F474907

General Info

Members Datasets Scaffolds Average Seq Length
682 237 672 213

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10003629|Ga0157371_100036297
Length 202
Sequence MIVCEKVSKSYPMGRGRKHVLKDVDLEIRPGEHIGFLGRNGAGKTTFIKLIGGVELATSGKIRRQMSVSWPLGFGGGFQGSLTGYDNARFIARIYIRELGPQLKMPVKTYSSGMRARLAFALSLAIEFECYLIDEVIMVGDSNFQRKCHYELFDKRGDRALIFASHSTDLIREYCNRAMVLHGGTGTMYTDINQALEIYASL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
3 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
4 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
5 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
9 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
220 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0.29
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 2.79
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_209976 2162886007 Bacteria 2656
2 JGI24736J21556_1000069 3300001904 Bacteria 16830
3 JGI24752J21851_1000086 3300001976 Bacteria 12364
4 JGI24740J21852_10003151 3300001979 Bacteria 7278
5 JGI24740J21852_10020269 3300001979 Bacteria 2323
6 JGI24737J22298_10001229 3300001990 Bacteria 9037
7 JGI24737J22298_10077900 3300001990 Bacteria 988
8 JGI24735J21928_10001501 3300002067 Bacteria 8259
9 Ga0065704_10000277 3300005289 Bacteria 104842
10 Ga0065704_10073718 3300005289 Bacteria 6846
11 Ga0065704_10090188 3300005289 Bacteria 2806
12 Ga0065707_10085857 3300005295 Bacteria 5847
13 Ga0065707_10092635 3300005295 Bacteria 3742
14 Ga0070658_10002371 3300005327 Bacteria 15809
15 Ga0070658_10003386 3300005327 Bacteria 13130
16 Ga0070658_10008650 3300005327 Bacteria 8179
17 Ga0070658_10009192 3300005327 Bacteria 7946
18 Ga0070658_10016647 3300005327 Bacteria 5884
19 Ga0070658_10033089 3300005327 Bacteria 4158
20 Ga0070658_10092331 3300005327 Bacteria 2496
21 Ga0070658_10163673 3300005327 Bacteria 1867
22 Ga0070676_10116723 3300005328 Bacteria 1670
23 Ga0070676_10121621 3300005328 Unclassified 1639
24 Ga0070683_100003584 3300005329 Bacteria 12636
25 Ga0070683_100010674 3300005329 Bacteria 7898
26 Ga0070690_100004211 3300005330 Bacteria 7962
27 Ga0070670_100000215 3300005331 Bacteria 53387
28 Ga0070670_100167033 3300005331 Bacteria 1908
29 Ga0070670_100169353 3300005331 Bacteria 1895
30 Ga0070666_10005604 3300005335 Bacteria 7704
31 Ga0070666_10013523 3300005335 Bacteria 5180
32 Ga0070666_10020911 3300005335 Bacteria 4236
33 Ga0070666_10026096 3300005335 Bacteria 3814
34 Ga0070666_10073215 3300005335 Bacteria 2334
35 Ga0070680_100000271 3300005336 Bacteria 34443
36 Ga0070680_100184717 3300005336 Bacteria 1756
37 Ga0070680_100269167 3300005336 Bacteria 1442
38 Ga0070680_100541703 3300005336 Bacteria 997
39 Ga0068868_100002030 3300005338 Bacteria 13918
40 Ga0068868_100022820 3300005338 Bacteria 4729
41 Ga0068868_100156144 3300005338 Bacteria 1882
42 Ga0070660_100000883 3300005339 Bacteria 20045
43 Ga0070660_100002324 3300005339 Bacteria 13066
44 Ga0070660_100002881 3300005339 Bacteria 11832
45 Ga0070660_100006448 3300005339 Bacteria 8136
46 Ga0070660_100043823 3300005339 Bacteria 3420
47 Ga0070660_100116309 3300005339 Unclassified 2132
48 Ga0070660_100126519 3300005339 Bacteria 2042
49 Ga0070660_100140029 3300005339 Bacteria 1940
50 Ga0070660_100384335 3300005339 Bacteria 1159
51 Ga0070660_100390546 3300005339 Bacteria 1149
52 Ga0070660_100503957 3300005339 Bacteria 1007
53 Ga0070691_10050964 3300005341 Bacteria 1975
54 Ga0070661_100001010 3300005344 Bacteria 19938
55 Ga0070661_100007206 3300005344 Bacteria 7663
56 Ga0070661_100025661 3300005344 Bacteria 4237
57 Ga0070661_100029372 3300005344 Bacteria 3968
58 Ga0070661_100037618 3300005344 Bacteria 3521
59 Ga0070661_100092981 3300005344 Bacteria 2235
60 Ga0070661_100175315 3300005344 Unclassified 1629
61 Ga0070668_100007830 3300005347 Bacteria 7935
62 Ga0070669_100000039 3300005353 Bacteria 135033
63 Ga0070669_100191322 3300005353 Bacteria 1605
64 Ga0070671_100001504 3300005355 Bacteria 17449
65 Ga0070671_100001971 3300005355 Bacteria 15750
66 Ga0070671_100007512 3300005355 Bacteria 8713
67 Ga0070671_100007581 3300005355 Bacteria 8678
68 Ga0070671_100009223 3300005355 Bacteria 7926
69 Ga0070671_100315756 3300005355 Bacteria 1331
70 Ga0070674_100014847 3300005356 Bacteria 4848
71 Ga0070674_100023869 3300005356 Bacteria 3965
72 Ga0070674_100124350 3300005356 Bacteria 1913
73 Ga0070673_100001803 3300005364 Bacteria 12772
74 Ga0070673_100005453 3300005364 Bacteria 8144
75 Ga0070673_100047642 3300005364 Bacteria 3336
76 Ga0070673_100115036 3300005364 Bacteria 2236
77 Ga0070673_100128862 3300005364 Bacteria 2120
78 Ga0070673_100420972 3300005364 Bacteria 1197
79 Ga0070659_100001788 3300005366 Bacteria 15469
80 Ga0070659_100003421 3300005366 Bacteria 11309
81 Ga0070659_100004990 3300005366 Bacteria 9505
82 Ga0070659_100016215 3300005366 Bacteria 5591
83 Ga0070659_100024439 3300005366 Bacteria 4632
84 Ga0070659_100037487 3300005366 Bacteria 3779
85 Ga0070659_100059584 3300005366 Bacteria 3014
86 Ga0070659_100133576 3300005366 Bacteria 2017
87 Ga0070659_100224515 3300005366 Bacteria 1551
88 Ga0070659_100293781 3300005366 Unclassified 1353
89 Ga0070659_100443507 3300005366 Unclassified 1100
90 Ga0070667_100000311 3300005367 Bacteria 54491
91 Ga0070667_100000719 3300005367 Bacteria 31865
92 Ga0070709_10267657 3300005434 Bacteria 1237
93 Ga0070714_100015990 3300005435 Bacteria 6050
94 Ga0070714_100017633 3300005435 Bacteria 5787
95 Ga0070714_100043916 3300005435 Bacteria 3782
96 Ga0070714_100194819 3300005435 Bacteria 1851
97 Ga0070713_100009084 3300005436 Bacteria 7089
98 Ga0070713_100017413 3300005436 Bacteria 5434
99 Ga0070711_100005496 3300005439 Bacteria 7583
100 Ga0070663_100000485 3300005455 Bacteria 20967
101 Ga0070663_100001726 3300005455 Bacteria 12124
102 Ga0070663_100032754 3300005455 Bacteria 3585
103 Ga0070663_100069410 3300005455 Unclassified 2560
104 Ga0070678_100364920 3300005456 Bacteria 1245
105 Ga0070678_100964548 3300005456 Bacteria 782
106 Ga0070662_100008303 3300005457 Bacteria 6765
107 Ga0070662_100024960 3300005457 Bacteria 4124
108 Ga0070662_100144743 3300005457 Bacteria 1845
109 Ga0068867_100038525 3300005459 Bacteria 3480
110 Ga0068867_100983110 3300005459 Bacteria 764
111 Ga0070685_10067688 3300005466 Bacteria 2107
112 Ga0070679_100258359 3300005530 Bacteria 1697
113 Ga0070679_100278089 3300005530 Bacteria 1627
114 Ga0070679_100622792 3300005530 Bacteria 1022
115 Ga0070684_100008271 3300005535 Bacteria 8132
116 Ga0070684_100059971 3300005535 Bacteria 3327
117 Ga0068853_100000755 3300005539 Bacteria 22437
118 Ga0068853_100002226 3300005539 Bacteria 14500
119 Ga0068853_100002488 3300005539 Bacteria 13807
120 Ga0068853_100069436 3300005539 Bacteria 3065
121 Ga0068853_100154217 3300005539 Bacteria 2069
122 Ga0068853_100248810 3300005539 Bacteria 1630
123 Ga0068853_100318504 3300005539 Bacteria 1441
124 Ga0070672_100050476 3300005543 Bacteria 3240
125 Ga0070672_100071237 3300005543 Bacteria 2764
126 Ga0070672_100229482 3300005543 Bacteria 1559
127 Ga0070686_100196102 3300005544 Bacteria 1444
128 Ga0070665_100003111 3300005548 Bacteria 17877
129 Ga0070665_100064524 3300005548 Bacteria 3673
130 Ga0068855_100006702 3300005563 Bacteria 13973
131 Ga0068855_100010156 3300005563 Bacteria 11347
132 Ga0068855_100014166 3300005563 Bacteria 9607
133 Ga0068855_100017947 3300005563 Bacteria 8503
134 Ga0068855_100018598 3300005563 Bacteria 8357
135 Ga0068855_100029847 3300005563 Bacteria 6520
136 Ga0068855_100050067 3300005563 Plasmid 4924
137 Ga0068855_100112216 3300005563 Unclassified 3128
138 Ga0068855_100164447 3300005563 Bacteria 2516
139 Ga0068855_100212465 3300005563 Bacteria 2173
140 Ga0070664_100022088 3300005564 Bacteria 5247
141 Ga0070664_100059697 3300005564 Bacteria 3245
142 Ga0068857_100000856 3300005577 Bacteria 22822
143 Ga0068857_100010170 3300005577 Bacteria 8179
144 Ga0068857_100012150 3300005577 Bacteria 7490
145 Ga0068857_100190028 3300005577 Bacteria 1870
146 Ga0068854_100001288 3300005578 Bacteria 15095
147 Ga0068854_100001536 3300005578 Bacteria 14009
148 Ga0068854_100003540 3300005578 Bacteria 9761
149 Ga0068854_100009272 3300005578 Bacteria 6351
150 Ga0068854_100009525 3300005578 Bacteria 6271
151 Ga0068854_100020148 3300005578 Bacteria 4507
152 Ga0068854_100060809 3300005578 Bacteria 2734
153 Ga0068854_100100547 3300005578 Unclassified 2167
154 Ga0068854_100205013 3300005578 Bacteria 1552
155 Ga0068854_100313945 3300005578 Bacteria 1272
156 Ga0068856_100009429 3300005614 Bacteria 9477
157 Ga0068856_100010950 3300005614 Bacteria 8802
158 Ga0068856_100020465 3300005614 Bacteria 6427
159 Ga0068856_100031496 3300005614 Bacteria 5189
160 Ga0068856_100103740 3300005614 Unclassified 2837
161 Ga0068856_100326405 3300005614 Bacteria 1552
162 Ga0068856_100677498 3300005614 Bacteria 1052
163 Ga0068852_100000868 3300005616 Bacteria 20021
164 Ga0068852_100003221 3300005616 Bacteria 11400
165 Ga0068852_100005448 3300005616 Bacteria 9100
166 Ga0068852_100013235 3300005616 Bacteria 6306
167 Ga0068852_100016397 3300005616 Bacteria 5775
168 Ga0068852_100068911 3300005616 Bacteria 3098
169 Ga0068852_100094533 3300005616 Bacteria 2682
170 Ga0068852_100098578 3300005616 Bacteria 2632
171 Ga0068852_100194699 3300005616 Bacteria 1915
172 Ga0068852_100317230 3300005616 Bacteria 1513
173 Ga0068852_100317852 3300005616 Bacteria 1511
174 Ga0068852_100327642 3300005616 Bacteria 1489
175 Ga0068852_100403149 3300005616 Bacteria 1346
176 Ga0068852_100485478 3300005616 Unclassified 1228
177 Ga0068852_100513864 3300005616 Bacteria 1194
