795883 | 215 |
| 535 | 3300032005 | Ga0307411_10372986 | Ga0307411_103729862 | 215 |
| 536 | 3300032126 | Ga0307415_100022584 | Ga0307415_1000225843 | 215 |
| 537 | 3300032126 | Ga0307415_100074490 | Ga0307415_1000744902 | 215 |
| 538 | 3300032126 | Ga0307415_100288666 | Ga0307415_1002886662 | 215 |
| 539 | 3300032126 | Ga0307415_100589085 | Ga0307415_1005890852 | 215 |
| 540 | 3300033180 | Ga0307510_10020209 | Ga0307510_100202093 | 215 |
| 541 | 3300037312 | Ga0395899_0000931 | Ga0395899_0000931_13547_14194 | 215 |
| 542 | 3300037312 | Ga0395899_0002700 | Ga0395899_0002700_5181_5828 | 215 |
| 543 | 3300037312 | Ga0395899_0007403 | Ga0395899_0007403_1242_1889 | 215 |
| 544 | 3300037312 | Ga0395899_0009872 | Ga0395899_0009872_1107_1754 | 215 |
| 545 | 3300037312 | Ga0395899_0019600 | Ga0395899_0019600_4340_4987 | 215 |
| 546 | 3300037312 | Ga0395899_0030693 | Ga0395899_0030693_85_732 | 215 |
| 547 | 3300037312 | Ga0395899_0066777 | Ga0395899_0066777_104_751 | 215 |
| 548 | 3300037312 | Ga0395899_0074654 | Ga0395899_0074654_1296_1943 | 215 |
| 549 | 3300037418 | Ga0395900_0001129 | Ga0395900_0001129_19618_20265 | 215 |
| 550 | 3300037418 | Ga0395900_0010107 | Ga0395900_0010107_153_800 | 215 |
| 551 | 3300037418 | Ga0395900_0010785 | Ga0395900_0010785_442_1089 | 215 |
| 552 | 3300037418 | Ga0395900_0012806 | Ga0395900_0012806_5632_6279 | 215 |
| 553 | 3300037418 | Ga0395900_0029934 | Ga0395900_0029934_1605_2252 | 215 |
| 554 | 3300037418 | Ga0395900_0062174 | Ga0395900_0062174_857_1504 | 215 |
| 555 | 3300037418 | Ga0395900_0067773 | Ga0395900_0067773_103_750 | 215 |
| 556 | 3300037418 | Ga0395900_0100262 | Ga0395900_0100262_849_1496 | 215 |
| 557 | 3300037418 | Ga0395900_0189883 | Ga0395900_0189883_782_1429 | 215 |
| 558 | 3300037418 | Ga0395900_0431123 | Ga0395900_0431123_433_1080 | 215 |
| 559 | 3300037418 | Ga0395900_0457429 | Ga0395900_0457429_430_1077 | 215 |
| 560 | 3300037466 | Ga0395898_0001152 | Ga0395898_0001152_26343_26990 | 215 |
| 561 | 3300037466 | Ga0395898_0001704 | Ga0395898_0001704_24396_25043 | 215 |
| 562 | 3300037466 | Ga0395898_0009910 | Ga0395898_0009910_8982_9629 | 215 |
| 563 | 3300037466 | Ga0395898_0045237 | Ga0395898_0045237_1223_1870 | 215 |
| 564 | 3300037466 | Ga0395898_0093909 | Ga0395898_0093909_166_813 | 215 |
| 565 | 3300037466 | Ga0395898_0101651 | Ga0395898_0101651_130_777 | 215 |
| 566 | 3300037471 | Ga0395905_0001384 | Ga0395905_0001384_13269_13916 | 215 |
| 567 | 3300037471 | Ga0395905_0002955 | Ga0395905_0002955_1316_1963 | 215 |
| 568 | 3300037471 | Ga0395905_0007880 | Ga0395905_0007880_8368_9015 | 215 |
| 569 | 3300037471 | Ga0395905_0013174 | Ga0395905_0013174_2442_3089 | 215 |
| 570 | 3300037471 | Ga0395905_0035368 | Ga0395905_0035368_3264_3911 | 215 |
| 571 | 3300037471 | Ga0395905_0053985 | Ga0395905_0053985_1146_1793 | 215 |
| 572 | 3300037471 | Ga0395905_0057964 | Ga0395905_0057964_2559_3206 | 215 |
| 573 | 3300037471 | Ga0395905_0085437 | Ga0395905_0085437_900_1547 | 215 |
| 574 | 3300037471 | Ga0395905_0614794 | Ga0395905_0614794_315_962 | 215 |
| 575 | 3300037471 | Ga0395905_0966875 | Ga0395905_0966875_27_674 | 215 |
| 576 | 3300037471 | Ga0395905_1122887 | Ga0395905_1122887_11_658 | 215 |
| 577 | 3300038443 | Ga0395901_0000386 | Ga0395901_0000386_38665_39312 | 215 |
