F474895

General Info

Members Datasets Scaffolds Average Seq Length
682 301 1364 112

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100108728|Ga0097621_1001087282
Length 126
Sequence MKVGYSFPIAGYGEVMRKHTNDRLQGTLDMLVLKALASQGRMHGYAITLRIEQISESVLRLEEGSLYPALHRMTQSGWLRAEWGASENNRRARYYSITPAGRKQLAEEEQHWAHLTEAVTRVLRFV

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
215 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
279 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.91
Rhizosphere 96.04
Stem 0
Stem Tuber 0
Unclassified 38.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100108728 3300006237 Bacteria 2341
2 JGI24034J26672_10019277 3300002239 Unclassified 1063
3 rootH2_10135324 3300003320 Unclassified 3192
4 Ga0065707_10084700 3300005295 Bacteria 6870
5 Ga0065707_10105587 3300005295 Unclassified 2637
6 Ga0065707_10140368 3300005295 Unclassified 1781
7 Ga0070658_10071422 3300005327 Unclassified 2843
8 Ga0070676_11306196 3300005328 Unclassified 554
9 Ga0070683_100027896 3300005329 Bacteria 5097
10 Ga0070683_100894261 3300005329 Unclassified 852
11 Ga0068869_101531141 3300005334 Unclassified 593
12 Ga0070666_10081793 3300005335 Bacteria 2208
13 Ga0070680_100205734 3300005336 Bacteria 1660
14 Ga0070680_101013257 3300005336 Bacteria 717
15 Ga0070680_101225675 3300005336 Bacteria 649
16 Ga0070682_100066895 3300005337 Unclassified 2287
17 Ga0070660_100007116 3300005339 Bacteria 7777
18 Ga0070660_100311741 3300005339 Bacteria 1291
19 Ga0070660_101284253 3300005339 Bacteria 621
20 Ga0070660_101342869 3300005339 Bacteria 607
21 Ga0070689_101533395 3300005340 Unclassified 604
22 Ga0070691_10207733 3300005341 Unclassified 1032
23 Ga0070661_100206625 3300005344 Unclassified 1502
24 Ga0070661_100472674 3300005344 Unclassified 1000
25 Ga0070661_100498332 3300005344 Bacteria 975
26 Ga0070692_10516870 3300005345 Bacteria 776
27 Ga0070668_100487784 3300005347 Bacteria 1065
28 Ga0070668_100570154 3300005347 Unclassified 987
29 Ga0070668_102127138 3300005347 Unclassified 518
30 Ga0070669_100002529 3300005353 Bacteria 13220
31 Ga0070669_100273454 3300005353 Unclassified 1351
32 Ga0070669_100477421 3300005353 Unclassified 1031
33 Ga0070675_100003386 3300005354 Bacteria 12082
34 Ga0070675_100335089 3300005354 Bacteria 1339
35 Ga0070671_100553516 3300005355 Unclassified 992
36 Ga0070671_100892458 3300005355 Unclassified 776
37 Ga0070671_101684937 3300005355 Unclassified 563
38 Ga0070673_101439690 3300005364 Unclassified 649
39 Ga0070673_101463863 3300005364 Unclassified 644
40 Ga0070688_101466867 3300005365 Unclassified 554
41 Ga0070659_100266824 3300005366 Bacteria 1421
42 Ga0070667_100013313 3300005367 Bacteria 6794
43 Ga0070667_100772906 3300005367 Unclassified 891
44 Ga0070703_10000178 3300005406 Bacteria 31147
45 Ga0070714_100004824 3300005435 Bacteria 10232
46 Ga0070714_100018880 3300005435 Bacteria 5610
47 Ga0070714_100800584 3300005435 Bacteria 913
48 Ga0070714_102056372 3300005435 Bacteria 557
49 Ga0070714_102495966 3300005435 Bacteria 502
50 Ga0070713_100002665 3300005436 Bacteria 11632
51 Ga0070713_100004622 3300005436 Bacteria 9284
52 Ga0070713_100004920 3300005436 Bacteria 9067
53 Ga0070713_100009658 3300005436 Bacteria 6924
54 Ga0070713_100115208 3300005436 Bacteria 2349
55 Ga0070713_100292675 3300005436 Bacteria 1497
56 Ga0070713_100557921 3300005436 Unclassified 1085
57 Ga0070713_100956599 3300005436 Unclassified 825
58 Ga0070713_101054642 3300005436 Bacteria 785
59 Ga0070710_10043439 3300005437 Unclassified 2489
60 Ga0070710_10085532 3300005437 Bacteria 1850
61 Ga0070710_10107026 3300005437 Bacteria 1674
62 Ga0070701_11295914 3300005438 Unclassified 520
63 Ga0070711_100064540 3300005439 Bacteria 2559
64 Ga0070711_100071251 3300005439 Bacteria 2449
65 Ga0070711_100177274 3300005439 Bacteria 1629
66 Ga0070711_100217258 3300005439 Bacteria 1484
67 Ga0070711_100725683 3300005439 Bacteria 838
68 Ga0070711_101459842 3300005439 Unclassified 596
69 Ga0070705_100000349 3300005440 Bacteria 27279
70 Ga0070705_101089148 3300005440 Unclassified 653
71 Ga0070705_101772781 3300005440 Unclassified 523
72 Ga0070700_100191912 3300005441 Bacteria 1429
73 Ga0070700_100755097 3300005441 Bacteria 779
74 Ga0070694_100374644 3300005444 Unclassified 1109
75 Ga0070694_100718711 3300005444 Bacteria 813
76 Ga0070694_101035967 3300005444 Unclassified 682
77 Ga0070708_100015162 3300005445 Bacteria 6355
78 Ga0070708_100061872 3300005445 Bacteria 3346
79 Ga0070708_100066828 3300005445 Bacteria 3227
80 Ga0070708_100196948 3300005445 Bacteria 1885
81 Ga0070708_100813294 3300005445 Bacteria 878
82 Ga0070663_101057320 3300005455 Unclassified 708
83 Ga0070678_100621400 3300005456 Bacteria 966
84 Ga0070662_100081232 3300005457 Bacteria 2414
85 Ga0070662_100327720 3300005457 Unclassified 1250
86 Ga0070662_101958382 3300005457 Bacteria 506
87 Ga0070681_10079447 3300005458 Bacteria 3237
88 Ga0070681_10122863 3300005458 Bacteria 2529
89 Ga0068867_102389848 3300005459 Unclassified 503
90 Ga0070685_10154557 3300005466 Bacteria 1457
91 Ga0070706_100001322 3300005467 Bacteria 26367
92 Ga0070707_100661676 3300005468 Unclassified 1007
93 Ga0070707_100987970 3300005468 Unclassified 807
94 Ga0070698_100071709 3300005471 Bacteria 3473
95 Ga0070698_100121388 3300005471 Unclassified 2573
96 Ga0070698_100167067 3300005471 Unclassified 2142
97 Ga0070698_100526109 3300005471 Bacteria 1121
98 Ga0070698_100541033 3300005471 Bacteria 1104
99 Ga0070699_100000135 3300005518 Bacteria 68724
100 Ga0070699_100061294 3300005518 Bacteria 3260
101 Ga0070699_102187501 3300005518 Unclassified 505
102 Ga0070679_100002820 3300005530 Bacteria 15803
103 Ga0070679_100543827 3300005530 Bacteria 1105
104 Ga0070684_100112630 3300005535 Bacteria 2441
105 Ga0070684_100293092 3300005535 Bacteria 1492
106 Ga0070684_100622241 3300005535 Unclassified 1004
107 Ga0070697_100092974 3300005536 Unclassified 2496
108 Ga0070697_100102172 3300005536 Bacteria 2382
109 Ga0070697_100706292 3300005536 Unclassified 890
110 Ga0068853_100403690 3300005539 Bacteria 1279
111 Ga0068853_100433469 3300005539 Bacteria 1234
112 Ga0070672_100687194 3300005543 Unclassified 895
113 Ga0070686_100479740 3300005544 Unclassified 961
114 Ga0070695_100074705 3300005545 Bacteria 2228
115 Ga0070695_100285192 3300005545 Bacteria 1215
116 Ga0070695_100819438 3300005545 Unclassified 747
117 Ga0070696_100000042 3300005546 Bacteria 57704
118 Ga0070696_100062662 3300005546 Bacteria 2603
119 Ga0070693_100004231 3300005547 Bacteria 6776