178 Ga0068864_100000080 3300005618 Bacteria 102508
179 Ga0068851_10042741 3300005834 Bacteria 2282
180 Ga0068851_10162574 3300005834 Bacteria 1227
181 Ga0068851_10215259 3300005834 Bacteria 1077
182 Ga0068863_100000087 3300005841 Bacteria 102508
183 Ga0068858_100034153 3300005842 Bacteria 4717
184 Ga0068858_100472075 3300005842 Bacteria 1210
185 Ga0068860_100029152 3300005843 Bacteria 5309
186 Ga0068860_100393568 3300005843 Bacteria 1370
187 Ga0068862_100000101 3300005844 Bacteria 102508
188 Ga0068862_100032334 3300005844 Bacteria 4420
189 Ga0075364_10089606 3300006051 Bacteria 2040
190 Ga0075364_10400652 3300006051 Bacteria 936
191 Ga0070712_100050193 3300006175 Bacteria 2901
192 Ga0097621_100012206 3300006237 Bacteria 6357
193 Ga0068871_100001517 3300006358 Bacteria 15555
194 Ga0068871_100106748 3300006358 Bacteria 2351
195 Ga0075429_100027480 3300006880 Bacteria 4939
196 Ga0105251_10000248 3300009011 Bacteria 54567
197 Ga0105251_10013886 3300009011 Bacteria 4480
198 Ga0105250_10000748 3300009092 Bacteria 19742
199 Ga0105250_10006791 3300009092 Bacteria 4970
200 Ga0105240_10004406 3300009093 Bacteria 21474
201 Ga0105240_10010132 3300009093 Bacteria 13268
202 Ga0105240_10013114 3300009093 Bacteria 11404
203 Ga0105240_10052477 3300009093 Bacteria 5125
204 Ga0105240_10101719 3300009093 Bacteria 3494
205 Ga0105240_10391088 3300009093 Bacteria 1568
206 Ga0105240_10431847 3300009093 Bacteria 1478
207 Ga0111539_10079611 3300009094 Bacteria 3855
208 Ga0105245_10640480 3300009098 Bacteria 1092
209 Ga0105243_10517388 3300009148 Bacteria 1134
210 Ga0105241_10203413 3300009174 Bacteria 1655
211 Ga0105248_10001316 3300009177 Bacteria 27684
212 Ga0105248_10002296 3300009177 Bacteria 21166
213 Ga0105248_10462855 3300009177 Bacteria 1429
214 Ga0105237_10009761 3300009545 Bacteria 10267
215 Ga0105237_10118442 3300009545 Unclassified 2642
216 Ga0105237_10140536 3300009545 Bacteria 2409
217 Ga0105238_10005484 3300009551 Bacteria 12532
218 Ga0105238_10015201 3300009551 Bacteria 7794
219 Ga0105238_10028914 3300009551 Bacteria 5646
220 Ga0105249_10000024 3300009553 Bacteria 232947
221 Ga0099796_10009055 3300010159 Bacteria 2679
222 Ga0105239_10054386 3300010375 Bacteria 4391
223 Ga0157373_10001108 3300013100 Bacteria 20667
224 Ga0157373_10001147 3300013100 Bacteria 20292
225 Ga0157373_10005029 3300013100 Bacteria 9931
226 Ga0157373_10011635 3300013100 Bacteria 6464
227 Ga0157373_10044617 3300013100 Bacteria 3165
228 Ga0157371_10002246 3300013102 Bacteria 18652
229 Ga0157371_10003592 3300013102 Bacteria 13972
230 Ga0157371_10003629 3300013102 Bacteria 13896
231 Ga0157371_10007364 3300013102 Bacteria 8919
232 Ga0157371_10013147 3300013102 Bacteria 6301
233 Ga0157371_10026267 3300013102 Bacteria 4234
234 Ga0157371_10040325 3300013102 Bacteria 3335
235 Ga0157371_10070695 3300013102 Bacteria 2471
236 Ga0157371_10147044 3300013102 Bacteria 1679
237 Ga0157371_10466350 3300013102 Bacteria 930
238 Ga0157370_10001164 3300013104 Bacteria 32793
239 Ga0157370_10005590 3300013104 Bacteria 14081
240 Ga0157370_10013290 3300013104 Bacteria 8484
241 Ga0157370_10014274 3300013104 Bacteria 8131
242 Ga0157370_10019835 3300013104 Bacteria 6728
243 Ga0157370_10026941 3300013104 Bacteria 5669
244 Ga0157370_10053269 3300013104 Plasmid 3859
245 Ga0157370_10068120 3300013104 Bacteria 3364
246 Ga0157370_10135175 3300013104 Bacteria 2299
247 Ga0157370_10170694 3300013104 Bacteria 2022
248 Ga0157369_10001780 3300013105 Bacteria 26094
249 Ga0157369_10001785 3300013105 Bacteria 26034
250 Ga0157369_10005452 3300013105 Bacteria 14796
251 Ga0157369_10007104 3300013105 Bacteria 12913
252 Ga0157369_10010023 3300013105 Bacteria 10823
253 Ga0157369_10015692 3300013105 Bacteria 8536
254 Ga0157369_10015860 3300013105 Bacteria 8484
255 Ga0157369_10025891 3300013105 Bacteria 6508
256 Ga0157369_10037455 3300013105 Bacteria 5310
257 Ga0157369_10054658 3300013105 Bacteria 4311
258 Ga0157374_10004052 3300013296 Bacteria 12310
259 Ga0157374_10012763 3300013296 Bacteria 7320
260 Ga0157374_10091224 3300013296 Bacteria 2905
261 Ga0157378_10004743 3300013297 Bacteria 11917
262 Ga0157378_10006970 3300013297 Bacteria 9857
263 Ga0157378_11168367 3300013297 Bacteria 808
264 Ga0163162_10029816 3300013306 Bacteria 5401
265 Ga0163162_10071299 3300013306 Bacteria 3527
266 Ga0163162_10542209 3300013306 Bacteria 1292
267 Ga0157372_10001545 3300013307 Bacteria 25066
268 Ga0157372_10002393 3300013307 Bacteria 20313
269 Ga0157372_10007486 3300013307 Bacteria 11609
270 Ga0157372_10060097 3300013307 Bacteria 4252
271 Ga0157372_10091507 3300013307 Bacteria 3459
272 Ga0157372_10242097 3300013307 Unclassified 2093
273 Ga0157372_10405748 3300013307 Bacteria 1588
274 Ga0157372_10889359 3300013307 Bacteria 1033
275 Ga0157375_10026420 3300013308 Bacteria 5410
276 Ga0163163_10052244 3300014325 Bacteria 4031
277 Ga0157379_10033358 3300014968 Bacteria 4591
278 Ga0157379_10059439 3300014968 Bacteria 3418
279 Ga0157379_10076747 3300014968 Bacteria 2992
280 Ga0157379_10115571 3300014968 Bacteria 2412
281 Ga0157379_10313915 3300014968 Bacteria 1430
282 Ga0224712_10125287 3300022467 Bacteria 1116
283 Ga0209674_107553 3300025226 Bacteria 1362
284 Ga0209646_1002515 3300025246 Bacteria 4015
285 Ga0209677_104671 3300025253 Bacteria 3866
286 Ga0207656_10001317 3300025321 Bacteria 8172
287 Ga0207656_10166279 3300025321 Bacteria 1052
288 Ga0207696_1001183 3300025711 Bacteria 14868
289 Ga0207696_1005967 3300025711 Bacteria 4974
290 Ga0207713_1001574 3300025735 Bacteria 17889
291 Ga0207713_1002972 3300025735 Bacteria 11847
292 Ga0207713_1004528 3300025735 Bacteria 8998
293 Ga0207680_10020201 3300025903 Bacteria 3579
294 Ga0207680_10042236 3300025903 Bacteria 2666
295 Ga0207680_10042436 3300025903 Bacteria 2661
296 Ga0207680_10121902 3300025903 Bacteria 1706
297 Ga0207680_10589050 3300025903 Unclassified 795
298 Ga0207647_10000533 3300025904 Bacteria 30383
299 Ga0207647_10001255 3300025904 Bacteria 19519
300 Ga0207647_10001287 3300025904 Bacteria 19279
301 Ga0207647_10004812 3300025904 Bacteria 9990
302 Ga0207647_10009302 3300025904 Bacteria 6986
303 Ga0207647_10034680 3300025904 Bacteria 3219
304 Ga0207647_10073308 3300025904 Bacteria 2063
305 Ga0207699_10055032 3300025906 Bacteria 2366
306 Ga0207699_10075082 3300025906 Bacteria 2078
307 Ga0207645_10099008 3300025907 Bacteria 1880
308 Ga0207705_10000183 3300025909 Bacteria 65457
309 Ga0207705_10003164 3300025909 Bacteria 12524
310 Ga0207705_10005143 3300025909 Bacteria 9805
311 Ga0207705_10006347 3300025909 Bacteria 8771
312 Ga0207705_10014072 3300025909 Bacteria 5764
313 Ga0207705_10016263 3300025909 Bacteria 5335
314 Ga0207705_10021461 3300025909 Bacteria 4609
315 Ga0207705_10024673 3300025909 Plasmid 4290
316 Ga0207705_10039743 3300025909 Bacteria 3372
317 Ga0207705_10068819 3300025909 Unclassified 2564
318 Ga0207705_10126101 3300025909 Bacteria 1903
319 Ga0207695_10007371 3300025913 Bacteria 14036
320 Ga0207695_10009491 3300025913 Bacteria 12032
321 Ga0207695_10009677 3300025913 Bacteria 11872
322 Ga0207695_10073646 3300025913 Bacteria 3479
323 Ga0207695_10540722 3300025913 Bacteria 1046
324 Ga0207671_10066875 3300025914 Unclassified 2675
325 Ga0207671_10477718 3300025914 Bacteria 993
326 Ga0207693_10024751 3300025915 Bacteria 4760
327 Ga0207660_10000226 3300025917 Bacteria 36360
328 Ga0207660_10259849 3300025917 Bacteria 1373
329 Ga0207660_10478004 3300025917 Bacteria 1009
330 Ga0207660_10639778 3300025917 Bacteria 867
331 Ga0207657_10000783 3300025919 Bacteria 33822
332 Ga0207657_10005227 3300025919 Bacteria 13596
333 Ga0207657_10006755 3300025919 Bacteria 11853
334 Ga0207657_10010296 3300025919 Bacteria 9336
335 Ga0207657_10010572 3300025919 Bacteria 9203
336 Ga0207657_10027322 3300025919 Bacteria 5227
337 Ga0207657_10117272 3300025919 Unclassified 2193
338 Ga0207657_10308190 3300025919 Bacteria 1253
339 Ga0207657_10365857 3300025919 Bacteria 1136
340 Ga0207657_10414281 3300025919 Bacteria 1059
341 Ga0207657_10424743 3300025919 Bacteria 1044
342 Ga0207657_10451695 3300025919 Bacteria 1008
343 Ga0207649_10001886 3300025920 Bacteria 11958
344 Ga0207649_10002637 3300025920 Bacteria 9959
345 Ga0207649_10137033 3300025920 Bacteria 1670
346 Ga0207649_10456364 3300025920 Bacteria 965
347 Ga0207652_10332398 3300025921 Bacteria 1372
348 Ga0207681_10000144 3300025923 Bacteria 59200
349 Ga0207681_10178111 3300025923 Bacteria 1617
350 Ga0207694_10023835 3300025924 Bacteria 4647
351 Ga0207694_10072118 3300025924 Bacteria 2700
352 Ga0207694_10349244 3300025924 Unclassified 1224
353 Ga0207650_10000261 3300025925 Bacteria 56610
354 Ga0207650_10086559 3300025925 Bacteria 2386
355 Ga0207650_10343460 3300025925 Bacteria 1226
356 Ga0207650_10404487 3300025925 Bacteria 1130
357 Ga0207700_10131690 3300025928 Bacteria 2042
358 Ga0207664_10019747 3300025929 Bacteria 4988
359 Ga0207644_10000640 3300025931 Bacteria 22180
360 Ga0207644_10001358 3300025931 Bacteria 15739
361 Ga0207644_10001973 3300025931 Bacteria 13264
362 Ga0207644_10002363 3300025931 Bacteria 12182
363 Ga0207690_10001590 3300025932 Bacteria 14187
364 Ga0207690_10012337 3300025932 Bacteria 5113
365 Ga0207690_10017889 3300025932 Bacteria 4337
366 Ga0207690_10029935 3300025932 Bacteria 3466
367 Ga0207690_10053419 3300025932 Bacteria 2711
368 Ga0207690_10086578 3300025932 Bacteria 2202
369 Ga0207690_10093288 3300025932 Bacteria 2133
370 Ga0207690_10216335 3300025932 Bacteria 1464
371 Ga0207690_10250873 3300025932 Unclassified 1367
372 Ga0207706_10002940 3300025933 Bacteria 16464
373 Ga0207706_10014667 3300025933 Bacteria 7096