| 578 | 3300038443 | Ga0395901_0006002 | Ga0395901_0006002_7481_8128 | 215 |
| 579 | 3300038443 | Ga0395901_0010596 | Ga0395901_0010596_2117_2764 | 215 |
| 580 | 3300038443 | Ga0395901_0017423 | Ga0395901_0017423_50_697 | 215 |
| 581 | 3300038443 | Ga0395901_0026413 | Ga0395901_0026413_4403_5050 | 215 |
| 582 | 3300038443 | Ga0395901_0114106 | Ga0395901_0114106_713_1360 | 215 |
| 583 | 3300038443 | Ga0395901_0182610 | Ga0395901_0182610_797_1444 | 215 |
| 584 | 3300038443 | Ga0395901_0387353 | Ga0395901_0387353_179_826 | 215 |
| 585 | 3300038443 | Ga0395901_0499546 | Ga0395901_0499546_565_1212 | 215 |
| 586 | 3300038443 | Ga0395901_0542402 | Ga0395901_0542402_506_1153 | 215 |
| 587 | 3300044684 | Ga0466966_0037161 | Ga0466966_0037161_1770_2417 | 215 |
| 588 | 3300044693 | Ga0466961_0041607 | Ga0466961_0041607_448_1095 | 215 |
| 589 | 3300044694 | Ga0466963_0581091 | Ga0466963_0581091_116_763 | 215 |
| 590 | 3300044842 | Ga0466957_0001787 | Ga0466957_0001787_9192_9839 | 215 |
| 591 | 3300045836 | Ga0466958_0042568 | Ga0466958_0042568_1187_1834 | 215 |
| 592 | 3300045976 | Ga0466967_0424086 | Ga0466967_0424086_86_733 | 215 |
| 593 | 3300046460 | Ga0495638_0000068 | Ga0495638_0000068_134774_135421 | 215 |
| 594 | 3300046460 | Ga0495638_0422830 | Ga0495638_0422830_19_666 | 215 |
| 595 | 3300046492 | Ga0495585_0071943 | Ga0495585_0071943_20_667 | 215 |
| 596 | 3300046506 | Ga0495583_0000269 | Ga0495583_0000269_80855_81502 | 215 |
| 597 | 3300046507 | Ga0495606_0036990 | Ga0495606_0036990_1583_2230 | 215 |
| 598 | 3300046512 | Ga0495610_0000082 | Ga0495610_0000082_105505_106152 | 215 |
| 599 | 3300046512 | Ga0495610_0000243 | Ga0495610_0000243_38037_38684 | 215 |
| 600 | 3300046515 | Ga0495620_0003625 | Ga0495620_0003625_5720_6367 | 215 |
| 601 | 3300046519 | Ga0495632_0005949 | Ga0495632_0005949_5315_5962 | 215 |
| 602 | 3300046522 | Ga0495643_0000561 | Ga0495643_0000561_29671_30318 | 215 |
| 603 | 3300046524 | Ga0495648_0000046 | Ga0495648_0000046_134737_135384 | 215 |
| 604 | 3300046558 | Ga0495633_0005860 | Ga0495633_0005860_3735_4382 | 215 |
| 605 | 3300046558 | Ga0495633_0019674 | Ga0495633_0019674_2479_3126 | 215 |
| 606 | 3300046660 | Ga0495625_0000832 | Ga0495625_0000832_29329_29976 | 215 |
| 607 | 3300046692 | Ga0495671_0000057 | Ga0495671_0000057_81062_81709 | 215 |
| 608 | 3300047320 | Ga0495672_0038842 | Ga0495672_0038842_287_934 | 215 |
| 609 | 3300047323 | Ga0495683_0005724 | Ga0495683_0005724_177_857 | 215 |
| 610 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_42955_43602 | 215 |
| 611 | 3300047469 | Ga0495673_0000110 | Ga0495673_0000110_133080_133727 | 215 |
| 612 | 3300048091 | Ga0495626_0001225 | Ga0495626_0001225_11224_11871 | 215 |
| 613 | 3300048903 | Ga0496100_0001143 | Ga0496100_0001143_4216_4863 | 215 |
| 614 | 3300048904 | Ga0496101_0004565 | Ga0496101_0004565_839_1486 | 215 |
| 615 | 3300048904 | Ga0496101_0006709 | Ga0496101_0006709_1751_2398 | 215 |
| 616 | 3300048905 | Ga0496102_0000698 | Ga0496102_0000698_17263_17910 | 215 |
| 617 | 3300048906 | Ga0496103_0000258 | Ga0496103_0000258_34795_35442 | 215 |
| 618 | 3300048907 | Ga0496104_0000675 | Ga0496104_0000675_13517_14164 | 215 |
| 619 | 3300048907 | Ga0496104_0017956 | Ga0496104_0017956_2390_3037 | 215 |