120 Ga0070693_100211246 3300005547 Bacteria 1266
121 Ga0070665_100460581 3300005548 Bacteria 1282
122 Ga0070704_100202888 3300005549 Unclassified 1602
123 Ga0068855_100079482 3300005563 Bacteria 3803
124 Ga0068855_100108455 3300005563 Unclassified 3189
125 Ga0068855_102032573 3300005563 Unclassified 580
126 Ga0070664_100547903 3300005564 Bacteria 1069
127 Ga0070664_101668674 3300005564 Unclassified 604
128 Ga0070664_101928797 3300005564 Bacteria 560
129 Ga0068857_100023975 3300005577 Bacteria 5371
130 Ga0068857_100057143 3300005577 Unclassified 3463
131 Ga0068857_100063727 3300005577 Bacteria 3277
132 Ga0068857_100932727 3300005577 Bacteria 833
133 Ga0068854_101018738 3300005578 Unclassified 734
134 Ga0068854_101757551 3300005578 Unclassified 568
135 Ga0068856_100055278 3300005614 Bacteria 3917
136 Ga0068856_100123512 3300005614 Bacteria 2591
137 Ga0068856_100191778 3300005614 Bacteria 2057
138 Ga0068856_100570081 3300005614 Bacteria 1153
139 Ga0068856_100908813 3300005614 Bacteria 899
140 Ga0070702_100176467 3300005615 Unclassified 1394
141 Ga0068852_100229522 3300005616 Bacteria 1769
142 Ga0068859_100008926 3300005617 Bacteria 10126
143 Ga0068859_100094869 3300005617 Unclassified 3036
144 Ga0068859_100139588 3300005617 Bacteria 2497
145 Ga0068859_100714244 3300005617 Bacteria 1092
146 Ga0068859_101070864 3300005617 Unclassified 886
147 Ga0068859_101430511 3300005617 Unclassified 763
148 Ga0068864_100023876 3300005618 Bacteria 5139
149 Ga0068864_100232667 3300005618 Bacteria 1705
150 Ga0068864_100294007 3300005618 Bacteria 1519
151 Ga0068864_100827535 3300005618 Unclassified 911
152 Ga0068864_101529242 3300005618 Unclassified 671
153 Ga0068851_10640813 3300005834 Unclassified 650
154 Ga0068863_101893233 3300005841 Unclassified 606
155 Ga0068858_100021099 3300005842 Bacteria 6085
156 Ga0068858_100074768 3300005842 Unclassified 3146
157 Ga0068858_100807964 3300005842 Bacteria 915
158 Ga0068860_100990614 3300005843 Unclassified 858
159 Ga0068860_102459073 3300005843 Unclassified 541
160 Ga0068862_100030491 3300005844 Bacteria 4546
161 Ga0068862_100352664 3300005844 Bacteria 1365
162 Ga0081455_10123668 3300005937 Bacteria 2035
163 Ga0081455_10655328 3300005937 Unclassified 675
164 Ga0081539_10101917 3300005985 Bacteria 1461
165 Ga0070717_10005369 3300006028 Bacteria 9346
166 Ga0070717_10036751 3300006028 Bacteria 3974
167 Ga0070717_10371557 3300006028 Unclassified 1281
168 Ga0070717_10403822 3300006028 Bacteria 1228
169 Ga0070717_10527678 3300006028 Unclassified 1068
170 Ga0070717_11830724 3300006028 Unclassified 548
171 Ga0075432_10534870 3300006058 Unclassified 527
172 Ga0070715_10233117 3300006163 Bacteria 953
173 Ga0070715_10523909 3300006163 Unclassified 682
174 Ga0070715_10723572 3300006163 Bacteria 597
175 Ga0070715_10733568 3300006163 Bacteria 593
176 Ga0070715_10938833 3300006163 Bacteria 535
177 Ga0070712_100350499 3300006175 Bacteria 1208
178 Ga0070712_100472379 3300006175 Unclassified 1047
179 Ga0075366_10716035 3300006195 Bacteria 622
180 Ga0097621_100000269 3300006237 Bacteria 35187
181 Ga0068871_100019975 3300006358 Bacteria 5124
182 Ga0068871_100030265 3300006358 Bacteria 4261
183 Ga0068871_100124956 3300006358 Bacteria 2177
184 Ga0068871_100361103 3300006358 Bacteria 1286
185 Ga0075428_100034620 3300006844 Bacteria 5569
186 Ga0075428_100046964 3300006844 Unclassified 4743
187 Ga0075428_100226226 3300006844 Bacteria 2019
188 Ga0075428_100232870 3300006844 Bacteria 1988
189 Ga0075428_100447816 3300006844 Bacteria 1383
190 Ga0075428_100763098 3300006844 Bacteria 1029
191 Ga0075430_100010782 3300006846 Bacteria 7747
192 Ga0075430_100123833 3300006846 Bacteria 2155
193 Ga0075430_100159067 3300006846 Bacteria 1881
194 Ga0075431_100068393 3300006847 Unclassified 3665
195 Ga0075431_100068628 3300006847 Unclassified 3658
196 Ga0075431_100115445 3300006847 Bacteria 2771
197 Ga0075431_100211509 3300006847 Unclassified 1981
198 Ga0075431_100213262 3300006847 Bacteria 1972
199 Ga0075431_100375350 3300006847 Bacteria 1427
200 Ga0075431_100718987 3300006847 Unclassified 975
201 Ga0075431_100820328 3300006847 Unclassified 903
202 Ga0075433_10029871 3300006852 Bacteria 4647
203 Ga0075433_10165947 3300006852 Bacteria 1965
204 Ga0075433_10267740 3300006852 Unclassified 1514
205 Ga0075433_10339344 3300006852 Bacteria 1328
206 Ga0075433_10454695 3300006852 Unclassified 1129
207 Ga0075433_11066908 3300006852 Bacteria 703
208 Ga0075433_11311574 3300006852 Bacteria 627
209 Ga0075433_11414486 3300006852 Unclassified 601
210 Ga0075434_100102550 3300006871 Bacteria 2869
211 Ga0075434_100167337 3300006871 Unclassified 2218
212 Ga0075434_100336393 3300006871 Unclassified 1530
213 Ga0075434_100450950 3300006871 Unclassified 1308
214 Ga0075434_100814639 3300006871 Unclassified 950
215 Ga0075434_101504986 3300006871 Bacteria 682
216 Ga0075434_101513760 3300006871 Bacteria 680
217 Ga0075434_101913442 3300006871 Unclassified 599
218 Ga0075429_100071851 3300006880 Bacteria 3013
219 Ga0075429_100314057 3300006880 Unclassified 1372
220 Ga0075429_100344779 3300006880 Unclassified 1304
221 Ga0075429_100950858 3300006880 Bacteria 751
222 Ga0068865_100224943 3300006881 Bacteria 1469
223 Ga0068865_101697877 3300006881 Unclassified 569
224 Ga0075436_100031673 3300006914 Bacteria 3643
225 Ga0075436_100089914 3300006914 Bacteria 2134
226 Ga0075436_101409456 3300006914 Unclassified 528
227 Ga0097620_100008926 3300006931 Bacteria 10126
228 Ga0097620_100094871 3300006931 Unclassified 3036
229 Ga0097620_100139601 3300006931 Bacteria 2497
230 Ga0097620_100714249 3300006931 Bacteria 1092
231 Ga0097620_101070825 3300006931 Unclassified 886
232 Ga0097620_101430590 3300006931 Unclassified 763
233 Ga0075435_100328732 3300007076 Bacteria 1309
234 Ga0075435_101394274 3300007076 Bacteria 614
235 Ga0075435_101565841 3300007076 Unclassified 578
236 Ga0105240_10001098 3300009093 Bacteria 47733
237 Ga0105240_10017137 3300009093 Bacteria 9778
238 Ga0105240_10036276 3300009093 Bacteria 6344
239 Ga0111539_10000934 3300009094 Bacteria 38269
240 Ga0111539_10014759 3300009094 Bacteria 9745
241 Ga0111539_10027396 3300009094 Bacteria 6961
242 Ga0111539_10074041 3300009094 Bacteria 4014
243 Ga0111539_10103066 3300009094 Bacteria 3349
244 Ga0111539_10903983 3300009094 Unclassified 1027
245 Ga0111539_11707466 3300009094 Bacteria 730
246 Ga0105245_10692223 3300009098 Bacteria 1052
247 Ga0105247_10014769 3300009101 Unclassified 4681
248 Ga0114129_10005057 3300009147 Bacteria 18559
249 Ga0114129_10005926 3300009147 Bacteria 17298