374 Ga0207706_10037255 3300025933 Bacteria 4319
375 Ga0207706_10216527 3300025933 Bacteria 1678
376 Ga0207706_10339361 3300025933 Bacteria 1307
377 Ga0207706_10429320 3300025933 Bacteria 1144
378 Ga0207706_10646154 3300025933 Bacteria 906
379 Ga0207706_10716967 3300025933 Bacteria 854
380 Ga0207669_10000155 3300025937 Bacteria 32382
381 Ga0207669_10027134 3300025937 Bacteria 3129
382 Ga0207669_10033144 3300025937 Bacteria 2911
383 Ga0207711_10000943 3300025941 Bacteria 27943
384 Ga0207711_10627136 3300025941 Bacteria 1003
385 Ga0207711_10848837 3300025941 Bacteria 850
386 Ga0207661_10164582 3300025944 Bacteria 1926
387 Ga0207679_10005401 3300025945 Bacteria 8005
388 Ga0207679_10109470 3300025945 Bacteria 2177
389 Ga0207667_10004992 3300025949 Bacteria 16207
390 Ga0207667_10011952 3300025949 Bacteria 10051
391 Ga0207667_10013439 3300025949 Bacteria 9369
392 Ga0207667_10019030 3300025949 Bacteria 7676
393 Ga0207667_10019463 3300025949 Bacteria 7578
394 Ga0207667_10024535 3300025949 Bacteria 6619
395 Ga0207667_10025101 3300025949 Bacteria 6532
396 Ga0207667_10038970 3300025949 Bacteria 5067
397 Ga0207651_10001400 3300025960 Bacteria 10943
398 Ga0207651_10227381 3300025960 Bacteria 1512
399 Ga0207712_10000034 3300025961 Bacteria 202320
400 Ga0207668_10062973 3300025972 Bacteria 2614
401 Ga0207640_10000484 3300025981 Bacteria 24196
402 Ga0207640_10000660 3300025981 Bacteria 20197
403 Ga0207640_10001733 3300025981 Bacteria 11708
404 Ga0207640_10002573 3300025981 Bacteria 9724
405 Ga0207640_10007730 3300025981 Bacteria 5941
406 Ga0207640_10013483 3300025981 Bacteria 4687
407 Ga0207640_10018957 3300025981 Plasmid 4054
408 Ga0207640_10086643 3300025981 Unclassified 2157
409 Ga0207640_10155331 3300025981 Bacteria 1686
410 Ga0207658_10000216 3300025986 Bacteria 60563
411 Ga0207658_10000239 3300025986 Bacteria 57662
412 Ga0207703_10280398 3300026035 Bacteria 1513
413 Ga0207639_10000621 3300026041 Bacteria 24436
414 Ga0207639_10000721 3300026041 Bacteria 22595
415 Ga0207639_10000839 3300026041 Bacteria 20858
416 Ga0207639_10161603 3300026041 Bacteria 1888
417 Ga0207639_10180422 3300026041 Bacteria 1796
418 Ga0207639_10535474 3300026041 Bacteria 1074
419 Ga0207678_10001376 3300026067 Bacteria 22393
420 Ga0207678_10035183 3300026067 Bacteria 4361
421 Ga0207678_10098127 3300026067 Plasmid 2503
422 Ga0207678_10267213 3300026067 Bacteria 1466
423 Ga0207702_10006922 3300026078 Bacteria 9711
424 Ga0207702_10007750 3300026078 Bacteria 9119
425 Ga0207702_10011419 3300026078 Bacteria 7404
426 Ga0207702_10027294 3300026078 Bacteria 4741
427 Ga0207702_10273248 3300026078 Bacteria 1595
428 Ga0207648_10118145 3300026089 Bacteria 2330
429 Ga0207676_10000036 3300026095 Bacteria 198447
430 Ga0207674_10001997 3300026116 Bacteria 25875
431 Ga0207674_10015692 3300026116 Bacteria 8313
432 Ga0207674_10034227 3300026116 Bacteria 5314
433 Ga0207683_10375251 3300026121 Bacteria 1307
434 Ga0207698_10000814 3300026142 Bacteria 18122
435 Ga0207698_10001384 3300026142 Bacteria 14102
436 Ga0207698_10012925 3300026142 Bacteria 5487
437 Ga0207698_10023612 3300026142 Plasmid 4299
438 Ga0207698_10025849 3300026142 Bacteria 4144
439 Ga0207698_10192973 3300026142 Bacteria 1816
440 Ga0207698_10230474 3300026142 Bacteria 1681
441 Ga0207698_10249883 3300026142 Bacteria 1622
442 Ga0207698_10276123 3300026142 Bacteria 1552
443 Ga0207698_10287481 3300026142 Bacteria 1524
444 Ga0207698_10349043 3300026142 Unclassified 1397
445 Ga0207698_10352644 3300026142 Bacteria 1390
446 Ga0268266_10001825 3300028379 Bacteria 24081
447 Ga0268266_10047375 3300028379 Bacteria 3682
448 Ga0268265_10000059 3300028380 Bacteria 152531
449 Ga0268265_10516327 3300028380 Bacteria 1128
450 Ga0268264_10018435 3300028381 Bacteria 5708
451 Ga0268264_10369870 3300028381 Bacteria 1370
452 Ga0307408_100003693 3300031548 Bacteria 10423
453 Ga0307408_100032581 3300031548 Bacteria 3634
454 Ga0307408_100104155 3300031548 Bacteria 2167
455 Ga0307408_100392564 3300031548 Bacteria 1189
456 Ga0307408_100754635 3300031548 Bacteria 879
457 Ga0307405_10000174 3300031731 Bacteria 23496
458 Ga0307405_10001858 3300031731 Bacteria 9063
459 Ga0307405_10001976 3300031731 Bacteria 8865
460 Ga0307413_10012203 3300031824 Bacteria 4267
461 Ga0307410_10007381 3300031852 Bacteria 6015
462 Ga0307410_10053954 3300031852 Bacteria 2722
463 Ga0307406_10004487 3300031901 Bacteria 7600
464 Ga0307406_10007389 3300031901 Bacteria 6090
465 Ga0307406_10109431 3300031901 Unclassified 1899
466 Ga0307407_10014063 3300031903 Bacteria 3906
467 Ga0307412_10000500 3300031911 Bacteria 23370
468 Ga0307412_10003675 3300031911 Bacteria 8521
469 Ga0307412_10006740 3300031911 Bacteria 6510
470 Ga0307412_10085419 3300031911 Unclassified 2193
471 Ga0307409_100004973 3300031995 Bacteria 7566
472 Ga0307409_100012521 3300031995 Bacteria 5410
473 Ga0307409_100056801 3300031995 Bacteria 3029
474 Ga0307416_100004298 3300032002 Bacteria 8554
475 Ga0307416_100032322 3300032002 Bacteria 3952
476 Ga0307416_100087623 3300032002 Bacteria 2658
477 Ga0307414_10000935 3300032004 Bacteria 14921
478 Ga0307414_10065845 3300032004 Bacteria 2587
479 Ga0307411_10010420 3300032005 Bacteria 4955
480 Ga0307411_10026299 3300032005 Bacteria 3503
481 Ga0307411_10079588 3300032005 Bacteria 2251
482 Ga0307411_10372986 3300032005 Bacteria 1171
483 Ga0307415_100022584 3300032126 Bacteria 3886
484 Ga0307415_100074490 3300032126 Bacteria 2399
485 Ga0307415_100288666 3300032126 Bacteria 1353
486 Ga0307415_100589085 3300032126 Bacteria 988
487 Ga0307510_10020209 3300033180 Bacteria 7789
488 Ga0373946_0041007 3300035171 Bacteria 1897
489 Ga0373947_0031262 3300035725 Bacteria 3132
490 Ga0373925_0034706 3300037068 Bacteria 3719
491 Ga0395899_0000931 3300037312 Bacteria 27577
492 Ga0395899_0002700 3300037312 Bacteria 14310
493 Ga0395899_0007403 3300037312 Bacteria 8483
494 Ga0395899_0009872 3300037312 Bacteria 7320
495 Ga0395899_0014455 3300037312 Bacteria 6025
496 Ga0395899_0019600 3300037312 Bacteria 5135
497 Ga0395899_0030693 3300037312 Bacteria 4041
498 Ga0395899_0037168 3300037312 Plasmid 3651
499 Ga0395899_0066777 3300037312 Bacteria 2640
500 Ga0395899_0074654 3300037312 Bacteria 2477
501 Ga0395899_0120433 3300037312 Unclassified 1880
502 Ga0395900_0001129 3300037418 Bacteria 33757
503 Ga0395900_0007480 3300037418 Bacteria 11286
504 Ga0395900_0010107 3300037418 Bacteria 9650
505 Ga0395900_0010785 3300037418 Bacteria 9348
506 Ga0395900_0012806 3300037418 Bacteria 8573
507 Ga0395900_0029934 3300037418 Bacteria 5587
508 Ga0395900_0052238 3300037418 Plasmid 4207
509 Ga0395900_0062174 3300037418 Bacteria 3838
510 Ga0395900_0067773 3300037418 Plasmid 3666
511 Ga0395900_0093843 3300037418 Unclassified 3082
512 Ga0395900_0100262 3300037418 Bacteria 2975
513 Ga0395900_0131136 3300037418 Bacteria 2569
514 Ga0395900_0189883 3300037418 Bacteria 2084
515 Ga0395900_0431123 3300037418 Bacteria 1277
516 Ga0395900_0457429 3300037418 Bacteria 1232
517 Ga0395898_0001152 3300037466 Bacteria 40373
518 Ga0395898_0001704 3300037466 Bacteria 29248
519 Ga0395898_0009910 3300037466 Bacteria 9982
520 Ga0395898_0045237 3300037466 Bacteria 4327
521 Ga0395898_0093909 3300037466 Bacteria 2882
522 Ga0395898_0101651 3300037466 Bacteria 2760
523 Ga0395898_0102378 3300037466 Unclassified 2749
524 Ga0395898_0515742 3300037466 Unclassified 1137
525 Ga0395905_0001384 3300037471 Bacteria 29378
526 Ga0395905_0002955 3300037471 Bacteria 18464
527 Ga0395905_0006991 3300037471 Bacteria 11280
528 Ga0395905_0007880 3300037471 Bacteria 10545
529 Ga0395905_0013174 3300037471 Bacteria 7936
530 Ga0395905_0017879 3300037471 Bacteria 6736
531 Ga0395905_0032999 3300037471 Plasmid 4867
532 Ga0395905_0035368 3300037471 Bacteria 4691
533 Ga0395905_0053985 3300037471 Bacteria 3761
534 Ga0395905_0057964 3300037471 Bacteria 3622
535 Ga0395905_0085437 3300037471 Bacteria 2956
536 Ga0395905_0614794 3300037471 Bacteria 988
537 Ga0395905_0966875 3300037471 Bacteria 754
538 Ga0395905_1122887 3300037471 Bacteria 689
539 Ga0436364_1142878 3300037853 Bacteria 875
540 Ga0395901_0000386 3300038443 Bacteria 52804
541 Ga0395901_0006002 3300038443 Bacteria 12304
542 Ga0395901_0010596 3300038443 Bacteria 9339
543 Ga0395901_0017423 3300038443 Bacteria 7333
544 Ga0395901_0018457 3300038443 Bacteria 7120
545 Ga0395901_0026413 3300038443 Bacteria 5961
546 Ga0395901_0037743 3300038443 Plasmid 4996
547 Ga0395901_0114106 3300038443 Bacteria 2838
548 Ga0395901_0182610 3300038443 Bacteria 2200
549 Ga0395901_0387353 3300038443 Bacteria 1438
550 Ga0395901_0499546 3300038443 Bacteria 1238
551 Ga0395901_0525542 3300038443 Unclassified 1202
552 Ga0395901_0542402 3300038443 Bacteria 1179
553 Ga0466966_0037161 3300044684 Unclassified 3142
554 Ga0466961_0025260 3300044693 Unclassified 3821
555 Ga0466961_0041607 3300044693 Bacteria 2946
556 Ga0466963_0001398 3300044694 Bacteria 12940
557 Ga0466963_0581091 3300044694 Bacteria 791
558 Ga0466957_0001787 3300044842 Bacteria 11323
559 Ga0466957_0022732 3300044842 Bacteria 3702
560 Ga0466959_0231731 3300045049 Bacteria 1278
561 Ga0466958_0042568 3300045836 Plasmid 2735
562 Ga0466958_0155080 3300045836 Bacteria 1445
563 Ga0466967_0123450 3300045976 Bacteria 2396
564 Ga0466967_0238487 3300045976 Bacteria 1734
565 Ga0466967_0424086 3300045976 Bacteria 1297
566 Ga0495638_0000068 3300046460 Bacteria 167596
567 Ga0495638_0422830 3300046460 Bacteria 686
568 Ga0495650_0000196 3300046471 Bacteria 131306
569 Ga0495585_0071943 3300046492 Bacteria 1885
570 Ga0495583_0000269 3300046506 Bacteria 85380