| 620 | 3300048908 | Ga0496105_0000184 | Ga0496105_0000184_13534_14181 | 215 |
| 621 | 3300048908 | Ga0496105_0003801 | Ga0496105_0003801_8468_9115 | 215 |
| 622 | 3300048910 | Ga0496107_0355793 | Ga0496107_0355793_364_1011 | 215 |
| 623 | 3300048912 | Ga0496109_0002925 | Ga0496109_0002925_2485_3132 | 215 |
| 624 | 3300048912 | Ga0496109_0005801 | Ga0496109_0005801_5493_6140 | 215 |
| 625 | 3300048914 | Ga0496111_0012485 | Ga0496111_0012485_4961_5608 | 215 |
| 626 | 3300048915 | Ga0496112_0001054 | Ga0496112_0001054_17433_18080 | 215 |
| 627 | 3300048915 | Ga0496112_0015723 | Ga0496112_0015723_1393_2040 | 215 |
| 628 | 3300048915 | Ga0496112_0025699 | Ga0496112_0025699_767_1414 | 215 |
| 629 | 3300048916 | Ga0496113_0001048 | Ga0496113_0001048_6337_6984 | 215 |
| 630 | 3300048917 | Ga0496114_0213160 | Ga0496114_0213160_532_1179 | 215 |
| 631 | 3300048919 | Ga0496116_0001606 | Ga0496116_0001606_9769_10416 | 215 |
| 632 | 3300048919 | Ga0496116_0006963 | Ga0496116_0006963_8717_9364 | 215 |
| 633 | 3300048919 | Ga0496116_0019186 | Ga0496116_0019186_203_850 | 215 |
| 634 | 3300048920 | Ga0496117_0001983 | Ga0496117_0001983_11044_11691 | 215 |
| 635 | 3300048920 | Ga0496117_0006616 | Ga0496117_0006616_688_1335 | 215 |
| 636 | 3300048920 | Ga0496117_0047668 | Ga0496117_0047668_1454_2101 | 215 |
| 637 | 3300048921 | Ga0496118_0000335 | Ga0496118_0000335_19318_19983 | 215 |
| 638 | 3300048921 | Ga0496118_0002186 | Ga0496118_0002186_11044_11691 | 215 |
| 639 | 3300048921 | Ga0496118_0007403 | Ga0496118_0007403_688_1335 | 215 |
| 640 | 3300048921 | Ga0496118_0076912 | Ga0496118_0076912_1185_1832 | 215 |
| 641 | 3300048922 | Ga0496119_0001028 | Ga0496119_0001028_21570_22217 | 215 |
| 642 | 3300048922 | Ga0496119_0006485 | Ga0496119_0006485_27_674 | 215 |
| 643 | 3300048923 | Ga0496120_0000961 | Ga0496120_0000961_29693_30340 | 215 |
| 644 | 3300048923 | Ga0496120_0039250 | Ga0496120_0039250_713_1360 | 215 |
| 645 | 3300048924 | Ga0496121_0006115 | Ga0496121_0006115_3482_4129 | 215 |
| 646 | 3300048924 | Ga0496121_0006397 | Ga0496121_0006397_13750_14397 | 215 |
| 647 | 3300048924 | Ga0496121_0012699 | Ga0496121_0012699_6042_6689 | 215 |
| 648 | 3300048925 | Ga0496122_0001573 | Ga0496122_0001573_11138_11785 | 215 |
| 649 | 3300048925 | Ga0496122_0002945 | Ga0496122_0002945_7065_7712 | 215 |
| 650 | 3300048925 | Ga0496122_0054532 | Ga0496122_0054532_145_792 | 215 |
| 651 | 3300048926 | Ga0496123_0000428 | Ga0496123_0000428_64077_64724 | 215 |
| 652 | 3300048926 | Ga0496123_0003956 | Ga0496123_0003956_7562_8209 | 215 |
| 653 | 3300048927 | Ga0496124_0002149 | Ga0496124_0002149_22799_23446 | 215 |
| 654 | 3300048927 | Ga0496124_0004303 | Ga0496124_0004303_12287_12934 | 215 |
| 655 | 3300048927 | Ga0496124_0007434 | Ga0496124_0007434_688_1335 | 215 |
| 656 | 3300048927 | Ga0496124_0014032 | Ga0496124_0014032_2100_2747 | 215 |
| 657 | 3300048928 | Ga0496125_0003189 | Ga0496125_0003189_16603_17250 | 215 |
| 658 | 3300048928 | Ga0496125_0004588 | Ga0496125_0004588_7957_8604 | 215 |
| 659 | 3300048928 | Ga0496125_0018222 | Ga0496125_0018222_851_1498 | 215 |
| 660 | 3300048928 | Ga0496125_0046502 | Ga0496125_0046502_2555_3202 | 215 |
| 661 | 3300048928 | Ga0496125_0133927 | Ga0496125_0133927_975_1622 | 215 |
| 662 | 3300048929 | Ga0496126_0000158 | Ga0496126_0000158_30095_30742 | 215 |