250 Ga0114129_10011973 3300009147 Bacteria 12337
251 Ga0114129_10024505 3300009147 Bacteria 8549
252 Ga0114129_10122427 3300009147 Unclassified 3579
253 Ga0114129_10130917 3300009147 Bacteria 3446
254 Ga0114129_10175772 3300009147 Unclassified 2916
255 Ga0114129_10340593 3300009147 Unclassified 1989
256 Ga0114129_10654518 3300009147 Unclassified 1355
257 Ga0114129_10769084 3300009147 Unclassified 1231
258 Ga0114129_11360077 3300009147 Bacteria 878
259 Ga0114129_11483760 3300009147 Bacteria 834
260 Ga0114129_13116195 3300009147 Bacteria 542
261 Ga0105243_11981936 3300009148 Unclassified 616
262 Ga0105241_10242954 3300009174 Bacteria 1523
263 Ga0105241_10248696 3300009174 Bacteria 1506
264 Ga0105241_10397994 3300009174 Unclassified 1207
265 Ga0105242_10044673 3300009176 Unclassified 3589
266 Ga0105242_10100518 3300009176 Bacteria 2449
267 Ga0105242_10174050 3300009176 Unclassified 1894
268 Ga0105242_10907214 3300009176 Unclassified 882
269 Ga0105242_11592801 3300009176 Unclassified 686
270 Ga0105242_11990233 3300009176 Unclassified 623
271 Ga0105248_10034781 3300009177 Bacteria 5637
272 Ga0105248_10460906 3300009177 Bacteria 1433
273 Ga0105248_10837992 3300009177 Bacteria 1038
274 Ga0105248_11622438 3300009177 Bacteria 733
275 Ga0105237_10002116 3300009545 Bacteria 25058
276 Ga0105237_10557814 3300009545 Unclassified 1152
277 Ga0105237_10842624 3300009545 Unclassified 924
278 Ga0105238_10001216 3300009551 Bacteria 25926
279 Ga0105238_10569366 3300009551 Bacteria 1138
280 Ga0105249_10040612 3300009553 Bacteria 4226
281 Ga0105249_10471139 3300009553 Unclassified 1297
282 Ga0105239_10385410 3300010375 Bacteria 1585
283 Ga0105239_11210186 3300010375 Bacteria 871
284 Ga0105246_10359818 3300011119 Unclassified 1195
285 Ga0157371_10094622 3300013102 Unclassified 2117
286 Ga0157371_10137742 3300013102 Unclassified 1738
287 Ga0157370_10097893 3300013104 Bacteria 2752
288 Ga0157369_10032788 3300013105 Bacteria 5709
289 Ga0157369_10123712 3300013105 Bacteria 2744
290 Ga0157369_10268239 3300013105 Bacteria 1779
291 Ga0157369_10336462 3300013105 Unclassified 1568
292 Ga0157369_10511022 3300013105 Bacteria 1243
293 Ga0157374_10014399 3300013296 Bacteria 6922
294 Ga0157374_10039686 3300013296 Bacteria 4333
295 Ga0157374_10189609 3300013296 Unclassified 2011
296 Ga0157374_11410901 3300013296 Bacteria 719
297 Ga0157374_12197306 3300013296 Unclassified 579
298 Ga0157378_10162378 3300013297 Unclassified 2090
299 Ga0157378_11298096 3300013297 Bacteria 769
300 Ga0157378_11567884 3300013297 Bacteria 704
301 Ga0157378_12674794 3300013297 Bacteria 551
302 Ga0163162_10014973 3300013306 Bacteria 7575
303 Ga0163162_11929424 3300013306 Bacteria 676
304 Ga0157372_10001208 3300013307 Bacteria 27938
305 Ga0157372_10832506 3300013307 Unclassified 1071
306 Ga0157372_11744064 3300013307 Bacteria 716
307 Ga0157375_10973758 3300013308 Bacteria 989
308 Ga0157375_12024911 3300013308 Bacteria 685
309 Ga0157375_12824541 3300013308 Bacteria 580
310 Ga0163163_10024286 3300014325 Bacteria 5768
311 Ga0163163_10094729 3300014325 Bacteria 3004
312 Ga0163163_10419169 3300014325 Unclassified 1398
313 Ga0163163_10431743 3300014325 Bacteria 1376
314 Ga0163163_10805733 3300014325 Unclassified 1003
315 Ga0163163_11409068 3300014325 Bacteria 759
316 Ga0157380_10629748 3300014326 Unclassified 1066
317 Ga0157380_10962605 3300014326 Bacteria 884
318 Ga0157377_10016947 3300014745 Bacteria 3759
319 Ga0157379_10165446 3300014968 Unclassified 1996
320 Ga0157379_10432241 3300014968 Bacteria 1213
321 Ga0157379_12191656 3300014968 Unclassified 549
322 Ga0157376_10103539 3300014969 Bacteria 2492
323 Ga0157376_10239892 3300014969 Bacteria 1688
324 Ga0157376_10717028 3300014969 Unclassified 1007
325 Ga0157376_10949660 3300014969 Unclassified 880
326 Ga0157376_11598291 3300014969 Unclassified 686
327 Ga0163161_10450439 3300017792 Bacteria 1040
328 Ga0213875_10072972 3300021388 Bacteria 1602
329 Ga0207666_1006737 3300025271 Bacteria 1496
330 Ga0207697_10081184 3300025315 Bacteria 1366
331 Ga0207656_10390664 3300025321 Unclassified 698
332 Ga0207656_10455831 3300025321 Unclassified 646
333 Ga0207653_10000270 3300025885 Bacteria 30912
334 Ga0207692_10036514 3300025898 Bacteria 2397
335 Ga0207692_10069578 3300025898 Bacteria 1850
336 Ga0207692_10451371 3300025898 Bacteria 809
337 Ga0207692_10590956 3300025898 Unclassified 713
338 Ga0207688_10348387 3300025901 Bacteria 912
339 Ga0207647_10037530 3300025904 Bacteria 3071
340 Ga0207685_10392789 3300025905 Bacteria 709
341 Ga0207685_10504658 3300025905 Bacteria 637
342 Ga0207685_10615960 3300025905 Unclassified 584
343 Ga0207685_10666650 3300025905 Bacteria 564
344 Ga0207685_10707411 3300025905 Bacteria 549
345 Ga0207699_10015018 3300025906 Bacteria 4012
346 Ga0207699_10143415 3300025906 Unclassified 1572
347 Ga0207705_10021986 3300025909 Bacteria 4552
348 Ga0207684_10000786 3300025910 Bacteria 36890
349 Ga0207684_10939584 3300025910 Bacteria 725
350 Ga0207707_10012095 3300025912 Bacteria 7505
351 Ga0207707_10035852 3300025912 Bacteria 4338
352 Ga0207707_10049126 3300025912 Bacteria 3675
353 Ga0207707_10454123 3300025912 Bacteria 1096
354 Ga0207707_10615647 3300025912 Bacteria 918
355 Ga0207707_10649835 3300025912 Bacteria 889
356 Ga0207695_10049646 3300025913 Unclassified 4421
357 Ga0207695_10070660 3300025913 Bacteria 3568
358 Ga0207671_10123869 3300025914 Bacteria 1978
359 Ga0207671_10516114 3300025914 Unclassified 953
360 Ga0207693_10314604 3300025915 Bacteria 1226
361 Ga0207693_10419199 3300025915 Unclassified 1047
362 Ga0207663_10219352 3300025916 Bacteria 1383
363 Ga0207663_10309224 3300025916 Bacteria 1184
364 Ga0207663_10346502 3300025916 Unclassified 1123
365 Ga0207663_11146305 3300025916 Unclassified 625
366 Ga0207663_11283594 3300025916 Unclassified 590
367 Ga0207660_10171621 3300025917 Bacteria 1679
368 Ga0207660_10692809 3300025917 Bacteria 831
369 Ga0207660_10973797 3300025917 Bacteria 692
370 Ga0207662_10260572 3300025918 Bacteria 1141
371 Ga0207657_10390152 3300025919 Bacteria 1096
372 Ga0207657_10414886 3300025919 Bacteria 1058
373 Ga0207649_10308732 3300025920 Bacteria 1159
374 Ga0207649_10507148 3300025920 Unclassified 918
375 Ga0207652_10005046 3300025921 Bacteria 10701
376 Ga0207652_10182045 3300025921 Bacteria 1888
377 Ga0207652_10214892 3300025921 Bacteria 1732
378 Ga0207681_10008916 3300025923 Bacteria 6123
379 Ga0207681_10193247 3300025923 Unclassified 1558
380 Ga0207694_10002111 3300025924 Bacteria 16387
381 Ga0207694_10624445 3300025924 Bacteria 907
382 Ga0207650_10707499 3300025925 Unclassified 851
383 Ga0207650_11276507 3300025925 Bacteria 625
384 Ga0207687_10278355 3300025927 Unclassified 1340
385 Ga0207687_10693528 3300025927 Unclassified 864
386 Ga0207687_10727757 3300025927 Bacteria 843
387 Ga0207700_10001659 3300025928 Bacteria 12652
388 Ga0207700_10002766 3300025928 Bacteria 10111
389 Ga0207700_10003986 3300025928 Bacteria 8647
390 Ga0207700_10082166 3300025928 Bacteria 2518
391 Ga0207700_10341121 3300025928 Bacteria 1303
392 Ga0207700_10549119 3300025928 Unclassified 1025
393 Ga0207700_10883664 3300025928 Bacteria 800
394 Ga0207664_10004670 3300025929 Bacteria 9294
395 Ga0207664_10007352 3300025929 Bacteria 7635
396 Ga0207664_10219258 3300025929 Bacteria 1649
397 Ga0207664_10374251 3300025929 Bacteria 1264
398 Ga0207644_10287862 3300025931 Unclassified 1321
399 Ga0207690_10500904 3300025932 Bacteria 982
400 Ga0207690_10829040 3300025932 Unclassified 765
401 Ga0207690_10852491 3300025932 Bacteria 754
402 Ga0207706_10043319 3300025933 Bacteria 3989
403 Ga0207706_10258712 3300025933 Bacteria 1520
404 Ga0207686_10078823 3300025934 Unclassified 2143
405 Ga0207686_10398071 3300025934 Unclassified 1048
406 Ga0207686_10746009 3300025934 Unclassified 781
407 Ga0207670_10182935 3300025936 Unclassified 1580
408 Ga0207670_10185727 3300025936 Unclassified 1569
409 Ga0207670_10583138 3300025936 Bacteria 917
410 Ga0207704_10205086 3300025938 Bacteria 1446
411 Ga0207711_10114034 3300025941 Bacteria 2407
412 Ga0207711_10611042 3300025941 Bacteria 1017
413 Ga0207689_10126507 3300025942 Bacteria 2102
414 Ga0207689_10747064 3300025942 Unclassified 825
415 Ga0207689_11488865 3300025942 Unclassified 565
416 Ga0207661_10028688 3300025944 Bacteria 4265
417 Ga0207661_11087909 3300025944 Bacteria 736
418 Ga0207661_11148395 3300025944 Unclassified 715
419 Ga0207679_10489864 3300025945 Bacteria 1096
420 Ga0207679_10937435 3300025945 Bacteria 793
421 Ga0207679_11435152 3300025945 Unclassified 633
422 Ga0207667_10000199 3300025949 Bacteria 87200
423 Ga0207667_10037314 3300025949 Bacteria 5195
424 Ga0207651_11269592 3300025960 Unclassified 662
425 Ga0207712_10070473 3300025961 Bacteria 2512
426 Ga0207712_10249364 3300025961 Unclassified 1434
427 Ga0207668_10122907 3300025972 Bacteria 1969
428 Ga0207640_10311047 3300025981 Bacteria 1250
429 Ga0207658_10787587 3300025986 Unclassified 863
430 Ga0207703_10072612 3300026035 Unclassified 2845
431 Ga0207703_11063034 3300026035 Bacteria 777
432 Ga0207703_12228176 3300026035 Unclassified 524
433 Ga0207639_10030928 3300026041 Bacteria 3931
434 Ga0207639_10038808 3300026041 Bacteria 3545
435 Ga0207639_10865575 3300026041 Unclassified 844
436 Ga0207678_11021316 3300026067 Bacteria 732
437 Ga0207678_11834848 3300026067 Bacteria 530
438 Ga0207708_10235005 3300026075 Bacteria 1472
439 Ga0207702_10027148 3300026078 Bacteria 4754
440 Ga0207702_10246596 3300026078 Bacteria 1675
441 Ga0207641_10688466 3300026088 Unclassified 1006
442 Ga0207648_12287290 3300026089 Unclassified 501
443 Ga0207676_10377945 3300026095 Bacteria 1318
444 Ga0207676_10656132 3300026095 Bacteria 1013
445 Ga0207676_11499056 3300026095 Bacteria 671
446 Ga0207674_10039523 3300026116 Bacteria 4890
447 Ga0207674_10134153 3300026116 Unclassified 2439
448 Ga0207674_10390310 3300026116 Bacteria 1346
449 Ga0207683_10234525 3300026121 Bacteria 1673
450 Ga0207428_10003364 3300027907 Bacteria 15543
451 Ga0207428_10006774 3300027907 Bacteria 10512
452 Ga0207428_10022937 3300027907 Bacteria 5257
453 Ga0207428_10294714 3300027907 Unclassified 1201
454 Ga0268266_11028437 3300028379 Bacteria 797
455 Ga0268265_10065399 3300028380 Unclassified 2806
456 Ga0268265_10155156 3300028380 Bacteria 1936
457 Ga0268264_10835665 3300028381 Unclassified 922
458 Ga0268264_11415987 3300028381 Unclassified 706
459 Ga0265334_10124094 3300028573 Unclassified 922
460 Ga0265338_10005369 3300028800 Bacteria 16754
461 Ga0265338_10006091 3300028800 Bacteria 15487
462 Ga0265338_10050132 3300028800 Bacteria 3777
463 Ga0265330_10027182 3300031235 Bacteria 2585
464 Ga0265332_10016963 3300031238 Bacteria 3213
465 Ga0265328_10011597 3300031239 Bacteria 3516
466 Ga0265320_10108859 3300031240 Bacteria 1271
467 Ga0265339_10007701 3300031249 Bacteria 6928
468 Ga0265339_10059657 3300031249 Bacteria 2057
469 Ga0265316_10020178 3300031344 Bacteria 5678
470 Ga0265316_10428090 3300031344 Unclassified 951
471 Ga0265313_10006754 3300031595 Bacteria 8025
472 Ga0265314_10000027 3300031711 Bacteria 278331
473 Ga0265314_10000326 3300031711 Bacteria 67045
474 Ga0265342_10051608 3300031712 Bacteria 2453
475 Ga0307413_11248985 3300031824 Unclassified 648
476 Ga0307410_11994011 3300031852 Unclassified 518
477 Ga0307406_10312654 3300031901 Unclassified 1212
478 Ga0307416_100804261 3300032002 Bacteria 1036
479 Ga0307416_101016316 3300032002 Bacteria 932
480 Ga0307414_10868050 3300032004 Bacteria 826
481 Ga0307415_102269637 3300032126 Unclassified 532
482 Ga0373949_0092611 3300035090 Bacteria 819
483 Ga0373949_0105989 3300035090 Bacteria 775
484 Ga0373932_0044189 3300035112 Bacteria 1298
485 Ga0373941_0148436 3300035115 Bacteria 858
486 Ga0373957_0114506 3300035120 Bacteria 1088
487 Ga0373943_0022358 3300035170 Unclassified 2930
488 Ga0373946_0472301 3300035171 Unclassified 641
489 Ga0373962_0115106 3300035242 Unclassified 852
490 Ga0373924_0104087 3300035410 Bacteria 1223
491 Ga0373931_0094581 3300035691 Bacteria 1671
492 Ga0373931_0132120 3300035691 Unclassified 1438
493 Ga0373931_0287927 3300035691 Bacteria 1011
494 Ga0373927_0005031 3300035695 Bacteria 9149
495 Ga0373927_0057457 3300035695 Unclassified 2516
496 Ga0373933_0079496 3300035724 Bacteria 2008
497 Ga0373947_0001881 3300035725 Bacteria 12814
498 Ga0373937_0000436 3300036401 Bacteria 38637
499 Ga0373937_1512152 3300036401 Unclassified 619
500 Ga0373925_0206095 3300037068 Bacteria 1565
501 Ga0373925_1026057 3300037068 Bacteria 679
502 Ga0373925_1253650 3300037068 Unclassified 609
503 Ga0395899_0121348 3300037312 Bacteria 1872
504 Ga0395900_0042637 3300037418 Bacteria 4676
505 Ga0395900_0985525 3300037418 Unclassified 763
506 Ga0395898_0017488 3300037466 Bacteria 7320
507 Ga0395905_0040624 3300037471 Bacteria 4364
508 Ga0395905_0391624 3300037471 Unclassified 1284
509 Ga0436364_0346683 3300037853 Unclassified 3208
510 Ga0436364_0486904 3300037853 Unclassified 595
511 Ga0436364_1040119 3300037853 Unclassified 868
512 Ga0395901_0009223 3300038443 Bacteria 9997
513 Ga0395901_0350263 3300038443 Bacteria 1524
514 Ga0436365_0151676 3300039437 Unclassified 625
515 Ga0436365_0491275 3300039437 Bacteria 1194
516 Ga0436365_1100517 3300039437 Unclassified 4361
517 Ga0436365_1912650 3300039437 Bacteria 1443
518 Ga0436363_0641965 3300039450 Bacteria 655
519 Ga0436363_1255938 3300039450 Bacteria 987
520 Ga0451849_1378011 3300041505 Bacteria 1433
521 Ga0439442_135005 3300042002 Unclassified 544
522 Ga0439443_102656 3300042003 Bacteria 549
523 Ga0439449_0318418 3300042007 Unclassified 588
524 Ga0439435_0157484 3300042436 Unclassified 732
525 Ga0439444_0133126 3300042437 Unclassified 589
526 Ga0439440_0253575 3300042993 Unclassified 537
527 Ga0453683_0537091 3300044673 Unclassified 760
528 Ga0466963_0002123 3300044694 Bacteria 10966
529 Ga0466963_0314621 3300044694 Bacteria 1102
530 Ga0466963_0666251 3300044694 Unclassified 734
531 Ga0466957_0232923 3300044842 Bacteria 1220
532 Ga0466957_0355487 3300044842 Unclassified 995
533 Ga0466959_0326347 3300045049 Unclassified 1049
534 Ga0466967_0136980 3300045976 Bacteria 2277
535 Ga0466967_0277231 3300045976 Bacteria 1608
536 Ga0495651_0011967 3300046462 Bacteria 6675
537 Ga0495580_0001206 3300046472 Bacteria 22766
538 Ga0495580_0866997 3300046472 Unclassified 582
539 Ga0495639_0069640 3300046475 Bacteria 1623
540 Ga0495639_0192531 3300046475 Unclassified 996
541 Ga0495662_0088605 3300046476 Bacteria 1508
542 Ga0495664_0002288 3300046477 Bacteria 10268
543 Ga0495664_0486467 3300046477 Unclassified 738
544 Ga0495585_0475116 3300046492 Unclassified 596
545 Ga0495608_0330686 3300046511 Bacteria 940
546 Ga0495628_0175580 3300046516 Unclassified 1623
547 Ga0495628_0310800 3300046516 Bacteria 1165
548 Ga0495628_0386396 3300046516 Bacteria 1024
549 Ga0495652_0608864 3300046529 Bacteria 744
550 Ga0495652_0769770 3300046529 Unclassified 643
551 Ga0495665_0387700 3300046531 Unclassified 709
552 Ga0495586_0427666 3300046535 Unclassified 763
553 Ga0495645_0079801 3300046543 Bacteria 2350
554 Ga0495645_0120046 3300046543 Unclassified 1851
555 Ga0495645_0850645 3300046543 Unclassified 544
556 Ga0495667_0010911 3300046559 Bacteria 6143
557 Ga0495667_0485942 3300046559 Bacteria 774
558 Ga0495635_0993425 3300046663 Unclassified 534
559 Ga0495659_0152201 3300046664 Bacteria 929
560 Ga0495659_0254700 3300046664 Unclassified 732
561 Ga0495588_0330979 3300046674 Unclassified 801
562 Ga0495599_0682359 3300046678 Unclassified 593
563 Ga0495623_0510656 3300046679 Unclassified 633
564 Ga0495646_0625975 3300046680 Unclassified 545
565 Ga0495658_0111615 3300046683 Archaea 1644
566 Ga0495613_0117899 3300046689 Archaea 1908
567 Ga0495613_0320513 3300046689 Bacteria 1070
568 Ga0495624_0016993 3300046690 Unclassified 4891
569 Ga0495600_0124046 3300046809 Unclassified 1680
570 Ga0495600_0433221 3300046809 Unclassified 815
571 Ga0495636_0585042 3300047318 Unclassified 545
572 Ga0495674_1028772 3300047319 Unclassified 630
573 Ga0495680_0186264 3300047322 Bacteria 1495
574 Ga0495684_0000911 3300047471 Bacteria 24040
575 Ga0495684_0213010 3300047471 Unclassified 1420
576 Ga0496104_0316728 3300048907 Bacteria 1473
577 Ga0496104_0657541 3300048907 Unclassified 957
578 Ga0496106_0638488 3300048909 Bacteria 851
579 Ga0496106_0653733 3300048909 Unclassified 840
580 Ga0496109_0658828 3300048912 Bacteria 984
581 Ga0496109_0977674 3300048912 Bacteria 784
582 Ga0496109_1064658 3300048912 Unclassified 746
583 Ga0496112_0014392 3300048915 Bacteria 7335
584 Ga0496112_0440529 3300048915 Unclassified 1241
585 Ga0496112_0455426 3300048915 Bacteria 1217
586 Ga0496112_1931215 3300048915 Unclassified 502
587 Ga0496113_0857123 3300048916 Unclassified 720
588 Ga0496115_0796698 3300048918 Unclassified 736
589 Ga0496126_0017619 3300048929 Bacteria 7116
590 Ga0501032_0052018 3300049569 Bacteria 2760
591 Ga0501033_0037014 3300049570 Bacteria 3654
592 Ga0501033_0932987 3300049570 Bacteria 582
593 Ga0501034_0008885 3300049571 Bacteria 10563
594 Ga0501034_0492342 3300049571 Bacteria 1140
595 Ga0501034_0520667 3300049571 Unclassified 1101
596 Ga0501036_0073706 3300049572 Unclassified 2886
597 Ga0501037_0124447 3300049573 Unclassified 1852
598 Ga0501037_0130040 3300049573 Bacteria 1806
599 Ga0501038_1252688 3300049574 Bacteria 537
600 Ga0501039_0088770 3300049575 Unclassified 2408
601 Ga0501040_0707463 3300049576 Unclassified 729
602 Ga0501043_0337631 3300049579 Unclassified 1147
603 Ga0501043_0920068 3300049579 Bacteria 626
604 Ga0501046_0002288 3300049580 Bacteria 18063
605 Ga0501047_0103815 3300049581 Bacteria 2723
606 Ga0501047_1096121 3300049581 Unclassified 609
607 Ga0501048_0011383 3300049582 Bacteria 6634
608 Ga0501048_0835855 3300049582 Bacteria 662
609 Ga0501067_0242339 3300049583 Bacteria 1003
610 Ga0501068_0025574 3300049584 Unclassified 3472
611 Ga0501069_0197898 3300049585 Bacteria 1164
612 Ga0501069_0557134 3300049585 Bacteria 686
613 Ga0501070_0722244 3300049586 Bacteria 787
614 Ga0501072_0034831 3300049588 Unclassified 3945
615 Ga0501073_0007424 3300049589 Bacteria 8147
616 Ga0501076_1675952 3300049592 Unclassified 522
617 Ga0501209_196798 3300049656 Unclassified 619
618 Ga0501233_181462 3300049668 Bacteria 603
619 Ga0501079_0240918 3300049741 Bacteria 1413
620 Ga0501080_0020576 3300049742 Bacteria 6110
621 Ga0501035_0011498 3300049822 Bacteria 8203
622 Ga0501044_0027325 3300049823 Bacteria 6031
623 Ga0501044_0098694 3300049823 Bacteria 2940
624 Ga0501045_0800695 3300049824 Unclassified 694
625 nmdc:mga05p37_1076289_c1 3300050507 Unclassified 845
626 nmdc:mga05p37_1175_c1 3300050507 Bacteria 30186
627 nmdc:mga05p37_12923_c1 3300050507 Bacteria 9987
628 nmdc:mga05p37_158957_c1 3300050507 Unclassified 2760
629 nmdc:mga05p37_194009_c1 3300050507 Bacteria 2464
630 nmdc:mga05p37_393985_c1 3300050507 Unclassified 1619
631 nmdc:mga05p37_420321_c1 3300050507 Unclassified 1556
632 nmdc:mga05p37_877264_c1 3300050507 Bacteria 971
633 nmdc:mga05p37_89462_c1 3300050507 Unclassified 3794
634 nmdc:mga09592_1254616_c1 3300050508 Bacteria 611
635 nmdc:mga09592_292505_c1 3300050508 Unclassified 1412
636 nmdc:mga09592_64119_c1 3300050508 Bacteria 3110
637 nmdc:mga0qj67_1181546_c1 3300050509 Bacteria 596
638 nmdc:mga0qj67_123955_c1 3300050509 Bacteria 2091
639 nmdc:mga0qj67_277269_c1 3300050509 Bacteria 1359
640 nmdc:mga0qj67_519566_c1 3300050509 Unclassified 956
641 nmdc:mga0qj67_604582_c1 3300050509 Unclassified 877
642 nmdc:mga0qj67_68359_c1 3300050509 Bacteria 2831
643 nmdc:mga0qj67_96504_c1 3300050509 Bacteria 2380
644 nmdc:mga06r32_110927_c1 3300050510 Bacteria 2699
645 nmdc:mga06r32_1113767_c1 3300050510 Unclassified 738
646 nmdc:mga06r32_112058_c1 3300050510 Bacteria 2685
647 nmdc:mga06r32_1124102_c1 3300050510 Unclassified 734
648 nmdc:mga06r32_327118_c1 3300050510 Bacteria 1518
649 nmdc:mga06r32_4404_c1 3300050510 Bacteria 12593
650 nmdc:mga06r32_516266_c1 3300050510 Unclassified 1171
651 nmdc:mga08y16_1370896_c1 3300050511 Unclassified 671
652 nmdc:mga08y16_305471_c1 3300050511 Unclassified 1639
653 nmdc:mga08y16_3730_c1 3300050511 Bacteria 15857
654 nmdc:mga08y16_57936_c1 3300050511 Bacteria 4048
655 nmdc:mga08y16_657636_c1 3300050511 Bacteria 1051
656 nmdc:mga08y16_7482_c2 3300050511 Bacteria 8665
657 nmdc:mga08y16_891852_c1 3300050511 Unclassified 876
658 nmdc:mga0n895_1258959_c1 3300050512 Unclassified 712
659 nmdc:mga0n895_1578364_c1 3300050512 Unclassified 621
660 nmdc:mga0n895_181846_c1 3300050512 Unclassified 2134
661 nmdc:mga0n895_1820827_c1 3300050512 Unclassified 569
662 nmdc:mga0n895_2221668_c1 3300050512 Bacteria 504
663 nmdc:mga0n895_273899_c1 3300050512 Unclassified 1712
664 nmdc:mga0rr50_1311992_c1 3300050513 Bacteria 614
665 nmdc:mga0rr50_1467233_c1 3300050513 Bacteria 577
666 nmdc:mga0rr50_1704597_c1 3300050513 Bacteria 531
667 nmdc:mga0rr50_366612_c1 3300050513 Bacteria 1213
668 nmdc:mga08x19_472022_c1 3300050514 Unclassified 884
669 nmdc:mga08x19_64606_c1 3300050514 Bacteria 2376
670 nmdc:mga0a205_1119762_c1 3300050515 Unclassified 635
671 nmdc:mga0a205_648725_c1 3300050515 Unclassified 907
672 nmdc:mga0a205_899601_c1 3300050515 Bacteria 732
673 Ga0495601_0095487 3300053077 Bacteria 1917
674 Ga0495601_0353222 3300053077 Unclassified 956
675 Ga0495601_0531395 3300053077 Bacteria 758
676 Ga0495619_0134715 3300053085 Bacteria 1699
677 Ga0501084_0010357 3300054114 Bacteria 7714
678 Ga0590071_000460 3300059421 Bacteria 11857
679 Ga0590074_040648 3300059423 Bacteria 836
680 Ga0590075_002447 3300059424 Bacteria 4450
681 Ga0590077_006828 3300059426 Bacteria 2337
682 Ga0501082_0002643 3300060353 Bacteria 15675
683 Ga0097621_100108728
684 JGI24034J26672_10019277
685 rootH2_10135324
686 Ga0065707_10084700
687 Ga0065707_10105587
688 Ga0065707_10140368
689 Ga0070658_10071422
690 Ga0070676_11306196
691 Ga0070683_100027896
692 Ga0070683_100894261
693 Ga0068869_101531141
694 Ga0070666_10081793
695 Ga0070680_100205734
696 Ga0070680_101013257
697 Ga0070680_101225675
698 Ga0070682_100066895
699 Ga0070660_100007116
700 Ga0070660_100311741
701 Ga0070660_101284253
702 Ga0070660_101342869
703 Ga0070689_101533395
704 Ga0070691_10207733
705 Ga0070661_100206625
706 Ga0070661_100472674
707 Ga0070661_100498332
708 Ga0070692_10516870
709 Ga0070668_100487784
710 Ga0070668_100570154
711 Ga0070668_102127138
712 Ga0070669_100002529
713 Ga0070669_100273454
714 Ga0070669_100477421
715 Ga0070675_100003386
716 Ga0070675_100335089
717 Ga0070671_100553516
718 Ga0070671_100892458
719 Ga0070671_101684937
720 Ga0070673_101439690
721 Ga0070673_101463863
722 Ga0070688_101466867
723 Ga0070659_100266824
724 Ga0070667_100013313
725 Ga0070667_100772906
726 Ga0070703_10000178
727 Ga0070714_100004824
728 Ga0070714_100018880
729 Ga0070714_100800584
730 Ga0070714_102056372
731 Ga0070714_102495966
732 Ga0070713_100002665
733 Ga0070713_100004622
734 Ga0070713_100004920
735 Ga0070713_100009658
736 Ga0070713_100115208
737 Ga0070713_100292675
738 Ga0070713_100557921
739 Ga0070713_100956599
740 Ga0070713_101054642
741 Ga0070710_10043439
742 Ga0070710_10085532
743 Ga0070710_10107026
744 Ga0070701_11295914
745 Ga0070711_100064540
746 Ga0070711_100071251
747 Ga0070711_100177274
748 Ga0070711_100217258
749 Ga0070711_100725683
750 Ga0070711_101459842
751 Ga0070705_100000349
752 Ga0070705_101089148
753 Ga0070705_101772781
754 Ga0070700_100191912
755 Ga0070700_100755097
756 Ga0070694_100374644
757 Ga0070694_100718711
758 Ga0070694_101035967
759 Ga0070708_100015162
760 Ga0070708_100061872
761 Ga0070708_100066828
762 Ga0070708_100196948
763 Ga0070708_100813294
764 Ga0070663_101057320
765 Ga0070678_100621400
766 Ga0070662_100081232
767 Ga0070662_100327720
768 Ga0070662_101958382
769 Ga0070681_10079447
770 Ga0070681_10122863
771 Ga0068867_102389848
772 Ga0070685_10154557
773 Ga0070706_100001322
774 Ga0070707_100661676
775 Ga0070707_100987970
776 Ga0070698_100071709
777 Ga0070698_100121388
778 Ga0070698_100167067
779 Ga0070698_100526109
780 Ga0070698_100541033
781 Ga0070699_100000135
782 Ga0070699_100061294
783 Ga0070699_102187501
784 Ga0070679_100002820
785 Ga0070679_100543827
786 Ga0070684_100112630
787 Ga0070684_100293092
788 Ga0070684_100622241
789 Ga0070697_100092974
790 Ga0070697_100102172
791 Ga0070697_100706292
792 Ga0068853_100403690
793 Ga0068853_100433469
794 Ga0070672_100687194
795 Ga0070686_100479740
796 Ga0070695_100074705
797 Ga0070695_100285192
798 Ga0070695_100819438
799 Ga0070696_100000042
800 Ga0070696_100062662
801 Ga0070693_100004231
802 Ga0070693_100211246
803 Ga0070665_100460581
804 Ga0070704_100202888
805 Ga0068855_100079482
806 Ga0068855_100108455
807 Ga0068855_102032573
808 Ga0070664_100547903
809 Ga0070664_101668674
810 Ga0070664_101928797
811 Ga0068857_100023975
812 Ga0068857_100057143
813 Ga0068857_100063727
814 Ga0068857_100932727
815 Ga0068854_101018738
816 Ga0068854_101757551
817 Ga0068856_100055278
818 Ga0068856_100123512
819 Ga0068856_100191778
820 Ga0068856_100570081
821 Ga0068856_100908813
822 Ga0070702_100176467
823 Ga0068852_100229522
824 Ga0068859_100008926
825 Ga0068859_100094869
826 Ga0068859_100139588
827 Ga0068859_100714244
828 Ga0068859_101070864
829 Ga0068859_101430511
830 Ga0068864_100023876
831 Ga0068864_100232667
832 Ga0068864_100294007
833 Ga0068864_100827535
834 Ga0068864_101529242
835 Ga0068851_10640813
836 Ga0068863_101893233
837 Ga0068858_100021099
838 Ga0068858_100074768
839 Ga0068858_100807964
840 Ga0068860_100990614
841 Ga0068860_102459073
842 Ga0068862_100030491
843 Ga0068862_100352664
844 Ga0081455_10123668
845 Ga0081455_10655328
846 Ga0081539_10101917
847 Ga0070717_10005369
848 Ga0070717_10036751
849 Ga0070717_10371557
850 Ga0070717_10403822
851 Ga0070717_10527678
852 Ga0070717_11830724
853 Ga0075432_10534870
854 Ga0070715_10233117
855 Ga0070715_10523909
856 Ga0070715_10723572
857 Ga0070715_10733568
858 Ga0070715_10938833
859 Ga0070712_100350499
860 Ga0070712_100472379
861 Ga0075366_10716035
862 Ga0097621_100000269
863 Ga0068871_100019975
864 Ga0068871_100030265
865 Ga0068871_100124956
866 Ga0068871_100361103
867 Ga0075428_100034620
868 Ga0075428_100046964
869 Ga0075428_100226226
870 Ga0075428_100232870
871 Ga0075428_100447816
872 Ga0075428_100763098
873 Ga0075430_100010782
874 Ga0075430_100123833
875 Ga0075430_100159067
876 Ga0075431_100068393
877 Ga0075431_100068628
878 Ga0075431_100115445
879 Ga0075431_100211509
880 Ga0075431_100213262
881 Ga0075431_100375350
882 Ga0075431_100718987
883 Ga0075431_100820328
884 Ga0075433_10029871
885 Ga0075433_10165947
886 Ga0075433_10267740
887 Ga0075433_10339344
888 Ga0075433_10454695
889 Ga0075433_11066908
890 Ga0075433_11311574
891 Ga0075433_11414486
892 Ga0075434_100102550
893 Ga0075434_100167337
894 Ga0075434_100336393
895 Ga0075434_100450950
896 Ga0075434_100814639
897 Ga0075434_101504986
898 Ga0075434_101513760
899 Ga0075434_101913442
900 Ga0075429_100071851
901 Ga0075429_100314057
902 Ga0075429_100344779
903 Ga0075429_100950858
904 Ga0068865_100224943
905 Ga0068865_101697877
906 Ga0075436_100031673
907 Ga0075436_100089914
908 Ga0075436_101409456
909 Ga0097620_100008926
910 Ga0097620_100094871
911 Ga0097620_100139601
912 Ga0097620_100714249
913 Ga0097620_101070825
914 Ga0097620_101430590
915 Ga0075435_100328732
916 Ga0075435_101394274
917 Ga0075435_101565841
918 Ga0105240_10001098
919 Ga0105240_10017137
920 Ga0105240_10036276
921 Ga0111539_10000934
922 Ga0111539_10014759
923 Ga0111539_10027396
924 Ga0111539_10074041
925 Ga0111539_10103066
926 Ga0111539_10903983
927 Ga0111539_11707466
928 Ga0105245_10692223
929 Ga0105247_10014769
930 Ga0114129_10005057
931 Ga0114129_10005926
932 Ga0114129_10011973
933 Ga0114129_10024505
934 Ga0114129_10122427
935 Ga0114129_10130917
936 Ga0114129_10175772
937 Ga0114129_10340593
938 Ga0114129_10654518
939 Ga0114129_10769084
940 Ga0114129_11360077
941 Ga0114129_11483760
942 Ga0114129_13116195
943 Ga0105243_11981936
944 Ga0105241_10242954
945 Ga0105241_10248696
946 Ga0105241_10397994
947 Ga0105242_10044673
948 Ga0105242_10100518
949 Ga0105242_10174050
950 Ga0105242_10907214
951 Ga0105242_11592801
952 Ga0105242_11990233
953 Ga0105248_10034781
954 Ga0105248_10460906
955 Ga0105248_10837992
956 Ga0105248_11622438
957 Ga0105237_10002116
958 Ga0105237_10557814
959 Ga0105237_10842624
960 Ga0105238_10001216
961 Ga0105238_10569366
962 Ga0105249_10040612
963 Ga0105249_10471139
964 Ga0105239_10385410
965 Ga0105239_11210186
966 Ga0105246_10359818
967 Ga0157371_10094622
968 Ga0157371_10137742
969 Ga0157370_10097893
970 Ga0157369_10032788
971 Ga0157369_10123712
972 Ga0157369_10268239
973 Ga0157369_10336462
974 Ga0157369_10511022
975 Ga0157374_10014399
976 Ga0157374_10039686
977 Ga0157374_10189609
978 Ga0157374_11410901
979 Ga0157374_12197306
980 Ga0157378_10162378
981 Ga0157378_11298096
982 Ga0157378_11567884
983 Ga0157378_12674794
984 Ga0163162_10014973
985 Ga0163162_11929424
986 Ga0157372_10001208
987 Ga0157372_10832506
988 Ga0157372_11744064
989 Ga0157375_10973758
990 Ga0157375_12024911
991 Ga0157375_12824541
992 Ga0163163_10024286
993 Ga0163163_10094729
994 Ga0163163_10419169
995 Ga0163163_10431743
996 Ga0163163_10805733
997 Ga0163163_11409068
998 Ga0157380_10629748
999 Ga0157380_10962605
1000 Ga0157377_10016947
1001 Ga0157379_10165446
1002 Ga0157379_10432241
1003 Ga0157379_12191656
1004 Ga0157376_10103539
1005 Ga0157376_10239892
1006 Ga0157376_10717028
1007 Ga0157376_10949660
1008 Ga0157376_11598291
1009 Ga0163161_10450439
1010 Ga0213875_10072972
1011 Ga0207666_1006737
1012 Ga0207697_10081184
1013 Ga0207656_10390664
1014 Ga0207656_10455831
1015 Ga0207653_10000270
1016 Ga0207692_10036514
1017 Ga0207692_10069578
1018 Ga0207692_10451371
1019 Ga0207692_10590956
1020 Ga0207688_10348387
1021 Ga0207647_10037530
1022 Ga0207685_10392789
1023 Ga0207685_10504658
1024 Ga0207685_10615960
1025 Ga0207685_10666650
1026 Ga0207685_10707411
1027 Ga0207699_10015018
1028 Ga0207699_10143415
1029 Ga0207705_10021986
1030 Ga0207684_10000786
1031 Ga0207684_10939584
1032 Ga0207707_10012095
1033 Ga0207707_10035852
1034 Ga0207707_10049126
1035 Ga0207707_10454123
1036 Ga0207707_10615647
1037 Ga0207707_10649835
1038 Ga0207695_10049646
1039 Ga0207695_10070660
1040 Ga0207671_10123869
1041 Ga0207671_10516114
1042 Ga0207693_10314604
1043 Ga0207693_10419199
1044 Ga0207663_10219352
1045 Ga0207663_10309224
1046 Ga0207663_10346502
1047 Ga0207663_11146305
1048 Ga0207663_11283594
1049 Ga0207660_10171621
1050 Ga0207660_10692809
1051 Ga0207660_10973797
1052 Ga0207662_10260572
1053 Ga0207657_10390152
1054 Ga0207657_10414886
1055 Ga0207649_10308732
1056 Ga0207649_10507148
1057 Ga0207652_10005046
1058 Ga0207652_10182045
1059 Ga0207652_10214892
1060 Ga0207681_10008916
1061 Ga0207681_10193247
1062 Ga0207694_10002111
1063 Ga0207694_10624445
1064 Ga0207650_10707499
1065 Ga0207650_11276507
1066 Ga0207687_10278355
1067 Ga0207687_10693528
1068 Ga0207687_10727757
1069 Ga0207700_10001659
1070 Ga0207700_10002766
1071 Ga0207700_10003986
1072 Ga0207700_10082166
1073 Ga0207700_10341121
1074 Ga0207700_10549119
1075 Ga0207700_10883664
1076 Ga0207664_10004670
1077 Ga0207664_10007352
1078 Ga0207664_10219258
1079 Ga0207664_10374251
1080 Ga0207644_10287862
1081 Ga0207690_10500904
1082 Ga0207690_10829040
1083 Ga0207690_10852491
1084 Ga0207706_10043319
1085 Ga0207706_10258712
1086 Ga0207686_10078823
1087 Ga0207686_10398071
1088 Ga0207686_10746009
1089 Ga0207670_10182935
1090 Ga0207670_10185727
1091 Ga0207670_10583138
1092 Ga0207704_10205086
1093 Ga0207711_10114034
1094 Ga0207711_10611042
1095 Ga0207689_10126507
1096 Ga0207689_10747064
1097 Ga0207689_11488865
1098 Ga0207661_10028688
1099 Ga0207661_11087909
1100 Ga0207661_11148395
1101 Ga0207679_10489864
1102 Ga0207679_10937435
1103 Ga0207679_11435152
1104 Ga0207667_10000199
1105 Ga0207667_10037314
1106 Ga0207651_11269592
1107 Ga0207712_10070473
1108 Ga0207712_10249364
1109 Ga0207668_10122907
1110 Ga0207640_10311047
1111 Ga0207658_10787587
1112 Ga0207703_10072612
1113 Ga0207703_11063034
1114 Ga0207703_12228176
1115 Ga0207639_10030928
1116 Ga0207639_10038808
1117 Ga0207639_10865575
1118 Ga0207678_11021316
1119 Ga0207678_11834848
1120 Ga0207708_10235005
1121 Ga0207702_10027148
1122 Ga0207702_10246596
1123 Ga0207641_10688466
1124 Ga0207648_12287290
1125 Ga0207676_10377945
1126 Ga0207676_10656132
1127 Ga0207676_11499056
1128 Ga0207674_10039523
1129 Ga0207674_10134153
1130 Ga0207674_10390310
1131 Ga0207683_10234525
1132 Ga0207428_10003364
1133 Ga0207428_10006774
1134 Ga0207428_10022937
1135 Ga0207428_10294714
1136 Ga0268266_11028437
1137 Ga0268265_10065399
1138 Ga0268265_10155156
1139 Ga0268264_10835665
1140 Ga0268264_11415987
1141 Ga0265334_10124094
1142 Ga0265338_10005369
1143 Ga0265338_10006091
1144 Ga0265338_10050132
1145 Ga0265330_10027182
1146 Ga0265332_10016963
1147 Ga0265328_10011597
1148 Ga0265320_10108859
1149 Ga0265339_10007701
1150 Ga0265339_10059657
1151 Ga0265316_10020178
1152 Ga0265316_10428090
1153 Ga0265313_10006754
1154 Ga0265314_10000027
1155 Ga0265314_10000326
1156 Ga0265342_10051608
1157 Ga0307413_11248985
1158 Ga0307410_11994011
1159 Ga0307406_10312654
1160 Ga0307416_100804261
1161 Ga0307416_101016316
1162 Ga0307414_10868050
1163 Ga0307415_102269637
1164 Ga0373949_0092611
1165 Ga0373949_0105989
1166 Ga0373932_0044189
1167 Ga0373941_0148436
1168 Ga0373957_0114506
1169 Ga0373943_0022358
1170 Ga0373946_0472301
1171 Ga0373962_0115106
1172 Ga0373924_0104087
1173 Ga0373931_0094581
1174 Ga0373931_0132120
1175 Ga0373931_0287927
1176 Ga0373927_0005031
1177 Ga0373927_0057457
1178 Ga0373933_0079496
1179 Ga0373947_0001881
1180 Ga0373937_0000436
1181 Ga0373937_1512152
1182 Ga0373925_0206095
1183 Ga0373925_1026057
1184 Ga0373925_1253650
1185 Ga0395899_0121348
1186 Ga0395900_0042637
1187 Ga0395900_0985525
1188 Ga0395898_0017488
1189 Ga0395905_0040624
1190 Ga0395905_0391624
1191 Ga0436364_0346683
1192 Ga0436364_0486904
1193 Ga0436364_1040119
1194 Ga0395901_0009223
1195 Ga0395901_0350263
1196 Ga0436365_0151676
1197 Ga0436365_0491275
1198 Ga0436365_1100517
1199 Ga0436365_1912650
1200 Ga0436363_0641965
1201 Ga0436363_1255938
1202 Ga0451849_1378011
1203 Ga0439442_135005
1204 Ga0439443_102656
1205 Ga0439449_0318418
1206 Ga0439435_0157484
1207 Ga0439444_0133126
1208 Ga0439440_0253575
1209 Ga0453683_0537091
1210 Ga0466963_0002123
1211 Ga0466963_0314621
1212 Ga0466963_0666251
1213 Ga0466957_0232923
1214 Ga0466957_0355487
1215 Ga0466959_0326347
1216 Ga0466967_0136980
1217 Ga0466967_0277231
1218 Ga0495651_0011967
1219 Ga0495580_0001206
1220 Ga0495580_0866997
1221 Ga0495639_0069640
1222 Ga0495639_0192531
1223 Ga0495662_0088605
1224 Ga0495664_0002288
1225 Ga0495664_0486467
1226 Ga0495585_0475116
1227 Ga0495608_0330686
1228 Ga0495628_0175580
1229 Ga0495628_0310800
1230 Ga0495628_0386396
1231 Ga0495652_0608864
1232 Ga0495652_0769770
1233 Ga0495665_0387700
1234 Ga0495586_0427666
1235 Ga0495645_0079801
1236 Ga0495645_0120046
1237 Ga0495645_0850645
1238 Ga0495667_0010911
1239 Ga0495667_0485942
1240 Ga0495635_0993425
1241 Ga0495659_0152201
1242 Ga0495659_0254700
1243 Ga0495588_0330979
1244 Ga0495599_0682359
1245 Ga0495623_0510656
1246 Ga0495646_0625975
1247 Ga0495658_0111615
1248 Ga0495613_0117899
1249 Ga0495613_0320513
1250 Ga0495624_0016993
1251 Ga0495600_0124046
1252 Ga0495600_0433221
1253 Ga0495636_0585042
1254 Ga0495674_1028772
1255 Ga0495680_0186264
1256 Ga0495684_0000911
1257 Ga0495684_0213010
1258 Ga0496104_0316728
1259 Ga0496104_0657541
1260 Ga0496106_0638488
1261 Ga0496106_0653733
1262 Ga0496109_0658828
1263 Ga0496109_0977674
1264 Ga0496109_1064658
1265 Ga0496112_0014392
1266 Ga0496112_0440529
1267 Ga0496112_0455426
1268 Ga0496112_1931215
1269 Ga0496113_0857123
1270 Ga0496115_0796698
1271 Ga0496126_0017619
1272 Ga0501032_0052018
1273 Ga0501033_0037014
1274 Ga0501033_0932987
1275 Ga0501034_0008885
1276 Ga0501034_0492342
1277 Ga0501034_0520667
1278 Ga0501036_0073706
1279 Ga0501037_0124447
1280 Ga0501037_0130040
1281 Ga0501038_1252688
1282 Ga0501039_0088770
1283 Ga0501040_0707463
1284 Ga0501043_0337631
1285 Ga0501043_0920068
1286 Ga0501046_0002288
1287 Ga0501047_0103815
1288 Ga0501047_1096121
1289 Ga0501048_0011383
1290 Ga0501048_0835855
1291 Ga0501067_0242339
1292 Ga0501068_0025574
1293 Ga0501069_0197898
1294 Ga0501069_0557134
1295 Ga0501070_0722244
1296 Ga0501072_0034831
1297 Ga0501073_0007424
1298 Ga0501076_1675952
1299 Ga0501209_196798
1300 Ga0501233_181462
1301 Ga0501079_0240918
1302 Ga0501080_0020576
1303 Ga0501035_0011498
1304 Ga0501044_0027325
1305 Ga0501044_0098694
1306 Ga0501045_0800695
1307 nmdc:mga05p37_1076289_c1
1308 nmdc:mga05p37_1175_c1
1309 nmdc:mga05p37_12923_c1
1310 nmdc:mga05p37_158957_c1
1311 nmdc:mga05p37_194009_c1
1312 nmdc:mga05p37_393985_c1
1313 nmdc:mga05p37_420321_c1
1314 nmdc:mga05p37_877264_c1
1315 nmdc:mga05p37_89462_c1
1316 nmdc:mga09592_1254616_c1
1317 nmdc:mga09592_292505_c1
1318 nmdc:mga09592_64119_c1
1319 nmdc:mga0qj67_1181546_c1
1320 nmdc:mga0qj67_123955_c1
1321 nmdc:mga0qj67_277269_c1
1322 nmdc:mga0qj67_519566_c1
1323 nmdc:mga0qj67_604582_c1
1324 nmdc:mga0qj67_68359_c1
1325 nmdc:mga0qj67_96504_c1
1326 nmdc:mga06r32_110927_c1
1327 nmdc:mga06r32_1113767_c1
1328 nmdc:mga06r32_112058_c1
1329 nmdc:mga06r32_1124102_c1
1330 nmdc:mga06r32_327118_c1
1331 nmdc:mga06r32_4404_c1
1332 nmdc:mga06r32_516266_c1
1333 nmdc:mga08y16_1370896_c1
1334 nmdc:mga08y16_305471_c1
1335 nmdc:mga08y16_3730_c1
1336 nmdc:mga08y16_57936_c1
1337 nmdc:mga08y16_657636_c1
1338 nmdc:mga08y16_7482_c2
1339 nmdc:mga08y16_891852_c1
1340 nmdc:mga0n895_1258959_c1
1341 nmdc:mga0n895_1578364_c1
1342 nmdc:mga0n895_181846_c1
1343 nmdc:mga0n895_1820827_c1
1344 nmdc:mga0n895_2221668_c1
1345 nmdc:mga0n895_273899_c1
1346 nmdc:mga0rr50_1311992_c1
1347 nmdc:mga0rr50_1467233_c1
1348 nmdc:mga0rr50_1704597_c1
1349 nmdc:mga0rr50_366612_c1
1350 nmdc:mga08x19_472022_c1
1351 nmdc:mga08x19_64606_c1
1352 nmdc:mga0a205_1119762_c1
1353 nmdc:mga0a205_648725_c1
1354 nmdc:mga0a205_899601_c1
1355 Ga0495601_0095487
1356 Ga0495601_0353222
1357 Ga0495601_0531395
1358 Ga0495619_0134715
1359 Ga0501084_0010357
1360 Ga0590071_000460
1361 Ga0590074_040648
1362 Ga0590075_002447
1363 Ga0590077_006828
1364 Ga0501082_0002643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9238 11 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.915 7 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9131 6 105
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8962 6 108
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.8878 10 108
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9168 10 104 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.915 7 105 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9114 10 106 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8888 13 93 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8721 7 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A518K0B9-F1-model_v4 Lineage-specific thermal regulator protein 0.9977 10 108
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9973 10 107
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9955 10 87
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9932 16 108
AF-A0A4R1LC83-F1-model_v4 PadR family transcriptional regulator 0.9907 7 107

Map