571 Ga0495583_0006855 3300046506 Bacteria 7341
572 Ga0495606_0034686 3300046507 Bacteria 3460
573 Ga0495606_0036990 3300046507 Bacteria 3319
574 Ga0495610_0000082 3300046512 Bacteria 113066
575 Ga0495610_0000243 3300046512 Bacteria 57521
576 Ga0495610_0026748 3300046512 Bacteria 3076
577 Ga0495620_0003625 3300046515 Bacteria 8813
578 Ga0495631_0019572 3300046518 Bacteria 3173
579 Ga0495632_0005949 3300046519 Bacteria 7949
580 Ga0495637_0021113 3300046520 Bacteria 2988
581 Ga0495643_0000561 3300046522 Bacteria 45970
582 Ga0495648_0000046 3300046524 Bacteria 167725
583 Ga0495633_0001488 3300046558 Bacteria 18170
584 Ga0495633_0003456 3300046558 Bacteria 10503
585 Ga0495633_0005860 3300046558 Bacteria 7394
586 Ga0495633_0019674 3300046558 Bacteria 3411
587 Ga0495625_0000832 3300046660 Bacteria 42398
588 Ga0495625_0146707 3300046660 Bacteria 1588
589 Ga0495661_0181232 3300046665 Bacteria 1116
590 Ga0495669_0000023 3300046684 Bacteria 117158
591 Ga0495671_0000057 3300046692 Bacteria 114166
592 Ga0495672_0038842 3300047320 Bacteria 2900
593 Ga0495683_0005724 3300047323 Bacteria 6855
594 Ga0495687_000076 3300047443 Bacteria 149259
595 Ga0495673_0000110 3300047469 Bacteria 166127
596 Ga0495626_0001225 3300048091 Bacteria 21121
597 Ga0496100_0001143 3300048903 Bacteria 12894
598 Ga0496101_0004565 3300048904 Bacteria 8746
599 Ga0496101_0006709 3300048904 Bacteria 7423
600 Ga0496102_0000698 3300048905 Bacteria 33409
601 Ga0496103_0000258 3300048906 Bacteria 50941
602 Ga0496104_0000675 3300048907 Bacteria 29310
603 Ga0496104_0017956 3300048907 Bacteria 6449
604 Ga0496105_0000184 3300048908 Bacteria 41790
605 Ga0496105_0003801 3300048908 Bacteria 11263
606 Ga0496107_0277459 3300048910 Bacteria 1248
607 Ga0496107_0355793 3300048910 Bacteria 1090
608 Ga0496109_0002925 3300048912 Bacteria 14275
609 Ga0496109_0005801 3300048912 Bacteria 10339
610 Ga0496111_0012485 3300048914 Bacteria 5753
611 Ga0496112_0001054 3300048915 Bacteria 20330
612 Ga0496112_0015723 3300048915 Bacteria 7068
613 Ga0496112_0025699 3300048915 Bacteria 5657
614 Ga0496113_0001048 3300048916 Bacteria 14914
615 Ga0496114_0213160 3300048917 Bacteria 1694
616 Ga0496116_0001606 3300048919 Bacteria 24832
617 Ga0496116_0004390 3300048919 Bacteria 13490
618 Ga0496116_0006963 3300048919 Bacteria 10131
619 Ga0496116_0019186 3300048919 Bacteria 5242
620 Ga0496117_0001983 3300048920 Bacteria 27190
621 Ga0496117_0006616 3300048920 Bacteria 11647
622 Ga0496117_0047668 3300048920 Bacteria 3070
623 Ga0496118_0000335 3300048921 Bacteria 80253
624 Ga0496118_0002186 3300048921 Bacteria 27190
625 Ga0496118_0007403 3300048921 Bacteria 11647
626 Ga0496118_0076912 3300048921 Bacteria 2370
627 Ga0496119_0001028 3300048922 Bacteria 35759
628 Ga0496119_0006485 3300048922 Bacteria 10807
629 Ga0496120_0000961 3300048923 Bacteria 39309
630 Ga0496120_0039250 3300048923 Bacteria 2795
631 Ga0496121_0006115 3300048924 Bacteria 15131
632 Ga0496121_0006397 3300048924 Bacteria 14645
633 Ga0496121_0012699 3300048924 Bacteria 9138
634 Ga0496122_0001573 3300048925 Bacteria 35934
635 Ga0496122_0002945 3300048925 Bacteria 23213
636 Ga0496122_0054532 3300048925 Bacteria 3001
637 Ga0496123_0000428 3300048926 Bacteria 75893
638 Ga0496123_0003956 3300048926 Bacteria 16060
639 Ga0496124_0002149 3300048927 Bacteria 26478
640 Ga0496124_0004303 3300048927 Bacteria 16719
641 Ga0496124_0007434 3300048927 Bacteria 11642
642 Ga0496124_0014032 3300048927 Bacteria 7773
643 Ga0496125_0003189 3300048928 Bacteria 20284
644 Ga0496125_0004588 3300048928 Bacteria 15796
645 Ga0496125_0018222 3300048928 Bacteria 6672
646 Ga0496125_0046502 3300048928 Bacteria 3640
647 Ga0496125_0133927 3300048928 Bacteria 1737
648 Ga0496126_0000158 3300048929 Bacteria 156032
649 Ga0496126_0002026 3300048929 Bacteria 28605
650 Ga0501335_000249 3300049551 Bacteria 3110
651 Ga0501038_0003137 3300049574 Bacteria 15417
652 Ga0501067_0147579 3300049583 Bacteria 1310
653 Ga0501206_000989 3300049653 Bacteria 3538
654 Ga0501224_004528 3300049664 Bacteria 1975
655 Ga0501235_000092 3300049669 Bacteria 14201
656 Ga0501236_000884 3300049670 Bacteria 3355
657 Ga0501225_0002260 3300049705 Bacteria 5957
658 Ga0501245_000867 3300049708 Bacteria 3823
659 nmdc:mga00v17_19848_c1 3300050491 Bacteria 3843
660 nmdc:mga0yw44_435499_c1 3300050492 Bacteria 888
661 nmdc:mga09592_36160_c1 3300050508 Bacteria 4137
662 Ga0500610_0000549 3300053079 Bacteria 11566
663 Ga0500644_0116068 3300053088 Bacteria 1037
664 Ga0500594_0001846 3300053118 Bacteria 4586
665 Ga0500608_058548 3300053122 Unclassified 1844
666 Ga0500559_0056486 3300053136 Bacteria 1742
667 Ga0500590_003777 3300053148 Bacteria 7043
668 Ga0500622_0028672 3300053156 Bacteria 2930
669 Ga0500624_000361 3300053157 Bacteria 14695
670 Ga0500645_005047 3300053730 Bacteria 4934
671 Ga0500596_000488 3300053735 Bacteria 7424
672 Ga0466962_0108093 3300061719 Bacteria 1338

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0025260 Ga0466961_0025260_3121_3768 168
2 3300044842 Ga0466957_0022732 Ga0466957_0022732_804_1451 168
3 3300045049 Ga0466959_0231731 Ga0466959_0231731_423_1070 168
4 3300045836 Ga0466958_0155080 Ga0466958_0155080_90_737 168
5 3300049583 Ga0501067_0147579 Ga0501067_0147579_298_945 176
6 3300005563 Ga0068855_100050067 Ga0068855_1000500673 180
7 3300005578 Ga0068854_100205013 Ga0068854_1002050132 180
8 3300005616 Ga0068852_100194699 Ga0068852_1001946992 180
9 3300013104 Ga0157370_10135175 Ga0157370_101351751 180
10 3300013105 Ga0157369_10054658 Ga0157369_100546583 180
11 3300025949 Ga0207667_10038970 Ga0207667_100389703 180
12 3300025981 Ga0207640_10155331 Ga0207640_101553312 180
13 3300026142 Ga0207698_10230474 Ga0207698_102304742 180
14 3300037312 Ga0395899_0037168 Ga0395899_0037168_955_1602 180
15 3300037418 Ga0395900_0093843 Ga0395900_0093843_281_928 180
16 3300037471 Ga0395905_0032999 Ga0395905_0032999_1541_2188 180
17 3300038443 Ga0395901_0037743 Ga0395901_0037743_1670_2317 180
18 3300013104 Ga0157370_10019835 Ga0157370_100198352 195
19 3300005327 Ga0070658_10033089 Ga0070658_100330893 201
20 3300005339 Ga0070660_100000883 Ga0070660_10000088318 201
21 3300005344 Ga0070661_100025661 Ga0070661_1000256613 201
22 3300005366 Ga0070659_100016215 Ga0070659_1000162154 201
23 3300005455 Ga0070663_100032754 Ga0070663_1000327544 201
24 3300005564 Ga0070664_100022088 Ga0070664_1000220883 201
25 3300025909 Ga0207705_10003164 Ga0207705_100031646 201
26 3300025919 Ga0207657_10000783 Ga0207657_1000078313 201
27 3300025933 Ga0207706_10002940 Ga0207706_1000294014 201
28 3300025945 Ga0207679_10109470 Ga0207679_101094703 201
29 3300026067 Ga0207678_10035183 Ga0207678_100351835 201
30 3300013102 Ga0157371_10003629 Ga0157371_100036297 202
31 3300037418 Ga0395900_0131136 Ga0395900_0131136_1616_2263 202
32 3300005327 Ga0070658_10092331 Ga0070658_100923313 203
33 3300005339 Ga0070660_100126519 Ga0070660_1001265192 203
34 3300005355 Ga0070671_100007581 Ga0070671_1000075811 203
35 3300005364 Ga0070673_100001803 Ga0070673_1000018037 203
36 3300005366 Ga0070659_100443507 Ga0070659_1004435072 203
37 3300006358 Ga0068871_100106748 Ga0068871_1001067482 203
38 3300009177 Ga0105248_10002296 Ga0105248_100022967 203
39 3300013105 Ga0157369_10001785 Ga0157369_100017853 203
40 3300013297 Ga0157378_11168367 Ga0157378_111683672 203
41 3300014968 Ga0157379_10059439 Ga0157379_100594395 203
42 3300025321 Ga0207656_10166279 Ga0207656_101662792 203
43 3300025903 Ga0207680_10042236 Ga0207680_100422363 203
44 3300025919 Ga0207657_10451695 Ga0207657_104516951 203
45 3300035171 Ga0373946_0041007 Ga0373946_0041007_434_1045 203
46 3300035725 Ga0373947_0031262 Ga0373947_0031262_2196_2807 203
47 3300037068 Ga0373925_0034706 Ga0373925_0034706_1437_2048 203
48 3300037312 Ga0395899_0014455 Ga0395899_0014455_2971_3582 203
49 3300037312 Ga0395899_0120433 Ga0395899_0120433_970_1581 203
50 3300037418 Ga0395900_0007480 Ga0395900_0007480_8767_9378 203
51 3300037418 Ga0395900_0052238 Ga0395900_0052238_3150_3761 203
52 3300037466 Ga0395898_0102378 Ga0395898_0102378_354_965 203
53 3300037466 Ga0395898_0515742 Ga0395898_0515742_324_935 203
54 3300037471 Ga0395905_0006991 Ga0395905_0006991_1909_2520 203
55 3300037471 Ga0395905_0017879 Ga0395905_0017879_304_915 203
56 3300038443 Ga0395901_0018457 Ga0395901_0018457_1909_2520 203
57 3300038443 Ga0395901_0525542 Ga0395901_0525542_354_965 203
58 3300048910 Ga0496107_0277459 Ga0496107_0277459_361_981 203
59 3300048919 Ga0496116_0004390 Ga0496116_0004390_2723_3334 203
60 3300050492 nmdc:mga0yw44_435499_c1 nmdc:mga0yw44_435499_c1_135_746 203
61 3300053136 Ga0500559_0056486 Ga0500559_0056486_911_1522 203
62 3300044694 Ga0466963_0001398 Ga0466963_0001398_3319_3966 207
63 3300045976 Ga0466967_0123450 Ga0466967_0123450_352_999 207
64 3300046471 Ga0495650_0000196 Ga0495650_0000196_94343_94966 207
65 3300046506 Ga0495583_0006855 Ga0495583_0006855_3753_4376 207
66 3300046507 Ga0495606_0034686 Ga0495606_0034686_851_1474 207
67 3300046518 Ga0495631_0019572 Ga0495631_0019572_200_823 207
68 3300046520 Ga0495637_0021113 Ga0495637_0021113_1309_1932 207
69 3300046558 Ga0495633_0003456 Ga0495633_0003456_6837_7460 207
70 3300046660 Ga0495625_0146707 Ga0495625_0146707_226_849 207
71 3300046665 Ga0495661_0181232 Ga0495661_0181232_236_859 207
72 3300046684 Ga0495669_0000023 Ga0495669_0000023_41743_42366 207
73 3300053079 Ga0500610_0000549 Ga0500610_0000549_9728_10351 207
74 3300046512 Ga0495610_0026748 Ga0495610_0026748_1875_2522 209
75 3300046558 Ga0495633_0001488 Ga0495633_0001488_8644_9291 210
76 iso_pu_bacteria 2738541301 2738849518 211
77 iso_pu_bacteria 2738541304 2738865247 211
78 iso_pu_bacteria 2738543022 2739297765 211
79 iso_pu_bacteria 2738543033 2739359443 211
80 iso_pu_bacteria 2808606404 2809081368 211
81 iso_pu_bacteria 2879163058 2879163647 211
82 iso_pu_bacteria 2880518877 2880523798 211
83 iso_pu_bacteria 2919138771 2919138879 211
84 iso_pu_bacteria 2919138771 2919139590 211
85 3300005436 Ga0070713_100017413 Ga0070713_1000174134 214
86 3300005439 Ga0070711_100005496 Ga0070711_1000054964 214
87 3300006175 Ga0070712_100050193 Ga0070712_1000501931 214
88 3300010159 Ga0099796_10009055 Ga0099796_100090553 214
89 3300025906 Ga0207699_10075082 Ga0207699_100750821 214
90 3300025915 Ga0207693_10024751 Ga0207693_100247513 214
91 3300037853 Ga0436364_1142878 Ga0436364_1142878_69_716 214
92 3300045976 Ga0466967_0238487 Ga0466967_0238487_543_1190 214
93 3300053730 Ga0500645_005047 Ga0500645_005047_2651_3295 214
94 2162886007 SwRhRL2b_contig_209976 SwRhRL2b_0898.00001110 215
95 3300001904 JGI24736J21556_1000069 JGI24736J21556_10000698 215
96 3300001976 JGI24752J21851_1000086 JGI24752J21851_10000864 215
97 3300001979 JGI24740J21852_10003151 JGI24740J21852_100031512 215
98 3300001979 JGI24740J21852_10020269 JGI24740J21852_100202692 215
99 3300001990 JGI24737J22298_10001229 JGI24737J22298_100012296 215
100 3300001990 JGI24737J22298_10077900 JGI24737J22298_100779001 215
101 3300002067 JGI24735J21928_10001501 JGI24735J21928_100015014 215
102 3300005289 Ga0065704_10000277 Ga0065704_1000027740 215
103 3300005289 Ga0065704_10073718 Ga0065704_100737187 215
104 3300005289 Ga0065704_10090188 Ga0065704_100901882 215
105 3300005295 Ga0065707_10085857 Ga0065707_100858578 215
106 3300005295 Ga0065707_10092635 Ga0065707_100926353 215
107 3300005327 Ga0070658_10002371 Ga0070658_100023716 215
108 3300005327 Ga0070658_10003386 Ga0070658_100033867 215
109 3300005327 Ga0070658_10008650 Ga0070658_100086502 215
110 3300005327 Ga0070658_10009192 Ga0070658_100091927 215
111 3300005327 Ga0070658_10016647 Ga0070658_100166473 215
112 3300005327 Ga0070658_10163673 Ga0070658_101636732 215
113 3300005328 Ga0070676_10116723 Ga0070676_101167232 215
114 3300005328 Ga0070676_10121621 Ga0070676_101216211 215
115 3300005329 Ga0070683_100003584 Ga0070683_1000035846 215
116 3300005329 Ga0070683_100010674 Ga0070683_1000106748 215
117 3300005330 Ga0070690_100004211 Ga0070690_1000042113 215
118 3300005331 Ga0070670_100000215 Ga0070670_1000002154 215
119 3300005331 Ga0070670_100167033 Ga0070670_1001670333 215
120 3300005331 Ga0070670_100169353 Ga0070670_1001693532 215
121 3300005335 Ga0070666_10005604 Ga0070666_100056043 215
122 3300005335 Ga0070666_10013523 Ga0070666_100135234 215
123 3300005335 Ga0070666_10020911 Ga0070666_100209113 215
124 3300005335 Ga0070666_10026096 Ga0070666_100260964 215
125 3300005335 Ga0070666_10073215 Ga0070666_100732151 215
126 3300005336 Ga0070680_100000271 Ga0070680_10000027112 215
127 3300005336 Ga0070680_100184717 Ga0070680_1001847171 215
128 3300005336 Ga0070680_100269167 Ga0070680_1002691672 215
129 3300005336 Ga0070680_100541703 Ga0070680_1005417031 215
130 3300005338 Ga0068868_100002030 Ga0068868_1000020307 215
131 3300005338 Ga0068868_100022820 Ga0068868_1000228203 215
132 3300005338 Ga0068868_100156144 Ga0068868_1001561442 215
133 3300005339 Ga0070660_100002324 Ga0070660_1000023248 215
134 3300005339 Ga0070660_100002881 Ga0070660_1000028815 215
135 3300005339 Ga0070660_100006448 Ga0070660_1000064486 215
136 3300005339 Ga0070660_100043823 Ga0070660_1000438231 215
137 3300005339 Ga0070660_100116309 Ga0070660_1001163092 215
138 3300005339 Ga0070660_100140029 Ga0070660_1001400293 215
139 3300005339 Ga0070660_100384335 Ga0070660_1003843352 215
140 3300005339 Ga0070660_100390546 Ga0070660_1003905462 215
141 3300005339 Ga0070660_100503957 Ga0070660_1005039571 215
142 3300005341 Ga0070691_10050964 Ga0070691_100509642 215
143 3300005344 Ga0070661_100001010 Ga0070661_1000010104 215
144 3300005344 Ga0070661_100007206 Ga0070661_1000072064 215
145 3300005344 Ga0070661_100029372 Ga0070661_1000293723 215
146 3300005344 Ga0070661_100037618 Ga0070661_1000376183 215
147 3300005344 Ga0070661_100092981 Ga0070661_1000929811 215
148 3300005344 Ga0070661_100175315 Ga0070661_1001753152 215
149 3300005347 Ga0070668_100007830 Ga0070668_1000078303 215
150 3300005353 Ga0070669_100000039 Ga0070669_10000003976 215
151 3300005353 Ga0070669_100191322 Ga0070669_1001913222 215
152 3300005355 Ga0070671_100001504 Ga0070671_10000150413 215
153 3300005355 Ga0070671_100001971 Ga0070671_1000019715 215
154 3300005355 Ga0070671_100007512 Ga0070671_1000075126 215
155 3300005355 Ga0070671_100009223 Ga0070671_1000092232 215
156 3300005355 Ga0070671_100315756 Ga0070671_1003157561 215
157 3300005356 Ga0070674_100014847 Ga0070674_1000148471 215
158 3300005356 Ga0070674_100023869 Ga0070674_1000238692 215
159 3300005356 Ga0070674_100124350 Ga0070674_1001243503 215
160 3300005364 Ga0070673_100005453 Ga0070673_1000054535 215
161 3300005364 Ga0070673_100047642 Ga0070673_1000476424 215
162 3300005364 Ga0070673_100115036 Ga0070673_1001150362 215
163 3300005364 Ga0070673_100128862 Ga0070673_1001288622 215
164 3300005364 Ga0070673_100420972 Ga0070673_1004209722 215
165 3300005366 Ga0070659_100001788 Ga0070659_10000178810 215
166 3300005366 Ga0070659_100003421 Ga0070659_1000034214 215
167 3300005366 Ga0070659_100004990 Ga0070659_1000049908 215
168 3300005366 Ga0070659_100024439 Ga0070659_1000244391 215
169 3300005366 Ga0070659_100037487 Ga0070659_1000374874 215
170 3300005366 Ga0070659_100059584 Ga0070659_1000595843 215
171 3300005366 Ga0070659_100133576 Ga0070659_1001335762 215
172 3300005366 Ga0070659_100224515 Ga0070659_1002245151 215
173 3300005366 Ga0070659_100293781 Ga0070659_1002937812 215
174 3300005367 Ga0070667_100000311 Ga0070667_1000003114 215
175 3300005367 Ga0070667_100000719 Ga0070667_10000071922 215
176 3300005434 Ga0070709_10267657 Ga0070709_102676572 215
177 3300005435 Ga0070714_100015990 Ga0070714_1000159903 215
178 3300005435 Ga0070714_100017633 Ga0070714_1000176332 215
179 3300005435 Ga0070714_100043916 Ga0070714_1000439162 215
180 3300005435 Ga0070714_100194819 Ga0070714_1001948192 215
181 3300005436 Ga0070713_100009084 Ga0070713_1000090845 215
182 3300005455 Ga0070663_100000485 Ga0070663_10000048512 215
183 3300005455 Ga0070663_100001726 Ga0070663_1000017265 215
184 3300005455 Ga0070663_100069410 Ga0070663_1000694103 215
185 3300005456 Ga0070678_100364920 Ga0070678_1003649201 215
186 3300005456 Ga0070678_100964548 Ga0070678_1009645481 215
187 3300005457 Ga0070662_100008303 Ga0070662_1000083037 215
188 3300005457 Ga0070662_100024960 Ga0070662_1000249603 215
189 3300005457 Ga0070662_100144743 Ga0070662_1001447432 215
190 3300005459 Ga0068867_100038525 Ga0068867_1000385253 215
191 3300005459 Ga0068867_100983110 Ga0068867_1009831101 215
192 3300005466 Ga0070685_10067688 Ga0070685_100676883 215
193 3300005530 Ga0070679_100258359 Ga0070679_1002583592 215
194 3300005530 Ga0070679_100278089 Ga0070679_1002780891 215
195 3300005530 Ga0070679_100622792 Ga0070679_1006227922 215
196 3300005535 Ga0070684_100008271 Ga0070684_1000082712 215
197 3300005535 Ga0070684_100059971 Ga0070684_1000599712 215
198 3300005539 Ga0068853_100000755 Ga0068853_10000075512 215
199 3300005539 Ga0068853_100002226 Ga0068853_1000022263 215
200 3300005539 Ga0068853_100002488 Ga0068853_1000024884 215
201 3300005539 Ga0068853_100069436 Ga0068853_1000694363 215
202 3300005539 Ga0068853_100154217 Ga0068853_1001542173 215
203 3300005539 Ga0068853_100248810 Ga0068853_1002488102 215
204 3300005539 Ga0068853_100318504 Ga0068853_1003185042 215
205 3300005543 Ga0070672_100050476 Ga0070672_1000504763 215
206 3300005543 Ga0070672_100071237 Ga0070672_1000712372 215
207 3300005543 Ga0070672_100229482 Ga0070672_1002294822 215
208 3300005544 Ga0070686_100196102 Ga0070686_1001961022 215
209 3300005548 Ga0070665_100003111 Ga0070665_1000031118 215
210 3300005548 Ga0070665_100064524 Ga0070665_1000645243 215
211 3300005563 Ga0068855_100006702 Ga0068855_1000067025 215
212 3300005563 Ga0068855_100010156 Ga0068855_1000101568 215
213 3300005563 Ga0068855_100014166 Ga0068855_1000141668 215
214 3300005563 Ga0068855_100017947 Ga0068855_1000179476 215
215 3300005563 Ga0068855_100018598 Ga0068855_1000185982 215
216 3300005563 Ga0068855_100029847 Ga0068855_1000298475 215
217 3300005563 Ga0068855_100112216 Ga0068855_1001122163 215
218 3300005563 Ga0068855_100164447 Ga0068855_1001644473 215
219 3300005563 Ga0068855_100212465 Ga0068855_1002124653 215
220 3300005564 Ga0070664_100059697 Ga0070664_1000596972 215
221 3300005577 Ga0068857_100000856 Ga0068857_1000008566 215
222 3300005577 Ga0068857_100010170 Ga0068857_1000101706 215
223 3300005577 Ga0068857_100012150 Ga0068857_1000121503 215
224 3300005577 Ga0068857_100190028 Ga0068857_1001900282 215
225 3300005578 Ga0068854_100001288 Ga0068854_10000128811 215
226 3300005578 Ga0068854_100001536 Ga0068854_1000015364 215
227 3300005578 Ga0068854_100003540 Ga0068854_1000035408 215
228 3300005578 Ga0068854_100009272 Ga0068854_1000092724 215
229 3300005578 Ga0068854_100009525 Ga0068854_1000095252 215
230 3300005578 Ga0068854_100020148 Ga0068854_1000201483 215
231 3300005578 Ga0068854_100060809 Ga0068854_1000608093 215
232 3300005578 Ga0068854_100100547 Ga0068854_1001005473 215
233 3300005578 Ga0068854_100313945 Ga0068854_1003139452 215
234 3300005614 Ga0068856_100009429 Ga0068856_1000094298 215
235 3300005614 Ga0068856_100010950 Ga0068856_1000109503 215
236 3300005614 Ga0068856_100020465 Ga0068856_1000204652 215
237 3300005614 Ga0068856_100031496 Ga0068856_1000314962 215
238 3300005614 Ga0068856_100103740 Ga0068856_1001037402 215
239 3300005614 Ga0068856_100326405 Ga0068856_1003264051 215
240 3300005614 Ga0068856_100677498 Ga0068856_1006774982 215
241 3300005616 Ga0068852_100000868 Ga0068852_10000086810 215
242 3300005616 Ga0068852_100003221 Ga0068852_1000032212 215
243 3300005616 Ga0068852_100005448 Ga0068852_1000054484 215
244 3300005616 Ga0068852_100013235 Ga0068852_1000132352 215
245 3300005616 Ga0068852_100016397 Ga0068852_1000163974 215
246 3300005616 Ga0068852_100068911 Ga0068852_1000689112 215
247 3300005616 Ga0068852_100094533 Ga0068852_1000945332 215
248 3300005616 Ga0068852_100098578 Ga0068852_1000985782 215
249 3300005616 Ga0068852_100317230 Ga0068852_1003172302 215
250 3300005616 Ga0068852_100317852 Ga0068852_1003178522 215
251 3300005616 Ga0068852_100327642 Ga0068852_1003276422 215
252 3300005616 Ga0068852_100403149 Ga0068852_1004031492 215
253 3300005616 Ga0068852_100485478 Ga0068852_1004854782 215
254 3300005616 Ga0068852_100513864 Ga0068852_1005138641 215
255 3300005618 Ga0068864_100000080 Ga0068864_10000008094 215
256 3300005834 Ga0068851_10042741 Ga0068851_100427413 215
257 3300005834 Ga0068851_10162574 Ga0068851_101625741 215
258 3300005834 Ga0068851_10215259 Ga0068851_102152592 215
259 3300005841 Ga0068863_100000087 Ga0068863_10000008794 215
260 3300005842 Ga0068858_100034153 Ga0068858_1000341533 215
261 3300005842 Ga0068858_100472075 Ga0068858_1004720752 215
262 3300005843 Ga0068860_100029152 Ga0068860_1000291523 215
263 3300005843 Ga0068860_100393568 Ga0068860_1003935682 215
264 3300005844 Ga0068862_100000101 Ga0068862_10000010194 215
265 3300005844 Ga0068862_100032334 Ga0068862_1000323345 215
266 3300006051 Ga0075364_10089606 Ga0075364_100896063 215
267 3300006051 Ga0075364_10400652 Ga0075364_104006521 215
268 3300006237 Ga0097621_100012206 Ga0097621_1000122063 215
269 3300006358 Ga0068871_100001517 Ga0068871_1000015175 215
270 3300006880 Ga0075429_100027480 Ga0075429_1000274802 215
271 3300009011 Ga0105251_10000248 Ga0105251_1000024847 215
272 3300009011 Ga0105251_10013886 Ga0105251_100138865 215
273 3300009092 Ga0105250_10000748 Ga0105250_100007487 215
274 3300009092 Ga0105250_10006791 Ga0105250_100067913 215
275 3300009093 Ga0105240_10004406 Ga0105240_100044063 215
276 3300009093 Ga0105240_10010132 Ga0105240_100101325 215
277 3300009093 Ga0105240_10013114 Ga0105240_100131148 215
278 3300009093 Ga0105240_10052477 Ga0105240_100524771 215
279 3300009093 Ga0105240_10101719 Ga0105240_101017192 215
280 3300009093 Ga0105240_10391088 Ga0105240_103910882 215
281 3300009093 Ga0105240_10431847 Ga0105240_104318472 215
282 3300009094 Ga0111539_10079611 Ga0111539_100796112 215
283 3300009098 Ga0105245_10640480 Ga0105245_106404801 215
284 3300009148 Ga0105243_10517388 Ga0105243_105173882 215
285 3300009174 Ga0105241_10203413 Ga0105241_102034132 215
286 3300009177 Ga0105248_10001316 Ga0105248_1000131614 215
287 3300009177 Ga0105248_10462855 Ga0105248_104628552 215
288 3300009545 Ga0105237_10009761 Ga0105237_100097616 215
289 3300009545 Ga0105237_10118442 Ga0105237_101184421 215
290 3300009545 Ga0105237_10140536 Ga0105237_101405362 215
291 3300009551 Ga0105238_10005484 Ga0105238_1000548410 215
292 3300009551 Ga0105238_10015201 Ga0105238_100152014 215
293 3300009551 Ga0105238_10028914 Ga0105238_100289145 215
294 3300009553 Ga0105249_10000024 Ga0105249_10000024143 215
295 3300010375 Ga0105239_10054386 Ga0105239_100543863 215
296 3300013100 Ga0157373_10001108 Ga0157373_100011087 215
297 3300013100 Ga0157373_10001147 Ga0157373_1000114712 215
298 3300013100 Ga0157373_10005029 Ga0157373_100050292 215
299 3300013100 Ga0157373_10011635 Ga0157373_100116355 215
300 3300013100 Ga0157373_10044617 Ga0157373_100446173 215
301 3300013102 Ga0157371_10002246 Ga0157371_100022468 215
302 3300013102 Ga0157371_10003592 Ga0157371_100035923 215
303 3300013102 Ga0157371_10007364 Ga0157371_100073644 215
304 3300013102 Ga0157371_10013147 Ga0157371_100131474 215
305 3300013102 Ga0157371_10026267 Ga0157371_100262675 215
306 3300013102 Ga0157371_10040325 Ga0157371_100403254 215
307 3300013102 Ga0157371_10070695 Ga0157371_100706952 215
308 3300013102 Ga0157371_10147044 Ga0157371_101470441 215
309 3300013102 Ga0157371_10466350 Ga0157371_104663502 215
310 3300013104 Ga0157370_10001164 Ga0157370_100011648 215
311 3300013104 Ga0157370_10005590 Ga0157370_100055907 215
312 3300013104 Ga0157370_10013290 Ga0157370_100132907 215
313 3300013104 Ga0157370_10014274 Ga0157370_100142744 215
314 3300013104 Ga0157370_10026941 Ga0157370_100269414 215
315 3300013104 Ga0157370_10053269 Ga0157370_100532694 215
316 3300013104 Ga0157370_10068120 Ga0157370_100681202 215
317 3300013104 Ga0157370_10170694 Ga0157370_101706941 215
318 3300013105 Ga0157369_10001780 Ga0157369_100017804 215
319 3300013105 Ga0157369_10005452 Ga0157369_100054527 215
320 3300013105 Ga0157369_10007104 Ga0157369_100071042 215
321 3300013105 Ga0157369_10010023 Ga0157369_100100238 215
322 3300013105 Ga0157369_10015692 Ga0157369_100156926 215
323 3300013105 Ga0157369_10015860 Ga0157369_100158607 215
324 3300013105 Ga0157369_10025891 Ga0157369_100258915 215
325 3300013105 Ga0157369_10037455 Ga0157369_100374555 215
326 3300013296 Ga0157374_10004052 Ga0157374_100040525 215
327 3300013296 Ga0157374_10012763 Ga0157374_100127636 215
328 3300013296 Ga0157374_10091224 Ga0157374_100912242 215
329 3300013297 Ga0157378_10004743 Ga0157378_100047435 215
330 3300013297 Ga0157378_10006970 Ga0157378_100069708 215
331 3300013306 Ga0163162_10029816 Ga0163162_100298165 215
332 3300013306 Ga0163162_10071299 Ga0163162_100712993 215
333 3300013306 Ga0163162_10542209 Ga0163162_105422092 215
334 3300013307 Ga0157372_10001545 Ga0157372_1000154514 215
335 3300013307 Ga0157372_10002393 Ga0157372_1000239312 215
336 3300013307 Ga0157372_10007486 Ga0157372_100074869 215
337 3300013307 Ga0157372_10060097 Ga0157372_100600974 215
338 3300013307 Ga0157372_10091507 Ga0157372_100915072 215
339 3300013307 Ga0157372_10242097 Ga0157372_102420972 215
340 3300013307 Ga0157372_10405748 Ga0157372_104057482 215
341 3300013307 Ga0157372_10889359 Ga0157372_108893592 215
342 3300013308 Ga0157375_10026420 Ga0157375_100264204 215
343 3300014325 Ga0163163_10052244 Ga0163163_100522444 215
344 3300014968 Ga0157379_10033358 Ga0157379_100333584 215
345 3300014968 Ga0157379_10076747 Ga0157379_100767473 215
346 3300014968 Ga0157379_10115571 Ga0157379_101155712 215
347 3300014968 Ga0157379_10313915 Ga0157379_103139152 215
348 3300022467 Ga0224712_10125287 Ga0224712_101252871 215
349 3300025226 Ga0209674_107553 Ga0209674_1075532 215
350 3300025246 Ga0209646_1002515 Ga0209646_10025152 215
351 3300025253 Ga0209677_104671 Ga0209677_1046713 215
352 3300025321 Ga0207656_10001317 Ga0207656_100013179 215
353 3300025711 Ga0207696_1001183 Ga0207696_10011837 215
354 3300025711 Ga0207696_1005967 Ga0207696_10059673 215
355 3300025735 Ga0207713_1001574 Ga0207713_100157412 215
356 3300025735 Ga0207713_1002972 Ga0207713_10029726 215
357 3300025735 Ga0207713_1004528 Ga0207713_10045284 215
358 3300025903 Ga0207680_10020201 Ga0207680_100202012 215
359 3300025903 Ga0207680_10042436 Ga0207680_100424362 215
360 3300025903 Ga0207680_10121902 Ga0207680_101219022 215
361 3300025903 Ga0207680_10589050 Ga0207680_105890501 215
362 3300025904 Ga0207647_10000533 Ga0207647_100005336 215
363 3300025904 Ga0207647_10001255 Ga0207647_100012557 215
364 3300025904 Ga0207647_10001287 Ga0207647_100012877 215
365 3300025904 Ga0207647_10004812 Ga0207647_100048128 215
366 3300025904 Ga0207647_10009302 Ga0207647_100093024 215
367 3300025904 Ga0207647_10034680 Ga0207647_100346801 215
368 3300025904 Ga0207647_10073308 Ga0207647_100733082 215
369 3300025906 Ga0207699_10055032 Ga0207699_100550322 215
370 3300025907 Ga0207645_10099008 Ga0207645_100990083 215
371 3300025909 Ga0207705_10000183 Ga0207705_1000018317 215
372 3300025909 Ga0207705_10005143 Ga0207705_100051439 215
373 3300025909 Ga0207705_10006347 Ga0207705_100063472 215
374 3300025909 Ga0207705_10014072 Ga0207705_100140724 215
375 3300025909 Ga0207705_10016263 Ga0207705_100162633 215
376 3300025909 Ga0207705_10021461 Ga0207705_100214615 215
377 3300025909 Ga0207705_10024673 Ga0207705_100246732 215
378 3300025909 Ga0207705_10039743 Ga0207705_100397432 215
379 3300025909 Ga0207705_10068819 Ga0207705_100688193 215
380 3300025909 Ga0207705_10126101 Ga0207705_101261012 215
381 3300025913 Ga0207695_10007371 Ga0207695_100073716 215
382 3300025913 Ga0207695_10009491 Ga0207695_100094919 215
383 3300025913 Ga0207695_10009677 Ga0207695_100096778 215
384 3300025913 Ga0207695_10073646 Ga0207695_100736464 215
385 3300025913 Ga0207695_10540722 Ga0207695_105407222 215
386 3300025914 Ga0207671_10066875 Ga0207671_100668751 215
387 3300025914 Ga0207671_10477718 Ga0207671_104777181 215
388 3300025917 Ga0207660_10000226 Ga0207660_1000022629 215
389 3300025917 Ga0207660_10259849 Ga0207660_102598492 215
390 3300025917 Ga0207660_10478004 Ga0207660_104780041 215
391 3300025917 Ga0207660_10639778 Ga0207660_106397782 215
392 3300025919 Ga0207657_10005227 Ga0207657_100052278 215
393 3300025919 Ga0207657_10006755 Ga0207657_100067556 215
394 3300025919 Ga0207657_10010296 Ga0207657_100102968 215
395 3300025919 Ga0207657_10010572 Ga0207657_100105729 215
396 3300025919 Ga0207657_10027322 Ga0207657_100273224 215
397 3300025919 Ga0207657_10117272 Ga0207657_101172722 215
398 3300025919 Ga0207657_10308190 Ga0207657_103081901 215
399 3300025919 Ga0207657_10365857 Ga0207657_103658572 215
400 3300025919 Ga0207657_10414281 Ga0207657_104142812 215
401 3300025919 Ga0207657_10424743 Ga0207657_104247431 215
402 3300025920 Ga0207649_10001886 Ga0207649_100018865 215
403 3300025920 Ga0207649_10002637 Ga0207649_100026372 215
404 3300025920 Ga0207649_10137033 Ga0207649_101370332 215
405 3300025920 Ga0207649_10456364 Ga0207649_104563641 215
406 3300025921 Ga0207652_10332398 Ga0207652_103323982 215
407 3300025923 Ga0207681_10000144 Ga0207681_1000014418 215
408 3300025923 Ga0207681_10178111 Ga0207681_101781112 215
409 3300025924 Ga0207694_10023835 Ga0207694_100238352 215
410 3300025924 Ga0207694_10072118 Ga0207694_100721183 215
411 3300025924 Ga0207694_10349244 Ga0207694_103492442 215
412 3300025925 Ga0207650_10000261 Ga0207650_100002618 215
413 3300025925 Ga0207650_10086559 Ga0207650_100865593 215
414 3300025925 Ga0207650_10343460 Ga0207650_103434602 215
415 3300025925 Ga0207650_10404487 Ga0207650_104044872 215
416 3300025928 Ga0207700_10131690 Ga0207700_101316903 215
417 3300025929 Ga0207664_10019747 Ga0207664_100197473 215
418 3300025931 Ga0207644_10000640 Ga0207644_100006405 215
419 3300025931 Ga0207644_10001358 Ga0207644_100013584 215
420 3300025931 Ga0207644_10001973 Ga0207644_1000197311 215
421 3300025931 Ga0207644_10002363 Ga0207644_100023632 215
422 3300025932 Ga0207690_10001590 Ga0207690_100015907 215
423 3300025932 Ga0207690_10012337 Ga0207690_100123373 215
424 3300025932 Ga0207690_10017889 Ga0207690_100178893 215
425 3300025932 Ga0207690_10029935 Ga0207690_100299352 215
426 3300025932 Ga0207690_10053419 Ga0207690_100534193 215
427 3300025932 Ga0207690_10086578 Ga0207690_100865782 215
428 3300025932 Ga0207690_10093288 Ga0207690_100932882 215
429 3300025932 Ga0207690_10216335 Ga0207690_102163352 215
430 3300025932 Ga0207690_10250873 Ga0207690_102508732 215
431 3300025933 Ga0207706_10014667 Ga0207706_100146677 215
432 3300025933 Ga0207706_10037255 Ga0207706_100372553 215
433 3300025933 Ga0207706_10216527 Ga0207706_102165272 215
434 3300025933 Ga0207706_10339361 Ga0207706_103393612 215
435 3300025933 Ga0207706_10429320 Ga0207706_104293202 215
436 3300025933 Ga0207706_10646154 Ga0207706_106461542 215
437 3300025933 Ga0207706_10716967 Ga0207706_107169672 215
438 3300025937 Ga0207669_10000155 Ga0207669_1000015522 215
439 3300025937 Ga0207669_10027134 Ga0207669_100271343 215
440 3300025937 Ga0207669_10033144 Ga0207669_100331443 215
441 3300025941 Ga0207711_10000943 Ga0207711_1000094314 215
442 3300025941 Ga0207711_10627136 Ga0207711_106271362 215
443 3300025941 Ga0207711_10848837 Ga0207711_108488371 215
444 3300025944 Ga0207661_10164582 Ga0207661_101645822 215
445 3300025945 Ga0207679_10005401 Ga0207679_100054015 215
446 3300025949 Ga0207667_10004992 Ga0207667_100049928 215
447 3300025949 Ga0207667_10011952 Ga0207667_100119522 215
448 3300025949 Ga0207667_10013439 Ga0207667_100134392 215
449 3300025949 Ga0207667_10019030 Ga0207667_100190303 215
450 3300025949 Ga0207667_10019463 Ga0207667_100194634 215
451 3300025949 Ga0207667_10024535 Ga0207667_100245355 215
452 3300025949 Ga0207667_10025101 Ga0207667_100251013 215
453 3300025960 Ga0207651_10001400 Ga0207651_100014005 215
454 3300025960 Ga0207651_10227381 Ga0207651_102273812 215
455 3300025961 Ga0207712_10000034 Ga0207712_10000034143 215
456 3300025972 Ga0207668_10062973 Ga0207668_100629733 215
457 3300025981 Ga0207640_10000484 Ga0207640_100004848 215
458 3300025981 Ga0207640_10000660 Ga0207640_1000066011 215
459 3300025981 Ga0207640_10001733 Ga0207640_100017339 215
460 3300025981 Ga0207640_10002573 Ga0207640_100025737 215
461 3300025981 Ga0207640_10007730 Ga0207640_100077304 215
462 3300025981 Ga0207640_10013483 Ga0207640_100134834 215
463 3300025981 Ga0207640_10018957 Ga0207640_100189573 215
464 3300025981 Ga0207640_10086643 Ga0207640_100866432 215
465 3300025986 Ga0207658_10000216 Ga0207658_1000021626 215
466 3300025986 Ga0207658_10000239 Ga0207658_100002398 215
467 3300026035 Ga0207703_10280398 Ga0207703_102803982 215
468 3300026041 Ga0207639_10000621 Ga0207639_100006216 215
469 3300026041 Ga0207639_10000721 Ga0207639_100007216 215
470 3300026041 Ga0207639_10000839 Ga0207639_1000083914 215
471 3300026041 Ga0207639_10161603 Ga0207639_101616032 215
472 3300026041 Ga0207639_10180422 Ga0207639_101804222 215
473 3300026041 Ga0207639_10535474 Ga0207639_105354742 215
474 3300026067 Ga0207678_10001376 Ga0207678_100013768 215
475 3300026067 Ga0207678_10098127 Ga0207678_100981272 215
476 3300026067 Ga0207678_10267213 Ga0207678_102672132 215
477 3300026078 Ga0207702_10006922 Ga0207702_100069227 215
478 3300026078 Ga0207702_10007750 Ga0207702_100077507 215
479 3300026078 Ga0207702_10011419 Ga0207702_100114196 215
480 3300026078 Ga0207702_10027294 Ga0207702_100272946 215
481 3300026078 Ga0207702_10273248 Ga0207702_102732482 215
482 3300026089 Ga0207648_10118145 Ga0207648_101181453 215
483 3300026095 Ga0207676_10000036 Ga0207676_1000003651 215
484 3300026116 Ga0207674_10001997 Ga0207674_100019976 215
485 3300026116 Ga0207674_10015692 Ga0207674_100156922 215
486 3300026116 Ga0207674_10034227 Ga0207674_100342274 215
487 3300026121 Ga0207683_10375251 Ga0207683_103752512 215
488 3300026142 Ga0207698_10000814 Ga0207698_1000081410 215
489 3300026142 Ga0207698_10001384 Ga0207698_100013846 215
490 3300026142 Ga0207698_10012925 Ga0207698_100129254 215
491 3300026142 Ga0207698_10023612 Ga0207698_100236122 215
492 3300026142 Ga0207698_10025849 Ga0207698_100258493 215
493 3300026142 Ga0207698_10192973 Ga0207698_101929732 215
494 3300026142 Ga0207698_10249883 Ga0207698_102498832 215
495 3300026142 Ga0207698_10276123 Ga0207698_102761232 215
496 3300026142 Ga0207698_10287481 Ga0207698_102874812 215
497 3300026142 Ga0207698_10349043 Ga0207698_103490432 215
498 3300026142 Ga0207698_10352644 Ga0207698_103526442 215
499 3300028379 Ga0268266_10001825 Ga0268266_100018256 215
500 3300028379 Ga0268266_10047375 Ga0268266_100473753 215
501 3300028380 Ga0268265_10000059 Ga0268265_100000594 215
502 3300028380 Ga0268265_10516327 Ga0268265_105163271 215
503 3300028381 Ga0268264_10018435 Ga0268264_100184353 215
504 3300028381 Ga0268264_10369870 Ga0268264_103698702 215
505 3300031548 Ga0307408_100003693 Ga0307408_1000036938 215
506 3300031548 Ga0307408_100032581 Ga0307408_1000325814 215
507 3300031548 Ga0307408_100104155 Ga0307408_1001041551 215
508 3300031548 Ga0307408_100392564 Ga0307408_1003925641 215
509 3300031548 Ga0307408_100754635 Ga0307408_1007546351 215
510 3300031731 Ga0307405_10000174 Ga0307405_1000017412 215
511 3300031731 Ga0307405_10001858 Ga0307405_100018583 215
512 3300031731 Ga0307405_10001976 Ga0307405_100019766 215
513 3300031824 Ga0307413_10012203 Ga0307413_100122032 215
514 3300031852 Ga0307410_10007381 Ga0307410_100073812 215
515 3300031852 Ga0307410_10053954 Ga0307410_100539542 215
516 3300031901 Ga0307406_10004487 Ga0307406_100044876 215
517 3300031901 Ga0307406_10007389 Ga0307406_100073895 215
518 3300031901 Ga0307406_10109431 Ga0307406_101094312 215
519 3300031903 Ga0307407_10014063 Ga0307407_100140634 215
520 3300031911 Ga0307412_10000500 Ga0307412_1000050012 215
521 3300031911 Ga0307412_10003675 Ga0307412_1000367511 215
522 3300031911 Ga0307412_10006740 Ga0307412_100067405 215
523 3300031911 Ga0307412_10085419 Ga0307412_100854192 215
524 3300031995 Ga0307409_100004973 Ga0307409_1000049735 215
525 3300031995 Ga0307409_100012521 Ga0307409_1000125214 215
526 3300031995 Ga0307409_100056801 Ga0307409_1000568012 215
527 3300032002 Ga0307416_100004298 Ga0307416_1000042986 215
528 3300032002 Ga0307416_100032322 Ga0307416_1000323222 215
529 3300032002 Ga0307416_100087623 Ga0307416_1000876233 215
530 3300032004 Ga0307414_10000935 Ga0307414_1000093511 215
531 3300032004 Ga0307414_10065845 Ga0307414_100658452 215
532 3300032005 Ga0307411_10010420 Ga0307411_100104202 215
533 3300032005 Ga0307411_10026299 Ga0307411_100262993 215
534 3300032005 Ga0307411_10079588 Ga0307411_100795883 215
535 3300032005 Ga0307411_10372986 Ga0307411_103729862 215
536 3300032126 Ga0307415_100022584 Ga0307415_1000225843 215
537 3300032126 Ga0307415_100074490 Ga0307415_1000744902 215
538 3300032126 Ga0307415_100288666 Ga0307415_1002886662 215
539 3300032126 Ga0307415_100589085 Ga0307415_1005890852 215
540 3300033180 Ga0307510_10020209 Ga0307510_100202093 215
541 3300037312 Ga0395899_0000931 Ga0395899_0000931_13547_14194 215
542 3300037312 Ga0395899_0002700 Ga0395899_0002700_5181_5828 215
543 3300037312 Ga0395899_0007403 Ga0395899_0007403_1242_1889 215
544 3300037312 Ga0395899_0009872 Ga0395899_0009872_1107_1754 215
545 3300037312 Ga0395899_0019600 Ga0395899_0019600_4340_4987 215
546 3300037312 Ga0395899_0030693 Ga0395899_0030693_85_732 215
547 3300037312 Ga0395899_0066777 Ga0395899_0066777_104_751 215
548 3300037312 Ga0395899_0074654 Ga0395899_0074654_1296_1943 215
549 3300037418 Ga0395900_0001129 Ga0395900_0001129_19618_20265 215
550 3300037418 Ga0395900_0010107 Ga0395900_0010107_153_800 215
551 3300037418 Ga0395900_0010785 Ga0395900_0010785_442_1089 215
552 3300037418 Ga0395900_0012806 Ga0395900_0012806_5632_6279 215
553 3300037418 Ga0395900_0029934 Ga0395900_0029934_1605_2252 215
554 3300037418 Ga0395900_0062174 Ga0395900_0062174_857_1504 215
555 3300037418 Ga0395900_0067773 Ga0395900_0067773_103_750 215
556 3300037418 Ga0395900_0100262 Ga0395900_0100262_849_1496 215
557 3300037418 Ga0395900_0189883 Ga0395900_0189883_782_1429 215
558 3300037418 Ga0395900_0431123 Ga0395900_0431123_433_1080 215
559 3300037418 Ga0395900_0457429 Ga0395900_0457429_430_1077 215
560 3300037466 Ga0395898_0001152 Ga0395898_0001152_26343_26990 215
561 3300037466 Ga0395898_0001704 Ga0395898_0001704_24396_25043 215
562 3300037466 Ga0395898_0009910 Ga0395898_0009910_8982_9629 215
563 3300037466 Ga0395898_0045237 Ga0395898_0045237_1223_1870 215
564 3300037466 Ga0395898_0093909 Ga0395898_0093909_166_813 215
565 3300037466 Ga0395898_0101651 Ga0395898_0101651_130_777 215
566 3300037471 Ga0395905_0001384 Ga0395905_0001384_13269_13916 215
567 3300037471 Ga0395905_0002955 Ga0395905_0002955_1316_1963 215
568 3300037471 Ga0395905_0007880 Ga0395905_0007880_8368_9015 215
569 3300037471 Ga0395905_0013174 Ga0395905_0013174_2442_3089 215
570 3300037471 Ga0395905_0035368 Ga0395905_0035368_3264_3911 215
571 3300037471 Ga0395905_0053985 Ga0395905_0053985_1146_1793 215
572 3300037471 Ga0395905_0057964 Ga0395905_0057964_2559_3206 215
573 3300037471 Ga0395905_0085437 Ga0395905_0085437_900_1547 215
574 3300037471 Ga0395905_0614794 Ga0395905_0614794_315_962 215
575 3300037471 Ga0395905_0966875 Ga0395905_0966875_27_674 215
576 3300037471 Ga0395905_1122887 Ga0395905_1122887_11_658 215
577 3300038443 Ga0395901_0000386 Ga0395901_0000386_38665_39312 215
578 3300038443 Ga0395901_0006002 Ga0395901_0006002_7481_8128 215
579 3300038443 Ga0395901_0010596 Ga0395901_0010596_2117_2764 215
580 3300038443 Ga0395901_0017423 Ga0395901_0017423_50_697 215
581 3300038443 Ga0395901_0026413 Ga0395901_0026413_4403_5050 215
582 3300038443 Ga0395901_0114106 Ga0395901_0114106_713_1360 215
583 3300038443 Ga0395901_0182610 Ga0395901_0182610_797_1444 215
584 3300038443 Ga0395901_0387353 Ga0395901_0387353_179_826 215
585 3300038443 Ga0395901_0499546 Ga0395901_0499546_565_1212 215
586 3300038443 Ga0395901_0542402 Ga0395901_0542402_506_1153 215
587 3300044684 Ga0466966_0037161 Ga0466966_0037161_1770_2417 215
588 3300044693 Ga0466961_0041607 Ga0466961_0041607_448_1095 215
589 3300044694 Ga0466963_0581091 Ga0466963_0581091_116_763 215
590 3300044842 Ga0466957_0001787 Ga0466957_0001787_9192_9839 215
591 3300045836 Ga0466958_0042568 Ga0466958_0042568_1187_1834 215
592 3300045976 Ga0466967_0424086 Ga0466967_0424086_86_733 215
593 3300046460 Ga0495638_0000068 Ga0495638_0000068_134774_135421 215
594 3300046460 Ga0495638_0422830 Ga0495638_0422830_19_666 215
595 3300046492 Ga0495585_0071943 Ga0495585_0071943_20_667 215
596 3300046506 Ga0495583_0000269 Ga0495583_0000269_80855_81502 215
597 3300046507 Ga0495606_0036990 Ga0495606_0036990_1583_2230 215
598 3300046512 Ga0495610_0000082 Ga0495610_0000082_105505_106152 215
599 3300046512 Ga0495610_0000243 Ga0495610_0000243_38037_38684 215
600 3300046515 Ga0495620_0003625 Ga0495620_0003625_5720_6367 215
601 3300046519 Ga0495632_0005949 Ga0495632_0005949_5315_5962 215
602 3300046522 Ga0495643_0000561 Ga0495643_0000561_29671_30318 215
603 3300046524 Ga0495648_0000046 Ga0495648_0000046_134737_135384 215
604 3300046558 Ga0495633_0005860 Ga0495633_0005860_3735_4382 215
605 3300046558 Ga0495633_0019674 Ga0495633_0019674_2479_3126 215
606 3300046660 Ga0495625_0000832 Ga0495625_0000832_29329_29976 215
607 3300046692 Ga0495671_0000057 Ga0495671_0000057_81062_81709 215
608 3300047320 Ga0495672_0038842 Ga0495672_0038842_287_934 215
609 3300047323 Ga0495683_0005724 Ga0495683_0005724_177_857 215
610 3300047443 Ga0495687_000076 Ga0495687_000076_42955_43602 215
611 3300047469 Ga0495673_0000110 Ga0495673_0000110_133080_133727 215
612 3300048091 Ga0495626_0001225 Ga0495626_0001225_11224_11871 215
613 3300048903 Ga0496100_0001143 Ga0496100_0001143_4216_4863 215
614 3300048904 Ga0496101_0004565 Ga0496101_0004565_839_1486 215
615 3300048904 Ga0496101_0006709 Ga0496101_0006709_1751_2398 215
616 3300048905 Ga0496102_0000698 Ga0496102_0000698_17263_17910 215
617 3300048906 Ga0496103_0000258 Ga0496103_0000258_34795_35442 215
618 3300048907 Ga0496104_0000675 Ga0496104_0000675_13517_14164 215
619 3300048907 Ga0496104_0017956 Ga0496104_0017956_2390_3037 215
620 3300048908 Ga0496105_0000184 Ga0496105_0000184_13534_14181 215
621 3300048908 Ga0496105_0003801 Ga0496105_0003801_8468_9115 215
622 3300048910 Ga0496107_0355793 Ga0496107_0355793_364_1011 215
623 3300048912 Ga0496109_0002925 Ga0496109_0002925_2485_3132 215
624 3300048912 Ga0496109_0005801 Ga0496109_0005801_5493_6140 215
625 3300048914 Ga0496111_0012485 Ga0496111_0012485_4961_5608 215
626 3300048915 Ga0496112_0001054 Ga0496112_0001054_17433_18080 215
627 3300048915 Ga0496112_0015723 Ga0496112_0015723_1393_2040 215
628 3300048915 Ga0496112_0025699 Ga0496112_0025699_767_1414 215
629 3300048916 Ga0496113_0001048 Ga0496113_0001048_6337_6984 215
630 3300048917 Ga0496114_0213160 Ga0496114_0213160_532_1179 215
631 3300048919 Ga0496116_0001606 Ga0496116_0001606_9769_10416 215
632 3300048919 Ga0496116_0006963 Ga0496116_0006963_8717_9364 215
633 3300048919 Ga0496116_0019186 Ga0496116_0019186_203_850 215
634 3300048920 Ga0496117_0001983 Ga0496117_0001983_11044_11691 215
635 3300048920 Ga0496117_0006616 Ga0496117_0006616_688_1335 215
636 3300048920 Ga0496117_0047668 Ga0496117_0047668_1454_2101 215
637 3300048921 Ga0496118_0000335 Ga0496118_0000335_19318_19983 215
638 3300048921 Ga0496118_0002186 Ga0496118_0002186_11044_11691 215
639 3300048921 Ga0496118_0007403 Ga0496118_0007403_688_1335 215
640 3300048921 Ga0496118_0076912 Ga0496118_0076912_1185_1832 215
641 3300048922 Ga0496119_0001028 Ga0496119_0001028_21570_22217 215
642 3300048922 Ga0496119_0006485 Ga0496119_0006485_27_674 215
643 3300048923 Ga0496120_0000961 Ga0496120_0000961_29693_30340 215
644 3300048923 Ga0496120_0039250 Ga0496120_0039250_713_1360 215
645 3300048924 Ga0496121_0006115 Ga0496121_0006115_3482_4129 215
646 3300048924 Ga0496121_0006397 Ga0496121_0006397_13750_14397 215
647 3300048924 Ga0496121_0012699 Ga0496121_0012699_6042_6689 215
648 3300048925 Ga0496122_0001573 Ga0496122_0001573_11138_11785 215
649 3300048925 Ga0496122_0002945 Ga0496122_0002945_7065_7712 215
650 3300048925 Ga0496122_0054532 Ga0496122_0054532_145_792 215
651 3300048926 Ga0496123_0000428 Ga0496123_0000428_64077_64724 215
652 3300048926 Ga0496123_0003956 Ga0496123_0003956_7562_8209 215
653 3300048927 Ga0496124_0002149 Ga0496124_0002149_22799_23446 215
654 3300048927 Ga0496124_0004303 Ga0496124_0004303_12287_12934 215
655 3300048927 Ga0496124_0007434 Ga0496124_0007434_688_1335 215
656 3300048927 Ga0496124_0014032 Ga0496124_0014032_2100_2747 215
657 3300048928 Ga0496125_0003189 Ga0496125_0003189_16603_17250 215
658 3300048928 Ga0496125_0004588 Ga0496125_0004588_7957_8604 215
659 3300048928 Ga0496125_0018222 Ga0496125_0018222_851_1498 215
660 3300048928 Ga0496125_0046502 Ga0496125_0046502_2555_3202 215
661 3300048928 Ga0496125_0133927 Ga0496125_0133927_975_1622 215
662 3300048929 Ga0496126_0000158 Ga0496126_0000158_30095_30742 215
663 3300048929 Ga0496126_0002026 Ga0496126_0002026_9824_10471 215
664 3300049551 Ga0501335_000249 Ga0501335_000249_333_980 215
665 3300049574 Ga0501038_0003137 Ga0501038_0003137_13408_14055 215
666 3300049653 Ga0501206_000989 Ga0501206_000989_471_1118 215
667 3300049664 Ga0501224_004528 Ga0501224_004528_202_849 215
668 3300049669 Ga0501235_000092 Ga0501235_000092_3071_3718 215
669 3300049670 Ga0501236_000884 Ga0501236_000884_1545_2192 215
670 3300049705 Ga0501225_0002260 Ga0501225_0002260_4652_5299 215
671 3300049708 Ga0501245_000867 Ga0501245_000867_3068_3715 215
672 3300050491 nmdc:mga00v17_19848_c1 nmdc:mga00v17_19848_c1_3051_3698 215
673 3300050508 nmdc:mga09592_36160_c1 nmdc:mga09592_36160_c1_3264_3911 215
674 3300053088 Ga0500644_0116068 Ga0500644_0116068_153_800 215
675 3300053118 Ga0500594_0001846 Ga0500594_0001846_164_811 215
676 3300053122 Ga0500608_058548 Ga0500608_058548_265_912 215
677 3300053148 Ga0500590_003777 Ga0500590_003777_5641_6291 215
678 3300053156 Ga0500622_0028672 Ga0500622_0028672_602_1252 215
679 3300053157 Ga0500624_000361 Ga0500624_000361_12937_13584 215
680 3300053735 Ga0500596_000488 Ga0500596_000488_4379_5026 215
681 3300061719 Ga0466962_0108093 Ga0466962_0108093_23_670 215
682 iso_pu_bacteria 8057101203 8057105141 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

72

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.901 2 214
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8977 2 214
7k2t-assembly1.cif.gz_C mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8914 1 214
7dd0-assembly1.cif.gz_A crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8907 2 214
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8893 2 214
ID Description Score Start End Superfamily
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8984 1 214 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8906 1 214 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8751 2 202 3.40.50.300
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8747 1 194 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8664 2 63 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7G4RK67-F1-model_v4 ABC transporter domain-containing protein 0.9512 1 214 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9503 1 215 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9461 1 215 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7G4RK67-F1-model_v4 ABC transporter domain-containing protein 0.9426 1 214 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-Q93UJ9-F1-model_v4 Wzt2 0.9324 5 214 GO:0005524
GO:0005886
GO:0016887
GO:0140359

Feature Viewer

pLDDT pTM Quality
90.34 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map