| 663 | 3300048929 | Ga0496126_0002026 | Ga0496126_0002026_9824_10471 | 215 |
| 664 | 3300049551 | Ga0501335_000249 | Ga0501335_000249_333_980 | 215 |
| 665 | 3300049574 | Ga0501038_0003137 | Ga0501038_0003137_13408_14055 | 215 |
| 666 | 3300049653 | Ga0501206_000989 | Ga0501206_000989_471_1118 | 215 |
| 667 | 3300049664 | Ga0501224_004528 | Ga0501224_004528_202_849 | 215 |
| 668 | 3300049669 | Ga0501235_000092 | Ga0501235_000092_3071_3718 | 215 |
| 669 | 3300049670 | Ga0501236_000884 | Ga0501236_000884_1545_2192 | 215 |
| 670 | 3300049705 | Ga0501225_0002260 | Ga0501225_0002260_4652_5299 | 215 |
| 671 | 3300049708 | Ga0501245_000867 | Ga0501245_000867_3068_3715 | 215 |
| 672 | 3300050491 | nmdc:mga00v17_19848_c1 | nmdc:mga00v17_19848_c1_3051_3698 | 215 |
| 673 | 3300050508 | nmdc:mga09592_36160_c1 | nmdc:mga09592_36160_c1_3264_3911 | 215 |
| 674 | 3300053088 | Ga0500644_0116068 | Ga0500644_0116068_153_800 | 215 |
| 675 | 3300053118 | Ga0500594_0001846 | Ga0500594_0001846_164_811 | 215 |
| 676 | 3300053122 | Ga0500608_058548 | Ga0500608_058548_265_912 | 215 |
| 677 | 3300053148 | Ga0500590_003777 | Ga0500590_003777_5641_6291 | 215 |
| 678 | 3300053156 | Ga0500622_0028672 | Ga0500622_0028672_602_1252 | 215 |
| 679 | 3300053157 | Ga0500624_000361 | Ga0500624_000361_12937_13584 | 215 |
| 680 | 3300053735 | Ga0500596_000488 | Ga0500596_000488_4379_5026 | 215 |
| 681 | 3300061719 | Ga0466962_0108093 | Ga0466962_0108093_23_670 | 215 |
| 682 | iso_pu_bacteria | 8057101203 | 8057105141 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dd0-assembly2.cif.gz_D | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.901 | 2 | 214 |
| 7dd0-assembly2.cif.gz_B | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8977 | 2 | 214 |
| 7k2t-assembly1.cif.gz_C | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.8914 | 1 | 214 |
| 7dd0-assembly1.cif.gz_A | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8907 | 2 | 214 |
| 7dd0-assembly2.cif.gz_D | crystal structure of the n-terminal domain of tagh from bacillus subtilis | 0.8893 | 2 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2L1_4_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8984 | 1 | 214 | 3.40.50.300 |
| af_Q2G2L1_4_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8906 | 1 | 214 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8751 | 2 | 202 | 3.40.50.300 |
| af_P16679_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8747 | 1 | 194 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8664 | 2 | 63 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G4RK67-F1-model_v4 | ABC transporter domain-containing protein | 0.9512 | 1 | 214 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-A0A7X4K8Y7-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9503 | 1 | 215 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-A0A7X4K8Y7-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9461 | 1 | 215 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-A0A7G4RK67-F1-model_v4 | ABC transporter domain-containing protein | 0.9426 | 1 | 214 |
GO:0005524
GO:0016020 GO:0016887 GO:0140359 |
| AF-Q93UJ9-F1-model_v4 | Wzt2 | 0.9324 | 5 | 214 |
GO:0005524
GO:0005886 GO:0016887 GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar