F474887

General Info

Members Datasets Scaffolds Average Seq Length
682 221 1364 252

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100197530|Ga0070699_1001975302
Length 279
Sequence VITLEPNDERALGIGPSVSAVIFDEEGSRVVRRIHHVGIVVRDLAEAYRFYRDTLSLPLVKEALIRDQGVRAALLAAGDSEIELLAPLDASSGVGRFLAKRGEGLHHVCFDTLDIHAALAVLNAKHVELIDTAPRPGLAGAIAFLHPKACCGVLVELATPAEDAASDGSPVRLKRLVVGARDVKQTAGVFRSLFGFQEVAMNDGPRAMLAVGRGAILIVPSEEVGGTEGMVALSLVAPDFESLMAAFDRAGTKCLRGTGEVTLEPASSHGVHLHISRYE

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100197530 3300005518 Bacteria 1788
2 rootL2_10233061 3300003322 Bacteria 1444
3 Ga0065707_10142629 3300005295 Unclassified 1753
4 Ga0065707_10211884 3300005295 Bacteria 1262
5 Ga0070676_10018969 3300005328 Bacteria 3820
6 Ga0070690_100084811 3300005330 Bacteria 2077
7 Ga0070690_100279149 3300005330 Bacteria 1191
8 Ga0068869_100011026 3300005334 Bacteria 5921
9 Ga0068869_100025058 3300005334 Bacteria 4138
10 Ga0070680_100011501 3300005336 Bacteria 6850
11 Ga0070680_100015960 3300005336 Bacteria 5900
12 Ga0070680_100256400 3300005336 Bacteria 1479
13 Ga0070682_100001060 3300005337 Bacteria 15853
14 Ga0070660_100003525 3300005339 Bacteria 10787
15 Ga0070689_100060275 3300005340 Bacteria 2950
16 Ga0070691_10008817 3300005341 Bacteria 4616
17 Ga0070691_10011917 3300005341 Bacteria 3980
18 Ga0070661_100000563 3300005344 Bacteria 28211
19 Ga0070692_10000774 3300005345 Bacteria 10530
20 Ga0070692_10120157 3300005345 Bacteria 1464
21 Ga0070692_10162792 3300005345 Bacteria 1280
22 Ga0070669_100012568 3300005353 Bacteria 6005
23 Ga0070669_100043809 3300005353 Bacteria 3260
24 Ga0070669_100180805 3300005353 Unclassified 1649
25 Ga0070675_100595926 3300005354 Unclassified 1002
26 Ga0070673_100041317 3300005364 Bacteria 3546
27 Ga0070688_100286861 3300005365 Unclassified 1185
28 Ga0070659_100000266 3300005366 Bacteria 41307
29 Ga0070703_10011898 3300005406 Bacteria 2462
30 Ga0070709_10063137 3300005434 Bacteria 2364
31 Ga0070701_10000288 3300005438 Bacteria 16453
32 Ga0070711_100048525 3300005439 Bacteria 2904
33 Ga0070705_100001017 3300005440 Bacteria 15627
34 Ga0070705_100005359 3300005440 Bacteria 6247
35 Ga0070705_100069584 3300005440 Bacteria 2123
36 Ga0070705_100445883 3300005440 Unclassified 970
37 Ga0070700_100010610 3300005441 Bacteria 5087
38 Ga0070700_100105163 3300005441 Bacteria 1866
39 Ga0070700_100317062 3300005441 Unclassified 1144
40 Ga0070694_100000550 3300005444 Bacteria 20622
41 Ga0070694_100001836 3300005444 Bacteria 12571
42 Ga0070694_100003131 3300005444 Bacteria 9855
43 Ga0070694_100006027 3300005444 Bacteria 7353
44 Ga0070694_100033199 3300005444 Bacteria 3394
45 Ga0070694_100068321 3300005444 Bacteria 2442
46 Ga0070694_100187655 3300005444 Unclassified 1533
47 Ga0070694_100325194 3300005444 Unclassified 1184
48 Ga0070708_100026929 3300005445 Bacteria 4927
49 Ga0070708_100029476 3300005445 Bacteria 4733
50 Ga0070708_100036509 3300005445 Bacteria 4286
51 Ga0070708_100078512 3300005445 Bacteria 2984
52 Ga0070708_100106911 3300005445 Bacteria 2568
53 Ga0070708_100112594 3300005445 Unclassified 2503
54 Ga0070708_100115704 3300005445 Bacteria 2468
55 Ga0070708_100159909 3300005445 Bacteria 2099
56 Ga0070708_100165879 3300005445 Bacteria 2060
57 Ga0070708_100248875 3300005445 Bacteria 1669
58 Ga0070663_100001906 3300005455 Bacteria 11639
59 Ga0070662_100036863 3300005457 Bacteria 3463
60 Ga0070662_100057919 3300005457 Bacteria 2817
61 Ga0070662_100205880 3300005457 Bacteria 1563
62 Ga0070681_10021373 3300005458 Bacteria 6489
63 Ga0068867_100000208 3300005459 Bacteria 39249
64 Ga0068867_100249140 3300005459 Bacteria 1444
65 Ga0068867_100409847 3300005459 Bacteria 1145
66 Ga0070706_100004634 3300005467 Bacteria 13198
67 Ga0070706_100006597 3300005467 Bacteria 10944
68 Ga0070706_100007820 3300005467 Bacteria 9993
69 Ga0070706_100008443 3300005467 Bacteria 9593
70 Ga0070706_100010153 3300005467 Bacteria 8755
71 Ga0070706_100136314 3300005467 Bacteria 2291
72 Ga0070706_100144962 3300005467 Bacteria 2218
73 Ga0070706_100189659 3300005467 Bacteria 1921
74 Ga0070706_100282738 3300005467 Bacteria 1548
75 Ga0070706_100344499 3300005467 Bacteria 1389
76 Ga0070706_100380299 3300005467 Bacteria 1315
77 Ga0070706_100448670 3300005467 Bacteria 1200
78 Ga0070707_100000504 3300005468 Bacteria 38890
79 Ga0070707_100002322 3300005468 Bacteria 18153
80 Ga0070707_100003445 3300005468 Bacteria 14953
81 Ga0070707_100023507 3300005468 Bacteria 5830
82 Ga0070707_100079321 3300005468 Bacteria 3168
83 Ga0070707_100128859 3300005468 Bacteria 2459
84 Ga0070707_100288769 3300005468 Bacteria 1594
85 Ga0070707_100339015 3300005468 Unclassified 1461
86 Ga0070707_100471993 3300005468 Bacteria 1216
87 Ga0070698_100001595 3300005471 Bacteria 25211
88 Ga0070698_100007837 3300005471 Bacteria 11562
89 Ga0070698_100014219 3300005471 Bacteria 8414
90 Ga0070698_100099101 3300005471 Unclassified 2887
91 Ga0070698_100290378 3300005471 Unclassified 1566
92 Ga0070699_100001437 3300005518 Bacteria 21880
93 Ga0070699_100002619 3300005518 Bacteria 16066
94 Ga0070699_100006121 3300005518 Bacteria 10524
95 Ga0070699_100013654 3300005518 Bacteria 6989
96 Ga0070699_100018119 3300005518 Bacteria 6049
97 Ga0070699_100044206 3300005518 Bacteria 3857
98 Ga0070699_100368293 3300005518 Bacteria 1296
99 Ga0070679_100008328 3300005530 Bacteria 9754
100 Ga0070679_100966494 3300005530 Unclassified 795
101 Ga0070684_100018531 3300005535 Bacteria 5737
102 Ga0070697_100000765 3300005536 Bacteria 24063
103 Ga0070697_100004914 3300005536 Bacteria 10256
104 Ga0070697_100026240 3300005536 Bacteria 4652
105 Ga0070697_100072748 3300005536 Bacteria 2821
106 Ga0070697_100097602 3300005536 Bacteria 2438
107 Ga0070697_100098939 3300005536 Bacteria 2421
108 Ga0070697_100135962 3300005536 Unclassified 2064
109 Ga0070697_100372003 3300005536 Bacteria 1237
110 Ga0068853_100000713 3300005539 Bacteria 23005
111 Ga0070672_100024421 3300005543 Bacteria 4468
112 Ga0070695_100001192 3300005545 Bacteria 14296
113 Ga0070695_100004245 3300005545 Bacteria 8385
114 Ga0070695_100004943 3300005545 Bacteria 7862
115 Ga0070695_100010086 3300005545 Bacteria 5633
116 Ga0070695_100041034 3300005545 Unclassified 2932
117 Ga0070696_100002521 3300005546 Bacteria 12124
118 Ga0070696_100010055 3300005546 Bacteria 6331
119 Ga0070696_100013736 3300005546 Bacteria 5438
120 Ga0070696_100032292 3300005546 Bacteria 3592
121 Ga0070696_100082066 3300005546 Bacteria 2285
122 Ga0070696_100117845 3300005546 Bacteria 1919
123 Ga0070696_100219503 3300005546 Bacteria 1426
124 Ga0070693_100000499 3300005547 Bacteria 17559
125 Ga0070693_100169421 3300005547 Bacteria 1397
126 Ga0070704_100000272 3300005549 Bacteria 22765
127 Ga0070704_100011406 3300005549 Bacteria 5447
128 Ga0070704_100031352 3300005549 Bacteria 3575
129 Ga0070704_100043764 3300005549 Bacteria 3106
130 Ga0070704_100097011 3300005549 Bacteria 2211
131 Ga0070704_100117152 3300005549 Unclassified 2038
132 Ga0070704_100235759 3300005549 Bacteria 1495
133 Ga0068855_100000225 3300005563 Bacteria 72196
134 Ga0068857_100008633 3300005577 Bacteria 8818
135 Ga0068857_100039780 3300005577 Unclassified 4167
136 Ga0068857_100515857 3300005577 Bacteria 1123
137 Ga0068854_100021997 3300005578 Bacteria 4335
138 Ga0068854_100479354 3300005578 Bacteria 1044
139 Ga0068856_100000469 3300005614 Bacteria 44557
140 Ga0070702_100039773 3300005615 Bacteria 2626
141 Ga0070702_100123594 3300005615 Bacteria 1624
142 Ga0070702_100254150 3300005615 Bacteria 1193
143 Ga0068859_100033402 3300005617 Bacteria 5165
144 Ga0068859_100058283 3300005617 Bacteria 3890
145 Ga0068859_100071268 3300005617 Bacteria 3511
146 Ga0068859_100172231 3300005617 Bacteria 2246
147 Ga0068859_100685346 3300005617 Bacteria 1116
148 Ga0068864_100009596 3300005618 Bacteria 7981
149 Ga0068866_10048679 3300005718 Bacteria 2144
150 Ga0068861_100080915 3300005719 Bacteria 2542
151 Ga0068870_10000153 3300005840 Bacteria 24175
152 Ga0068870_10034346 3300005840 Unclassified 2595
153 Ga0068863_100178921 3300005841 Bacteria 2036
154 Ga0068863_100309246 3300005841 Unclassified 1534
155 Ga0068863_100393475 3300005841 Bacteria 1354
156 Ga0068858_100076852 3300005842 Bacteria 3101
157 Ga0068858_100310655 3300005842 Bacteria 1505
158 Ga0068860_100017302 3300005843 Bacteria 7025
159 Ga0068860_100037641 3300005843 Bacteria 4631
160 Ga0068860_100095689 3300005843 Unclassified 2831
161 Ga0068860_100211257 3300005843 Bacteria 1882
162 Ga0068860_100285827 3300005843 Bacteria 1613
163 Ga0068860_100892047 3300005843 Bacteria 905
164 Ga0068862_100000978 3300005844 Bacteria 27392
165 Ga0068862_100012707 3300005844 Bacteria 6969
166 Ga0068862_100110580 3300005844 Bacteria 2411
167 Ga0068862_100123774 3300005844 Bacteria 2282
168 Ga0081455_10000474 3300005937 Bacteria 52046
169 Ga0081538_10050016 3300005981 Bacteria 2530
170 Ga0081540_1063165 3300005983 Unclassified 1754
171 Ga0081539_10000005 3300005985 Bacteria 549026
172 Ga0075432_10024209 3300006058 Bacteria 2080
173 Ga0070715_10013562 3300006163 Bacteria 2997
174 Ga0070716_100064372 3300006173 Bacteria 2132
175 Ga0070712_100008635 3300006175 Bacteria 6415
176 Ga0070712_100093444 3300006175 Bacteria 2208
177 Ga0075428_100000199 3300006844 Bacteria 57203
178 Ga0075428_100008050 3300006844 Bacteria 11700
179 Ga0075428_100015267 3300006844 Bacteria 8517
180 Ga0075428_100040485 3300006844 Bacteria 5126
181 Ga0075428_100324065 3300006844 Bacteria 1655
182 Ga0075430_100000808 3300006846 Bacteria 24374
183 Ga0075430_100004731 3300006846 Bacteria 11450
184 Ga0075430_100017757 3300006846 Bacteria 6057
185 Ga0075430_100045436 3300006846 Bacteria 3711
186 Ga0075430_100240251 3300006846 Bacteria 1501
187 Ga0075431_100000389 3300006847 Bacteria 35220
188 Ga0075431_100001322 3300006847 Bacteria 22654
189 Ga0075431_100004537 3300006847 Bacteria 13631
190 Ga0075431_100005921 3300006847 Bacteria 12096
191 Ga0075431_100009093 3300006847 Bacteria 9961
192 Ga0075431_100076480 3300006847 Bacteria 3454
193 Ga0075431_100109568 3300006847 Bacteria 2850
194 Ga0075431_100173662 3300006847 Bacteria 2214
195 Ga0075431_100206961 3300006847 Bacteria 2006
196 Ga0075431_100362269 3300006847 Bacteria 1456
197 Ga0075433_10000015 3300006852 Bacteria 67749
198 Ga0075433_10001183 3300006852 Bacteria 18964
199 Ga0075433_10010144 3300006852 Bacteria 7553
200 Ga0075433_10042628 3300006852 Bacteria 3938
201 Ga0075433_10046215 3300006852 Bacteria 3785
202 Ga0075433_10077597 3300006852 Bacteria 2926
203 Ga0075433_10078413 3300006852 Bacteria 2910
204 Ga0075433_10086973 3300006852 Bacteria 2760
205 Ga0075433_10093503 3300006852 Unclassified 2660
206 Ga0075433_10115459 3300006852 Archaea 2382
207 Ga0075433_10139503 3300006852 Bacteria 2155
208 Ga0075433_10173644 3300006852 Bacteria 1917
209 Ga0075433_10249587 3300006852 Bacteria 1575
210 Ga0075433_10414363 3300006852 Bacteria 1188
211 Ga0075434_100002598 3300006871 Bacteria 15938
212 Ga0075434_100022060 3300006871 Bacteria 6199
213 Ga0075434_100029051 3300006871 Bacteria 5437
214 Ga0075434_100051250 3300006871 Bacteria 4101
215 Ga0075434_100086283 3300006871 Bacteria 3139
216 Ga0075434_100088426 3300006871 Bacteria 3099
217 Ga0075434_100096436 3300006871 Unclassified 2962
218 Ga0075434_100194103 3300006871 Unclassified 2051
219 Ga0075434_100446846 3300006871 Unclassified 1314
220 Ga0075434_100672606 3300006871 Bacteria 1053
221 Ga0075429_100002057 3300006880 Bacteria 16759
222 Ga0075429_100007403 3300006880 Bacteria 9527
223 Ga0075429_100008648 3300006880 Bacteria 8856
224 Ga0075429_100019677 3300006880 Bacteria 5852
225 Ga0075429_100029961 3300006880 Bacteria 4727
226 Ga0075429_100040105 3300006880 Archaea 4076
227 Ga0075429_100075280 3300006880 Bacteria 2940
228 Ga0075429_100081656 3300006880 Bacteria 2818
229 Ga0075429_100082895 3300006880 Bacteria 2795
230 Ga0075429_100401849 3300006880 Bacteria 1200
231 Ga0075429_100463999 3300006880 Bacteria 1110
232 Ga0068865_100073361 3300006881 Unclassified 2434
233 Ga0068865_100138525 3300006881 Bacteria 1832
234 Ga0068865_100172315 3300006881 Bacteria 1660
235 Ga0068865_100318590 3300006881 Bacteria 1250
236 Ga0068865_100477156 3300006881 Unclassified 1036
237 Ga0075436_100008635 3300006914 Bacteria 6965
238 Ga0075436_100037847 3300006914 Bacteria 3331
239 Ga0075436_100172964 3300006914 Unclassified 1525
240 Ga0075436_100246231 3300006914 Bacteria 1272
241 Ga0075436_100261805 3300006914 Bacteria 1233
242 Ga0097620_100033401 3300006931 Bacteria 5165
243 Ga0097620_100058283 3300006931 Bacteria 3890
244 Ga0097620_100071272 3300006931 Bacteria 3511
245 Ga0097620_100172227 3300006931 Bacteria 2246
246 Ga0097620_100685246 3300006931 Bacteria 1116
247 Ga0075435_100002115 3300007076 Bacteria 13072
248 Ga0075435_100006107 3300007076 Bacteria 8490
249 Ga0075435_100006263 3300007076 Bacteria 8399
250 Ga0075435_100006539 3300007076 Bacteria 8245
251 Ga0075435_100015206 3300007076 Bacteria 5779
252 Ga0075435_100046949 3300007076 Bacteria 3466
253 Ga0075435_100049997 3300007076 Bacteria 3363
254 Ga0099794_10023185 3300007265 Bacteria 2836
255 Ga0099794_10028440 3300007265 Bacteria 2601
256 Ga0099794_10038323 3300007265 Bacteria 2270
257 Ga0111539_10002112 3300009094 Bacteria 26570
258 Ga0111539_10003107 3300009094 Bacteria 22004
259 Ga0111539_10004519 3300009094 Bacteria 18192
260 Ga0111539_10019773 3300009094 Bacteria 8305
261 Ga0114129_10000660 3300009147 Bacteria 43218
262 Ga0114129_10003798 3300009147 Bacteria 21295
263 Ga0114129_10007433 3300009147 Bacteria 15603
264 Ga0114129_10008938 3300009147 Bacteria 14274
265 Ga0114129_10016328 3300009147 Bacteria 10569
266 Ga0114129_10027076 3300009147 Bacteria 8118
267 Ga0114129_10038422 3300009147 Bacteria 6752
268 Ga0114129_10038537 3300009147 Bacteria 6741
269 Ga0114129_10056124 3300009147 Bacteria 5518
270 Ga0114129_10058613 3300009147 Bacteria 5386
271 Ga0114129_10070097 3300009147 Unclassified 4887
272 Ga0114129_10089023 3300009147 Bacteria 4279
273 Ga0114129_10128470 3300009147 Unclassified 3483
274 Ga0114129_10162201 3300009147 Bacteria 3053
275 Ga0114129_10174485 3300009147 Bacteria 2928
276 Ga0114129_10276801 3300009147 Bacteria 2243
277 Ga0114129_10384139 3300009147 Bacteria 1854
278 Ga0114129_10706004 3300009147 Bacteria 1296
279 Ga0114129_10735955 3300009147 Bacteria 1264
280 Ga0114129_10744855 3300009147 Bacteria 1255
281 Ga0114129_10848432 3300009147 Bacteria 1161
282 Ga0105243_10007964 3300009148 Bacteria 8141
283 Ga0105243_10120782 3300009148 Bacteria 2208
284 Ga0105243_10407540 3300009148 Bacteria 1265
285 Ga0105241_10001873 3300009174 Bacteria 15938
286 Ga0105241_10043120 3300009174 Unclassified 3415
287 Ga0105242_10026742 3300009176 Bacteria 4575
288 Ga0105242_10346937 3300009176 Bacteria 1370
289 Ga0105248_10191021 3300009177 Unclassified 2307
290 Ga0105248_11101782 3300009177 Unclassified 897
291 Ga0105237_10107653 3300009545 Bacteria 2779
292 Ga0105249_10034459 3300009553 Bacteria 4588
293 Ga0105249_10156281 3300009553 Bacteria 2200
294 Ga0105249_10166076 3300009553 Unclassified 2137
295 Ga0105249_10197584 3300009553 Bacteria 1966
296 Ga0105249_10555109 3300009553 Bacteria 1200
297 Ga0157373_10000221 3300013100 Bacteria 46813
298 Ga0157369_10024557 3300013105 Bacteria 6701
299 Ga0157378_10136433 3300013297 Bacteria 2275
300 Ga0157378_10422498 3300013297 Bacteria 1318
301 Ga0163162_10052813 3300013306 Unclassified 4083
302 Ga0163162_10125735 3300013306 Bacteria 2670
303 Ga0163162_10255597 3300013306 Unclassified 1884
304 Ga0157372_10000105 3300013307 Bacteria 88007
305 Ga0157372_10147545 3300013307 Bacteria 2713
306 Ga0163163_10136403 3300014325 Bacteria 2495
307 Ga0207653_10008922 3300025885 Bacteria 3129
308 Ga0207653_10011615 3300025885 Bacteria 2747
309 Ga0207642_10137711 3300025899 Bacteria 1282
310 Ga0207647_10112376 3300025904 Bacteria 1610
311 Ga0207685_10020618 3300025905 Bacteria 2195
312 Ga0207645_10001757 3300025907 Bacteria 17579
313 Ga0207643_10000036 3300025908 Bacteria 89740
314 Ga0207643_10033068 3300025908 Unclassified 2893
315 Ga0207684_10000115 3300025910 Bacteria 149762
316 Ga0207684_10000332 3300025910 Bacteria 65844
317 Ga0207684_10005374 3300025910 Bacteria 11831
318 Ga0207684_10007166 3300025910 Bacteria 10078
319 Ga0207684_10025225 3300025910 Bacteria 5067
320 Ga0207684_10026853 3300025910 Bacteria 4910
321 Ga0207684_10111603 3300025910 Bacteria 2340
322 Ga0207684_10133271 3300025910 Bacteria 2133
323 Ga0207684_10395538 3300025910 Unclassified 1188
324 Ga0207654_10001800 3300025911 Bacteria 11135
325 Ga0207654_10036663 3300025911 Unclassified 2741
326 Ga0207707_10000156 3300025912 Bacteria 71453
327 Ga0207671_10018617 3300025914 Bacteria 5321
328 Ga0207693_10017750 3300025915 Bacteria 5674
329 Ga0207693_10178973 3300025915 Bacteria 1668
330 Ga0207660_10004647 3300025917 Bacteria 8948
331 Ga0207660_10011792 3300025917 Bacteria 5697
332 Ga0207660_10223369 3300025917 Bacteria 1479
333 Ga0207660_10256409 3300025917 Bacteria 1382
334 Ga0207662_10026860 3300025918 Bacteria 3322
335 Ga0207662_10109956 3300025918 Bacteria 1717
336 Ga0207657_10000179 3300025919 Bacteria 65724
337 Ga0207649_10000839 3300025920 Bacteria 19720
338 Ga0207652_10000832 3300025921 Bacteria 29400
339 Ga0207646_10000275 3300025922 Bacteria 70273
340 Ga0207646_10000773 3300025922 Bacteria 41411
341 Ga0207646_10005664 3300025922 Bacteria 13103
342 Ga0207646_10048270 3300025922 Unclassified 3816
343 Ga0207646_10078341 3300025922 Bacteria 2954
344 Ga0207646_10173645 3300025922 Bacteria 1946
345 Ga0207646_10227211 3300025922 Unclassified 1686
346 Ga0207646_10306611 3300025922 Bacteria 1434
347 Ga0207646_10368017 3300025922 Bacteria 1299
348 Ga0207646_10408239 3300025922 Bacteria 1226
349 Ga0207681_10009674 3300025923 Bacteria 5898
350 Ga0207681_10057929 3300025923 Bacteria 2650
351 Ga0207681_10135307 3300025923 Unclassified 1828
352 Ga0207681_10234049 3300025923 Unclassified 1427
353 Ga0207681_10491180 3300025923 Bacteria 1004
354 Ga0207650_10014969 3300025925 Bacteria 5395
355 Ga0207690_10007488 3300025932 Bacteria 6481
356 Ga0207706_10002289 3300025933 Bacteria 18670
357 Ga0207706_10037198 3300025933 Unclassified 4323
358 Ga0207706_10080433 3300025933 Bacteria 2865
359 Ga0207686_10013653 3300025934 Bacteria 4499
360 Ga0207709_10016964 3300025935 Bacteria 4058
361 Ga0207670_10650620 3300025936 Bacteria 869
362 Ga0207704_10173183 3300025938 Bacteria 1551
363 Ga0207704_10194884 3300025938 Bacteria 1477
364 Ga0207665_10001888 3300025939 Bacteria 14117
365 Ga0207691_10049706 3300025940 Bacteria 3842
366 Ga0207711_10092166 3300025941 Unclassified 2666
367 Ga0207689_10001824 3300025942 Bacteria 20131
368 Ga0207689_10019449 3300025942 Bacteria 5724
369 Ga0207689_10023048 3300025942 Bacteria 5229
370 Ga0207679_10000578 3300025945 Bacteria 24450
371 Ga0207667_10001215 3300025949 Bacteria 32242
372 Ga0207712_10007462 3300025961 Bacteria 6906
373 Ga0207712_10066978 3300025961 Bacteria 2568
374 Ga0207640_10009235 3300025981 Bacteria 5514
375 Ga0207640_10453938 3300025981 Bacteria 1057
376 Ga0207658_10261657 3300025986 Bacteria 1475
377 Ga0207703_10323519 3300026035 Bacteria 1413
378 Ga0207639_10026312 3300026041 Bacteria 4227
379 Ga0207678_10022175 3300026067 Bacteria 5565
380 Ga0207708_10022397 3300026075 Bacteria 4771
381 Ga0207708_10176685 3300026075 Bacteria 1694
382 Ga0207708_10214588 3300026075 Unclassified 1539
383 Ga0207708_10383865 3300026075 Bacteria 1159
384 Ga0207702_10000898 3300026078 Bacteria 30914
385 Ga0207641_10018116 3300026088 Bacteria 5771
386 Ga0207641_10113240 3300026088 Bacteria 2409
387 Ga0207641_10146340 3300026088 Unclassified 2137
388 Ga0207648_10015388 3300026089 Bacteria 7039
389 Ga0207648_10121675 3300026089 Bacteria 2295
390 Ga0207648_10149272 3300026089 Bacteria 2062
391 Ga0207676_10039961 3300026095 Bacteria 3592
392 Ga0207676_10117620 3300026095 Bacteria 2236
393 Ga0207674_10001134 3300026116 Bacteria 34565
394 Ga0207674_10133362 3300026116 Unclassified 2446
395 Ga0207674_10164082 3300026116 Unclassified 2176
396 Ga0207675_100108908 3300026118 Unclassified 2613
397 Ga0207675_100392688 3300026118 Unclassified 1366
398 Ga0209973_1022102 3300027252 Bacteria 852
399 Ga0209967_1005752 3300027364 Bacteria 1674
400 Ga0209996_1000901 3300027395 Bacteria 3503
401 Ga0209995_1000762 3300027471 Bacteria 4948
402 Ga0209968_1003608 3300027526 Bacteria 2323
403 Ga0209999_1000742 3300027543 Bacteria 5318
404 Ga0209982_1003312 3300027552 Bacteria 2284
405 Ga0209970_1001347 3300027614 Bacteria 4293
406 Ga0209983_1000605 3300027665 Bacteria 7707
407 Ga0209983_1009000 3300027665 Bacteria 2040
408 Ga0209588_1010149 3300027671 Bacteria 2826
409 Ga0209971_1000290 3300027682 Bacteria 14010
410 Ga0209966_1000264 3300027695 Bacteria 18848
411 Ga0209998_10000001 3300027717 Bacteria 203589
412 Ga0209974_10003797 3300027876 Bacteria 5412
413 Ga0207428_10000036 3300027907 Bacteria 223539
414 Ga0207428_10000533 3300027907 Bacteria 45350
415 Ga0207428_10009658 3300027907 Bacteria 8644
416 Ga0207428_10068941 3300027907 Bacteria 2781
417 Ga0268265_10004196 3300028380 Bacteria 10082
418 Ga0268265_10017731 3300028380 Bacteria 4921
419 Ga0268265_10040124 3300028380 Bacteria 3455
420 Ga0268265_10076367 3300028380 Bacteria 2628
421 Ga0268264_10016517 3300028381 Bacteria 6043
422 Ga0268264_10047002 3300028381 Bacteria 3587
423 Ga0268264_10316442 3300028381 Unclassified 1474
424 Ga0268264_10327399 3300028381 Bacteria 1451
425 Ga0307408_100011328 3300031548 Bacteria 5893
426 Ga0307408_100087599 3300031548 Bacteria 2343
427 Ga0307408_100217210 3300031548 Unclassified 1558
428 Ga0307408_100635935 3300031548 Bacteria 952
429 Ga0307413_10361458 3300031824 Bacteria 1124
430 Ga0307410_10766271 3300031852 Bacteria 818
431 Ga0307406_10433709 3300031901 Bacteria 1050
432 Ga0307416_100208739 3300032002 Bacteria 1861
433 Ga0307416_100230509 3300032002 Bacteria 1785
434 Ga0307416_100572569 3300032002 Unclassified 1205
435 Ga0307411_10134153 3300032005 Bacteria 1814
436 Ga0307415_100506366 3300032126 Bacteria 1057
437 Ga0307415_100576654 3300032126 Bacteria 997
438 Ga0373948_0001659 3300034817 Bacteria 3146
439 Ga0373940_0004203 3300035088 Bacteria 3025
440 Ga0373940_0094229 3300035088 Bacteria 901
441 Ga0373951_0013367 3300035091 Bacteria 1846
442 Ga0373932_0056122 3300035112 Bacteria 1183
443 Ga0373932_0087358 3300035112 Unclassified 995
444 Ga0373939_0060650 3300035114 Unclassified 1203
445 Ga0373941_0004852 3300035115 Bacteria 3134
446 Ga0373960_0022878 3300035121 Bacteria 1679
447 Ga0373960_0044701 3300035121 Bacteria 1294
448 Ga0373961_0011183 3300035241 Bacteria 2225
449 Ga0373931_0022521 3300035691 Bacteria 3172
450 Ga0373931_0029971 3300035691 Bacteria 2798
451 Ga0395900_0003774 3300037418 Bacteria 16231
452 Ga0395898_0004916 3300037466 Bacteria 14507
453 Ga0395898_0432032 3300037466 Unclassified 1255
454 Ga0395901_0007481 3300038443 Bacteria 11029
455 Ga0439448_0039894 3300042005 Bacteria 1515
456 Ga0439455_0026888 3300042012 Unclassified 1407
457 Ga0439463_042114 3300042016 Bacteria 1161
458 Ga0439458_0003858 3300042157 Bacteria 3467
459 Ga0439459_0000409 3300042438 Bacteria 5438
460 Ga0439464_0012711 3300042439 Bacteria 2245
461 Ga0439460_0011881 3300042461 Bacteria 2250
462 Ga0451577_0001922 3300042876 Bacteria 26280
463 Ga0451577_0018859 3300042876 Bacteria 6350
464 Ga0451577_0042096 3300042876 Bacteria 4097
465 Ga0451577_0056126 3300042876 Bacteria 3512
466 Ga0451577_0134841 3300042876 Bacteria 2217
467 Ga0451577_0136119 3300042876 Bacteria 2206
468 Ga0451577_0215450 3300042876 Unclassified 1735
469 Ga0453683_0006686 3300044673 Bacteria 7888
470 Ga0453683_0040499 3300044673 Bacteria 2925
471 Ga0453683_0151574 3300044673 Bacteria 1465
472 Ga0453684_0033539 3300044712 Bacteria 7155
473 Ga0453684_0109526 3300044712 Bacteria 3359
474 Ga0453684_0466706 3300044712 Bacteria 1403
475 Ga0451576_0019373 3300045051 Bacteria 7427
476 Ga0451576_0043637 3300045051 Bacteria 4730
477 Ga0451576_0070107 3300045051 Bacteria 3648
478 Ga0451576_0072425 3300045051 Bacteria 3586
479 Ga0451576_0084351 3300045051 Bacteria 3304
480 Ga0451576_0086241 3300045051 Bacteria 3265
481 Ga0451576_0118900 3300045051 Bacteria 2751
482 Ga0495580_0001620 3300046472 Bacteria 19779
483 Ga0495580_0051216 3300046472 Bacteria 2919
484 Ga0495594_0031142 3300046499 Unclassified 2891
485 Ga0495598_0087178 3300046537 Bacteria 1011
486 Ga0495669_0025877 3300046684 Unclassified 2562
487 Ga0495669_0048999 3300046684 Unclassified 1890
488 Ga0495669_0094408 3300046684 Bacteria 1384
489 Ga0496102_0014574 3300048905 Bacteria 6833
490 Ga0496103_0472646 3300048906 Unclassified 803
491 Ga0496106_0216658 3300048909 Unclassified 1526
492 Ga0496113_0121122 3300048916 Bacteria 2046
493 Ga0501031_0278649 3300049568 Unclassified 1085
494 Ga0501033_0069673 3300049570 Archaea 2585
495 Ga0501033_0097209 3300049570 Bacteria 2152
496 Ga0501038_0120899 3300049574 Bacteria 2160
497 Ga0501038_0128842 3300049574 Bacteria 2080
498 Ga0501039_0014592 3300049575 Bacteria 6016
499 Ga0501039_0027305 3300049575 Bacteria 4390
500 Ga0501039_0044057 3300049575 Bacteria 3446
501 Ga0501039_0081036 3300049575 Bacteria 2527
502 Ga0501039_0199396 3300049575 Bacteria 1574
503 Ga0501040_0016801 3300049576 Bacteria 4852
504 Ga0501040_0021264 3300049576 Bacteria 4331
505 Ga0501040_0024766 3300049576 Bacteria 4030
506 Ga0501040_0038092 3300049576 Archaea 3268
507 Ga0501040_0087022 3300049576 Archaea 2169
508 Ga0501040_0113752 3300049576 Bacteria 1894
509 Ga0501040_0221475 3300049576 Bacteria 1346
510 Ga0501040_0303527 3300049576 Bacteria 1141
511 Ga0501041_0000354 3300049577 Bacteria 22685
512 Ga0501041_0021066 3300049577 Bacteria 3905
513 Ga0501041_0037136 3300049577 Bacteria 2951
514 Ga0501041_0039471 3300049577 Bacteria 2865
515 Ga0501041_0206745 3300049577 Bacteria 1231
516 Ga0501042_0003376 3300049578 Bacteria 10014
517 Ga0501042_0020695 3300049578 Bacteria 4580
518 Ga0501042_0110724 3300049578 Bacteria 1977
519 Ga0501042_0288248 3300049578 Bacteria 1186
520 Ga0501046_0000249 3300049580 Bacteria 55198
521 Ga0501046_0043892 3300049580 Bacteria 3557
522 Ga0501046_0058700 3300049580 Bacteria 3016
523 Ga0501048_0247737 3300049582 Bacteria 1264
524 Ga0501068_0083916 3300049584 Bacteria 1959
525 Ga0501068_0112429 3300049584 Bacteria 1694
526 Ga0501069_0032462 3300049585 Bacteria 2874
527 Ga0501071_0061629 3300049587 Bacteria 2717
528 Ga0501071_0070846 3300049587 Bacteria 2541
529 Ga0501071_0219140 3300049587 Bacteria 1432
530 Ga0501072_0006053 3300049588 Bacteria 9231
531 Ga0501072_0029876 3300049588 Bacteria 4259
532 Ga0501072_0395336 3300049588 Bacteria 1096
533 Ga0501072_0401042 3300049588 Bacteria 1088
534 Ga0501074_0002488 3300049590 Bacteria 12851
535 Ga0501074_0095301 3300049590 Bacteria 2131
536 Ga0501075_0009238 3300049591 Bacteria 6894
537 Ga0501075_0021428 3300049591 Bacteria 4712
538 Ga0501075_0128456 3300049591 Bacteria 1930
539 Ga0501075_0132709 3300049591 Bacteria 1897
540 Ga0501075_0195576 3300049591 Unclassified 1542
541 Ga0501076_0005939 3300049592 Bacteria 8815
542 Ga0501076_0006056 3300049592 Bacteria 8749
543 Ga0501076_0011568 3300049592 Bacteria 6580
544 Ga0501076_0011993 3300049592 Bacteria 6475
545 Ga0501076_0215999 3300049592 Unclassified 1567
546 Ga0501076_0587401 3300049592 Bacteria 919
547 Ga0501077_0011000 3300049593 Bacteria 5640
548 Ga0501077_0030144 3300049593 Bacteria 3451
549 Ga0501077_0058659 3300049593 Bacteria 2443
550 Ga0501079_0001033 3300049741 Bacteria 19305
551 Ga0501079_0011982 3300049741 Bacteria 6618
552 Ga0501079_0070735 3300049741 Bacteria 2695
553 Ga0501080_0065763 3300049742 Bacteria 3372
554 Ga0501080_0153099 3300049742 Unclassified 2131
555 Ga0501080_0200810 3300049742 Bacteria 1831
556 Ga0501080_0249181 3300049742 Unclassified 1620
557 Ga0501080_0366757 3300049742 Bacteria 1299
558 Ga0501080_0388149 3300049742 Bacteria 1257
559 Ga0501080_0519790 3300049742 Unclassified 1062
560 Ga0501081_0000301 3300049743 Bacteria 26437
561 Ga0501081_0001191 3300049743 Bacteria 15749
562 Ga0501081_0013979 3300049743 Bacteria 5286
563 Ga0501081_0023294 3300049743 Bacteria 4149
564 Ga0501081_0079850 3300049743 Bacteria 2288
565 Ga0501081_0363730 3300049743 Unclassified 1067
566 Ga0501081_0518813 3300049743 Bacteria 889
567 Ga0501045_0002887 3300049824 Bacteria 11737
568 Ga0501045_0030264 3300049824 Bacteria 3917
569 Ga0501045_0080780 3300049824 Bacteria 2397
570 nmdc:mga05p37_117223_c1 3300050507 Bacteria 3273
571 nmdc:mga05p37_13192_c2 3300050507 Bacteria 6142
572 nmdc:mga05p37_175186_c1 3300050507 Unclassified 2204
573 nmdc:mga05p37_175501_c1 3300050507 Bacteria 2611
574 nmdc:mga05p37_20828_c1 3300050507 Bacteria 7937
575 nmdc:mga05p37_2106_c1 3300050507 Bacteria 23246
576 nmdc:mga05p37_21837_c1 3300050507 Bacteria 7754
577 nmdc:mga05p37_26111_c1 3300050507 Bacteria 7102
578 nmdc:mga05p37_342668_c1 3300050507 Bacteria 1762
579 nmdc:mga05p37_385645_c1 3300050507 Bacteria 1640
580 nmdc:mga05p37_38664_c1 3300050507 Bacteria 5855
581 nmdc:mga05p37_40340_c1 3300050507 Bacteria 5732
582 nmdc:mga05p37_474894_c1 3300050507 Unclassified 1442
583 nmdc:mga05p37_48099_c1 3300050507 Bacteria 5246
584 nmdc:mga05p37_61742_c1 3300050507 Bacteria 4613
585 nmdc:mga05p37_712742_c1 3300050507 Unclassified 1113
586 nmdc:mga05p37_762114_c1 3300050507 Bacteria 1065
587 nmdc:mga05p37_7662_c1 3300050507 Bacteria 12740
588 nmdc:mga05p37_84575_c1 3300050507 Bacteria 3908
589 nmdc:mga09592_12998_c1 3300050508 Bacteria 6795
590 nmdc:mga09592_2723_c1 3300050508 Bacteria 14287
591 nmdc:mga09592_294690_c1 3300050508 Bacteria 1406
592 nmdc:mga09592_378711_c1 3300050508 Unclassified 1224
593 nmdc:mga09592_54459_c1 3300050508 Bacteria 3380
594 nmdc:mga09592_659778_c1 3300050508 Bacteria 893
595 nmdc:mga09592_68347_c2 3300050508 Bacteria 2453
596 nmdc:mga09592_7353_c1 3300050508 Bacteria 8953
597 nmdc:mga09592_82748_c1 3300050508 Bacteria 2735
598 nmdc:mga09592_8652_c1 3300050508 Bacteria 8282
599 nmdc:mga0qj67_19273_c1 3300050509 Bacteria 5211
600 nmdc:mga0qj67_522625_c1 3300050509 Bacteria 953
601 nmdc:mga0qj67_8550_c1 3300050509 Bacteria 7597
602 nmdc:mga06r32_103301_c1 3300050510 Bacteria 2798
603 nmdc:mga06r32_14198_c1 3300050510 Bacteria 7225
604 nmdc:mga06r32_146504_c1 3300050510 Bacteria 2338
605 nmdc:mga06r32_149290_c1 3300050510 Bacteria 2315
606 nmdc:mga06r32_18978_c1 3300050510 Bacteria 6305
607 nmdc:mga06r32_2357_c1 3300050510 Bacteria 16928
608 nmdc:mga06r32_3011_c1 3300050510 Bacteria 15093
609 nmdc:mga06r32_3259_c1 3300050510 Bacteria 14524
610 nmdc:mga06r32_41265_c1 3300050510 Bacteria 4384
611 nmdc:mga06r32_5474_c1 3300050510 Bacteria 11433
612 nmdc:mga06r32_60750_c1 3300050510 Bacteria 3637
613 nmdc:mga06r32_6131_c1 3300050510 Archaea 10795
614 nmdc:mga06r32_66940_c1 3300050510 Bacteria 3467
615 nmdc:mga06r32_68909_c1 3300050510 Bacteria 3418
616 nmdc:mga06r32_83824_c1 3300050510 Bacteria 3106
617 nmdc:mga08y16_10505_c1 3300050511 Bacteria 9713
618 nmdc:mga08y16_3281_c1 3300050511 Bacteria 16768
619 nmdc:mga08y16_34470_c1 3300050511 Bacteria 5317
620 nmdc:mga08y16_3977_c1 3300050511 Bacteria 15409
621 nmdc:mga0n895_158327_c1 3300050512 Bacteria 2296
622 nmdc:mga0n895_212849_c1 3300050512 Unclassified 1963
623 nmdc:mga0n895_241104_c1 3300050512 Bacteria 1835
624 nmdc:mga0n895_247289_c1 3300050512 Bacteria 1810
625 nmdc:mga0n895_494655_c1 3300050512 Bacteria 1232
626 nmdc:mga0n895_623814_c1 3300050512 Bacteria 1079
627 nmdc:mga0n895_628908_c1 3300050512 Bacteria 1074
628 nmdc:mga0n895_7703_c1 3300050512 Bacteria 9267
629 nmdc:mga0n895_8177_c1 3300050512 Bacteria 9043
630 nmdc:mga0n895_89585_c1 3300050512 Bacteria 3078
631 nmdc:mga0rr50_136280_c1 3300050513 Unclassified 1971
632 nmdc:mga0rr50_152283_c1 3300050513 Unclassified 1870
633 nmdc:mga0rr50_15739_c1 3300050513 Bacteria 5001
634 nmdc:mga0rr50_16448_c1 3300050513 Archaea 4915
635 nmdc:mga0rr50_1935_c1 3300050513 Bacteria 11507
636 nmdc:mga0rr50_297594_c1 3300050513 Bacteria 1349
637 nmdc:mga0rr50_347530_c1 3300050513 Unclassified 1247
638 nmdc:mga0rr50_358344_c1 3300050513 Bacteria 1227
639 nmdc:mga0rr50_58240_c1 3300050513 Bacteria 2895
640 nmdc:mga0rr50_58802_c1 3300050513 Archaea 2883
641 nmdc:mga0rr50_72111_c1 3300050513 Bacteria 2637
642 nmdc:mga08x19_149_c1 3300050514 Bacteria 58402
643 nmdc:mga08x19_240903_c1 3300050514 Bacteria 1247
644 nmdc:mga08x19_276727_c1 3300050514 Unclassified 1162
645 nmdc:mga08x19_50563_c1 3300050514 Unclassified 2667
646 nmdc:mga08x19_68622_c1 3300050514 Bacteria 2307
647 nmdc:mga08x19_8238_c1 3300050514 Bacteria 6197
648 nmdc:mga0a205_12084_c1 3300050515 Bacteria 7978
649 nmdc:mga0a205_13007_c1 3300050515 Bacteria 7725
650 nmdc:mga0a205_1862_c1 3300050515 Bacteria 18264
651 nmdc:mga0a205_2414_c1 3300050515 Bacteria 16482
652 nmdc:mga0a205_292822_c1 3300050515 Bacteria 1502
653 nmdc:mga0a205_406061_c1 3300050515 Bacteria 1226
654 nmdc:mga0a205_45783_c1 3300050515 Bacteria 4219
655 nmdc:mga0a205_57686_c2 3300050515 Bacteria 3002
656 nmdc:mga0a205_5960_c1 3300050515 Bacteria 10982
657 nmdc:mga0a205_61579_c1 3300050515 Unclassified 3625
658 nmdc:mga0a205_6174_c1 3300050515 Bacteria 7642
659 nmdc:mga0a205_71889_c1 3300050515 Bacteria 3001
660 nmdc:mga0a205_80591_c1 3300050515 Archaea 3145
661 nmdc:mga0a205_85916_c1 3300050515 Bacteria 3038
662 nmdc:mga0a205_91444_c1 3300050515 Bacteria 2940
663 Ga0501084_0002088 3300054114 Bacteria 15952
664 Ga0501084_0004838 3300054114 Bacteria 11007
665 Ga0501084_0021595 3300054114 Bacteria 5367
666 Ga0501084_0064790 3300054114 Bacteria 3057
667 Ga0501084_0160474 3300054114 Unclassified 1897
668 Ga0501084_0408303 3300054114 Bacteria 1148
669 Ga0501082_0000881 3300060353 Bacteria 26526
670 Ga0501082_0002230 3300060353 Bacteria 16946
671 Ga0501082_0042973 3300060353 Bacteria 3895
672 Ga0501082_0064941 3300060353 Bacteria 3143
673 Ga0501082_0088159 3300060353 Bacteria 2677
674 Ga0501082_0137235 3300060353 Bacteria 2122
675 Ga0530510_0019188 3300061734 Bacteria 4851
676 Ga0530510_0042737 3300061734 Bacteria 3274
677 Ga0530510_0060568 3300061734 Bacteria 2739
678 Ga0530510_0066452 3300061734 Bacteria 2614
679 Ga0530510_0112235 3300061734 Bacteria 1997
680 Ga0530510_0308753 3300061734 Bacteria 1184
681 Ga0530510_0349196 3300061734 Bacteria 1111
682 Ga0530510_0546833 3300061734 Bacteria 879
683 Ga0070699_100197530
684 rootL2_10233061
685 Ga0065707_10142629
686 Ga0065707_10211884
687 Ga0070676_10018969
688 Ga0070690_100084811
689 Ga0070690_100279149
690 Ga0068869_100011026
691 Ga0068869_100025058
692 Ga0070680_100011501
693 Ga0070680_100015960
694 Ga0070680_100256400
695 Ga0070682_100001060
696 Ga0070660_100003525
697 Ga0070689_100060275
698 Ga0070691_10008817
699 Ga0070691_10011917
700 Ga0070661_100000563
701 Ga0070692_10000774
702 Ga0070692_10120157
703 Ga0070692_10162792
704 Ga0070669_100012568
705 Ga0070669_100043809
706 Ga0070669_100180805
707 Ga0070675_100595926
708 Ga0070673_100041317
709 Ga0070688_100286861
710 Ga0070659_100000266
711 Ga0070703_10011898
712 Ga0070709_10063137
713 Ga0070701_10000288
714 Ga0070711_100048525
715 Ga0070705_100001017
716 Ga0070705_100005359
717 Ga0070705_100069584
718 Ga0070705_100445883
719 Ga0070700_100010610
720 Ga0070700_100105163
721 Ga0070700_100317062
722 Ga0070694_100000550
723 Ga0070694_100001836
724 Ga0070694_100003131
725 Ga0070694_100006027
726 Ga0070694_100033199
727 Ga0070694_100068321
728 Ga0070694_100187655
729 Ga0070694_100325194
730 Ga0070708_100026929
731 Ga0070708_100029476
732 Ga0070708_100036509
733 Ga0070708_100078512
734 Ga0070708_100106911
735 Ga0070708_100112594
736 Ga0070708_100115704
737 Ga0070708_100159909
738 Ga0070708_100165879
739 Ga0070708_100248875
740 Ga0070663_100001906
741 Ga0070662_100036863
742 Ga0070662_100057919
743 Ga0070662_100205880
744 Ga0070681_10021373
745 Ga0068867_100000208
746 Ga0068867_100249140
747 Ga0068867_100409847
748 Ga0070706_100004634
749 Ga0070706_100006597
750 Ga0070706_100007820
751 Ga0070706_100008443
752 Ga0070706_100010153
753 Ga0070706_100136314
754 Ga0070706_100144962
755 Ga0070706_100189659
756 Ga0070706_100282738
757 Ga0070706_100344499
758 Ga0070706_100380299
759 Ga0070706_100448670
760 Ga0070707_100000504
761 Ga0070707_100002322
762 Ga0070707_100003445
763 Ga0070707_100023507
764 Ga0070707_100079321
765 Ga0070707_100128859
766 Ga0070707_100288769
767 Ga0070707_100339015
768 Ga0070707_100471993
769 Ga0070698_100001595
770 Ga0070698_100007837
771 Ga0070698_100014219
772 Ga0070698_100099101
773 Ga0070698_100290378
774 Ga0070699_100001437
775 Ga0070699_100002619
776 Ga0070699_100006121
777 Ga0070699_100013654
778 Ga0070699_100018119
779 Ga0070699_100044206
780 Ga0070699_100368293
781 Ga0070679_100008328
782 Ga0070679_100966494
783 Ga0070684_100018531
784 Ga0070697_100000765
785 Ga0070697_100004914
786 Ga0070697_100026240
787 Ga0070697_100072748
788 Ga0070697_100097602
789 Ga0070697_100098939
790 Ga0070697_100135962
791 Ga0070697_100372003
792 Ga0068853_100000713
793 Ga0070672_100024421
794 Ga0070695_100001192
795 Ga0070695_100004245
796 Ga0070695_100004943
797 Ga0070695_100010086
798 Ga0070695_100041034
799 Ga0070696_100002521
800 Ga0070696_100010055
801 Ga0070696_100013736
802 Ga0070696_100032292
803 Ga0070696_100082066
804 Ga0070696_100117845
805 Ga0070696_100219503
806 Ga0070693_100000499
807 Ga0070693_100169421
808 Ga0070704_100000272
809 Ga0070704_100011406
810 Ga0070704_100031352
811 Ga0070704_100043764
812 Ga0070704_100097011
813 Ga0070704_100117152
814 Ga0070704_100235759
815 Ga0068855_100000225
816 Ga0068857_100008633
817 Ga0068857_100039780
818 Ga0068857_100515857
819 Ga0068854_100021997
820 Ga0068854_100479354
821 Ga0068856_100000469
822 Ga0070702_100039773
823 Ga0070702_100123594
824 Ga0070702_100254150
825 Ga0068859_100033402
826 Ga0068859_100058283
827 Ga0068859_100071268
828 Ga0068859_100172231
829 Ga0068859_100685346
830 Ga0068864_100009596
831 Ga0068866_10048679
832 Ga0068861_100080915
833 Ga0068870_10000153
834 Ga0068870_10034346
835 Ga0068863_100178921
836 Ga0068863_100309246
837 Ga0068863_100393475
838 Ga0068858_100076852
839 Ga0068858_100310655
840 Ga0068860_100017302
841 Ga0068860_100037641
842 Ga0068860_100095689
843 Ga0068860_100211257
844 Ga0068860_100285827
845 Ga0068860_100892047
846 Ga0068862_100000978
847 Ga0068862_100012707
848 Ga0068862_100110580
849 Ga0068862_100123774
850 Ga0081455_10000474
851 Ga0081538_10050016
852 Ga0081540_1063165
853 Ga0081539_10000005
854 Ga0075432_10024209
855 Ga0070715_10013562
856 Ga0070716_100064372
857 Ga0070712_100008635
858 Ga0070712_100093444
859 Ga0075428_100000199
860 Ga0075428_100008050
861 Ga0075428_100015267
862 Ga0075428_100040485
863 Ga0075428_100324065
864 Ga0075430_100000808
865 Ga0075430_100004731
866 Ga0075430_100017757
867 Ga0075430_100045436
868 Ga0075430_100240251
869 Ga0075431_100000389
870 Ga0075431_100001322
871 Ga0075431_100004537
872 Ga0075431_100005921
873 Ga0075431_100009093
874 Ga0075431_100076480
875 Ga0075431_100109568
876 Ga0075431_100173662
877 Ga0075431_100206961
878 Ga0075431_100362269
879 Ga0075433_10000015
880 Ga0075433_10001183
881 Ga0075433_10010144
882 Ga0075433_10042628
883 Ga0075433_10046215
884 Ga0075433_10077597
885 Ga0075433_10078413
886 Ga0075433_10086973
887 Ga0075433_10093503
888 Ga0075433_10115459
889 Ga0075433_10139503
890 Ga0075433_10173644
891 Ga0075433_10249587
892 Ga0075433_10414363
893 Ga0075434_100002598
894 Ga0075434_100022060
895 Ga0075434_100029051
896 Ga0075434_100051250
897 Ga0075434_100086283
898 Ga0075434_100088426
899 Ga0075434_100096436
900 Ga0075434_100194103
901 Ga0075434_100446846
902 Ga0075434_100672606
903 Ga0075429_100002057
904 Ga0075429_100007403
905 Ga0075429_100008648
906 Ga0075429_100019677
907 Ga0075429_100029961
908 Ga0075429_100040105
909 Ga0075429_100075280
910 Ga0075429_100081656
911 Ga0075429_100082895
912 Ga0075429_100401849
913 Ga0075429_100463999
914 Ga0068865_100073361
915 Ga0068865_100138525
916 Ga0068865_100172315
917 Ga0068865_100318590
918 Ga0068865_100477156
919 Ga0075436_100008635
920 Ga0075436_100037847
921 Ga0075436_100172964
922 Ga0075436_100246231
923 Ga0075436_100261805
924 Ga0097620_100033401
925 Ga0097620_100058283
926 Ga0097620_100071272
927 Ga0097620_100172227
928 Ga0097620_100685246
929 Ga0075435_100002115
930 Ga0075435_100006107
931 Ga0075435_100006263
932 Ga0075435_100006539
933 Ga0075435_100015206
934 Ga0075435_100046949
935 Ga0075435_100049997
936 Ga0099794_10023185
937 Ga0099794_10028440
938 Ga0099794_10038323
939 Ga0111539_10002112
940 Ga0111539_10003107
941 Ga0111539_10004519
942 Ga0111539_10019773
943 Ga0114129_10000660
944 Ga0114129_10003798
945 Ga0114129_10007433
946 Ga0114129_10008938
947 Ga0114129_10016328
948 Ga0114129_10027076
949 Ga0114129_10038422
950 Ga0114129_10038537
951 Ga0114129_10056124
952 Ga0114129_10058613
953 Ga0114129_10070097
954 Ga0114129_10089023
955 Ga0114129_10128470
956 Ga0114129_10162201
957 Ga0114129_10174485
958 Ga0114129_10276801
959 Ga0114129_10384139
960 Ga0114129_10706004
961 Ga0114129_10735955
962 Ga0114129_10744855
963 Ga0114129_10848432
964 Ga0105243_10007964
965 Ga0105243_10120782
966 Ga0105243_10407540
967 Ga0105241_10001873
968 Ga0105241_10043120
969 Ga0105242_10026742
970 Ga0105242_10346937
971 Ga0105248_10191021
972 Ga0105248_11101782
973 Ga0105237_10107653
974 Ga0105249_10034459
975 Ga0105249_10156281
976 Ga0105249_10166076
977 Ga0105249_10197584
978 Ga0105249_10555109
979 Ga0157373_10000221
980 Ga0157369_10024557
981 Ga0157378_10136433
982 Ga0157378_10422498
983 Ga0163162_10052813
984 Ga0163162_10125735
985 Ga0163162_10255597
986 Ga0157372_10000105
987 Ga0157372_10147545
988 Ga0163163_10136403
989 Ga0207653_10008922
990 Ga0207653_10011615
991 Ga0207642_10137711
992 Ga0207647_10112376
993 Ga0207685_10020618
994 Ga0207645_10001757
995 Ga0207643_10000036
996 Ga0207643_10033068
997 Ga0207684_10000115
998 Ga0207684_10000332
999 Ga0207684_10005374
1000 Ga0207684_10007166
1001 Ga0207684_10025225
1002 Ga0207684_10026853
1003 Ga0207684_10111603
1004 Ga0207684_10133271
1005 Ga0207684_10395538
1006 Ga0207654_10001800
1007 Ga0207654_10036663
1008 Ga0207707_10000156
1009 Ga0207671_10018617
1010 Ga0207693_10017750
1011 Ga0207693_10178973
1012 Ga0207660_10004647
1013 Ga0207660_10011792
1014 Ga0207660_10223369
1015 Ga0207660_10256409
1016 Ga0207662_10026860
1017 Ga0207662_10109956
1018 Ga0207657_10000179
1019 Ga0207649_10000839
1020 Ga0207652_10000832
1021 Ga0207646_10000275
1022 Ga0207646_10000773
1023 Ga0207646_10005664
1024 Ga0207646_10048270
1025 Ga0207646_10078341
1026 Ga0207646_10173645
1027 Ga0207646_10227211
1028 Ga0207646_10306611
1029 Ga0207646_10368017
1030 Ga0207646_10408239
1031 Ga0207681_10009674
1032 Ga0207681_10057929
1033 Ga0207681_10135307
1034 Ga0207681_10234049
1035 Ga0207681_10491180
1036 Ga0207650_10014969
1037 Ga0207690_10007488
1038 Ga0207706_10002289
1039 Ga0207706_10037198
1040 Ga0207706_10080433
1041 Ga0207686_10013653
1042 Ga0207709_10016964
1043 Ga0207670_10650620
1044 Ga0207704_10173183
1045 Ga0207704_10194884
1046 Ga0207665_10001888
1047 Ga0207691_10049706
1048 Ga0207711_10092166
1049 Ga0207689_10001824
1050 Ga0207689_10019449
1051 Ga0207689_10023048
1052 Ga0207679_10000578
1053 Ga0207667_10001215
1054 Ga0207712_10007462
1055 Ga0207712_10066978
1056 Ga0207640_10009235
1057 Ga0207640_10453938
1058 Ga0207658_10261657
1059 Ga0207703_10323519
1060 Ga0207639_10026312
1061 Ga0207678_10022175
1062 Ga0207708_10022397
1063 Ga0207708_10176685
1064 Ga0207708_10214588
1065 Ga0207708_10383865
1066 Ga0207702_10000898
1067 Ga0207641_10018116
1068 Ga0207641_10113240
1069 Ga0207641_10146340
1070 Ga0207648_10015388
1071 Ga0207648_10121675
1072 Ga0207648_10149272
1073 Ga0207676_10039961
1074 Ga0207676_10117620
1075 Ga0207674_10001134
1076 Ga0207674_10133362
1077 Ga0207674_10164082
1078 Ga0207675_100108908
1079 Ga0207675_100392688
1080 Ga0209973_1022102
1081 Ga0209967_1005752
1082 Ga0209996_1000901
1083 Ga0209995_1000762
1084 Ga0209968_1003608
1085 Ga0209999_1000742
1086 Ga0209982_1003312
1087 Ga0209970_1001347
1088 Ga0209983_1000605
1089 Ga0209983_1009000
1090 Ga0209588_1010149
1091 Ga0209971_1000290
1092 Ga0209966_1000264
1093 Ga0209998_10000001
1094 Ga0209974_10003797
1095 Ga0207428_10000036
1096 Ga0207428_10000533
1097 Ga0207428_10009658
1098 Ga0207428_10068941
1099 Ga0268265_10004196
1100 Ga0268265_10017731
1101 Ga0268265_10040124
1102 Ga0268265_10076367
1103 Ga0268264_10016517
1104 Ga0268264_10047002
1105 Ga0268264_10316442
1106 Ga0268264_10327399
1107 Ga0307408_100011328
1108 Ga0307408_100087599
1109 Ga0307408_100217210
1110 Ga0307408_100635935
1111 Ga0307413_10361458
1112 Ga0307410_10766271
1113 Ga0307406_10433709
1114 Ga0307416_100208739
1115 Ga0307416_100230509
1116 Ga0307416_100572569
1117 Ga0307411_10134153
1118 Ga0307415_100506366
1119 Ga0307415_100576654
1120 Ga0373948_0001659
1121 Ga0373940_0004203
1122 Ga0373940_0094229
1123 Ga0373951_0013367
1124 Ga0373932_0056122
1125 Ga0373932_0087358
1126 Ga0373939_0060650
1127 Ga0373941_0004852
1128 Ga0373960_0022878
1129 Ga0373960_0044701
1130 Ga0373961_0011183
1131 Ga0373931_0022521
1132 Ga0373931_0029971
1133 Ga0395900_0003774
1134 Ga0395898_0004916
1135 Ga0395898_0432032
1136 Ga0395901_0007481
1137 Ga0439448_0039894
1138 Ga0439455_0026888
1139 Ga0439463_042114
1140 Ga0439458_0003858
1141 Ga0439459_0000409
1142 Ga0439464_0012711
1143 Ga0439460_0011881
1144 Ga0451577_0001922
1145 Ga0451577_0018859
1146 Ga0451577_0042096
1147 Ga0451577_0056126
1148 Ga0451577_0134841
1149 Ga0451577_0136119
1150 Ga0451577_0215450
1151 Ga0453683_0006686
1152 Ga0453683_0040499
1153 Ga0453683_0151574
1154 Ga0453684_0033539
1155 Ga0453684_0109526
1156 Ga0453684_0466706
1157 Ga0451576_0019373
1158 Ga0451576_0043637
1159 Ga0451576_0070107
1160 Ga0451576_0072425
1161 Ga0451576_0084351
1162 Ga0451576_0086241
1163 Ga0451576_0118900
1164 Ga0495580_0001620
1165 Ga0495580_0051216
1166 Ga0495594_0031142
1167 Ga0495598_0087178
1168 Ga0495669_0025877
1169 Ga0495669_0048999
1170 Ga0495669_0094408
1171 Ga0496102_0014574
1172 Ga0496103_0472646
1173 Ga0496106_0216658
1174 Ga0496113_0121122
1175 Ga0501031_0278649
1176 Ga0501033_0069673
1177 Ga0501033_0097209
1178 Ga0501038_0120899
1179 Ga0501038_0128842
1180 Ga0501039_0014592
1181 Ga0501039_0027305
1182 Ga0501039_0044057
1183 Ga0501039_0081036
1184 Ga0501039_0199396
1185 Ga0501040_0016801
1186 Ga0501040_0021264
1187 Ga0501040_0024766
1188 Ga0501040_0038092
1189 Ga0501040_0087022
1190 Ga0501040_0113752
1191 Ga0501040_0221475
1192 Ga0501040_0303527
1193 Ga0501041_0000354
1194 Ga0501041_0021066
1195 Ga0501041_0037136
1196 Ga0501041_0039471
1197 Ga0501041_0206745
1198 Ga0501042_0003376
1199 Ga0501042_0020695
1200 Ga0501042_0110724
1201 Ga0501042_0288248
1202 Ga0501046_0000249
1203 Ga0501046_0043892
1204 Ga0501046_0058700
1205 Ga0501048_0247737
1206 Ga0501068_0083916
1207 Ga0501068_0112429
1208 Ga0501069_0032462
1209 Ga0501071_0061629
1210 Ga0501071_0070846
1211 Ga0501071_0219140
1212 Ga0501072_0006053
1213 Ga0501072_0029876
1214 Ga0501072_0395336
1215 Ga0501072_0401042
1216 Ga0501074_0002488
1217 Ga0501074_0095301
1218 Ga0501075_0009238
1219 Ga0501075_0021428
1220 Ga0501075_0128456
1221 Ga0501075_0132709
1222 Ga0501075_0195576
1223 Ga0501076_0005939
1224 Ga0501076_0006056
1225 Ga0501076_0011568
1226 Ga0501076_0011993
1227 Ga0501076_0215999
1228 Ga0501076_0587401
1229 Ga0501077_0011000
1230 Ga0501077_0030144
1231 Ga0501077_0058659
1232 Ga0501079_0001033
1233 Ga0501079_0011982
1234 Ga0501079_0070735
1235 Ga0501080_0065763
1236 Ga0501080_0153099
1237 Ga0501080_0200810
1238 Ga0501080_0249181
1239 Ga0501080_0366757
1240 Ga0501080_0388149
1241 Ga0501080_0519790
1242 Ga0501081_0000301
1243 Ga0501081_0001191
1244 Ga0501081_0013979
1245 Ga0501081_0023294
1246 Ga0501081_0079850
1247 Ga0501081_0363730
1248 Ga0501081_0518813
1249 Ga0501045_0002887
1250 Ga0501045_0030264
1251 Ga0501045_0080780
1252 nmdc:mga05p37_117223_c1
1253 nmdc:mga05p37_13192_c2
1254 nmdc:mga05p37_175186_c1
1255 nmdc:mga05p37_175501_c1
1256 nmdc:mga05p37_20828_c1
1257 nmdc:mga05p37_2106_c1
1258 nmdc:mga05p37_21837_c1
1259 nmdc:mga05p37_26111_c1
1260 nmdc:mga05p37_342668_c1
1261 nmdc:mga05p37_385645_c1
1262 nmdc:mga05p37_38664_c1
1263 nmdc:mga05p37_40340_c1
1264 nmdc:mga05p37_474894_c1
1265 nmdc:mga05p37_48099_c1
1266 nmdc:mga05p37_61742_c1
1267 nmdc:mga05p37_712742_c1
1268 nmdc:mga05p37_762114_c1
1269 nmdc:mga05p37_7662_c1
1270 nmdc:mga05p37_84575_c1
1271 nmdc:mga09592_12998_c1
1272 nmdc:mga09592_2723_c1
1273 nmdc:mga09592_294690_c1
1274 nmdc:mga09592_378711_c1
1275 nmdc:mga09592_54459_c1
1276 nmdc:mga09592_659778_c1
1277 nmdc:mga09592_68347_c2
1278 nmdc:mga09592_7353_c1
1279 nmdc:mga09592_82748_c1
1280 nmdc:mga09592_8652_c1
1281 nmdc:mga0qj67_19273_c1
1282 nmdc:mga0qj67_522625_c1
1283 nmdc:mga0qj67_8550_c1
1284 nmdc:mga06r32_103301_c1
1285 nmdc:mga06r32_14198_c1
1286 nmdc:mga06r32_146504_c1
1287 nmdc:mga06r32_149290_c1
1288 nmdc:mga06r32_18978_c1
1289 nmdc:mga06r32_2357_c1
1290 nmdc:mga06r32_3011_c1
1291 nmdc:mga06r32_3259_c1
1292 nmdc:mga06r32_41265_c1
1293 nmdc:mga06r32_5474_c1
1294 nmdc:mga06r32_60750_c1
1295 nmdc:mga06r32_6131_c1
1296 nmdc:mga06r32_66940_c1
1297 nmdc:mga06r32_68909_c1
1298 nmdc:mga06r32_83824_c1
1299 nmdc:mga08y16_10505_c1
1300 nmdc:mga08y16_3281_c1
1301 nmdc:mga08y16_34470_c1
1302 nmdc:mga08y16_3977_c1
1303 nmdc:mga0n895_158327_c1
1304 nmdc:mga0n895_212849_c1
1305 nmdc:mga0n895_241104_c1
1306 nmdc:mga0n895_247289_c1
1307 nmdc:mga0n895_494655_c1
1308 nmdc:mga0n895_623814_c1
1309 nmdc:mga0n895_628908_c1
1310 nmdc:mga0n895_7703_c1
1311 nmdc:mga0n895_8177_c1
1312 nmdc:mga0n895_89585_c1
1313 nmdc:mga0rr50_136280_c1
1314 nmdc:mga0rr50_152283_c1
1315 nmdc:mga0rr50_15739_c1
1316 nmdc:mga0rr50_16448_c1
1317 nmdc:mga0rr50_1935_c1
1318 nmdc:mga0rr50_297594_c1
1319 nmdc:mga0rr50_347530_c1
1320 nmdc:mga0rr50_358344_c1
1321 nmdc:mga0rr50_58240_c1
1322 nmdc:mga0rr50_58802_c1
1323 nmdc:mga0rr50_72111_c1
1324 nmdc:mga08x19_149_c1
1325 nmdc:mga08x19_240903_c1
1326 nmdc:mga08x19_276727_c1
1327 nmdc:mga08x19_50563_c1
1328 nmdc:mga08x19_68622_c1
1329 nmdc:mga08x19_8238_c1
1330 nmdc:mga0a205_12084_c1
1331 nmdc:mga0a205_13007_c1
1332 nmdc:mga0a205_1862_c1
1333 nmdc:mga0a205_2414_c1
1334 nmdc:mga0a205_292822_c1
1335 nmdc:mga0a205_406061_c1
1336 nmdc:mga0a205_45783_c1
1337 nmdc:mga0a205_57686_c2
1338 nmdc:mga0a205_5960_c1
1339 nmdc:mga0a205_61579_c1
1340 nmdc:mga0a205_6174_c1
1341 nmdc:mga0a205_71889_c1
1342 nmdc:mga0a205_80591_c1
1343 nmdc:mga0a205_85916_c1
1344 nmdc:mga0a205_91444_c1
1345 Ga0501084_0002088
1346 Ga0501084_0004838
1347 Ga0501084_0021595
1348 Ga0501084_0064790
1349 Ga0501084_0160474
1350 Ga0501084_0408303
1351 Ga0501082_0000881
1352 Ga0501082_0002230
1353 Ga0501082_0042973
1354 Ga0501082_0064941
1355 Ga0501082_0088159
1356 Ga0501082_0137235
1357 Ga0530510_0019188
1358 Ga0530510_0042737
1359 Ga0530510_0060568
1360 Ga0530510_0066452
1361 Ga0530510_0112235
1362 Ga0530510_0308753
1363 Ga0530510_0349196
1364 Ga0530510_0546833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

145

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

157

0.91

PF13468

Glyoxalase_3

Glyoxalase-like domain

34

194

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9521 1 132
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9512 1 132
6xbr-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43l) in complex with 2-nitronate-propionyl-coa 0.951 1 132
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.9504 1 132
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.947 3 133
ID Description Score Start End Superfamily
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9586 3 131 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9575 4 131 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.916 4 131 3.10.180.10
1jc4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.886 4 131 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8755 2 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V7C971-F1-model_v4 Methylmalonyl-CoA epimerase 0.9936 1 251 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V7F2U5-F1-model_v4 Methylmalonyl-CoA epimerase 0.9896 2 251 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V6XK89-F1-model_v4 Methylmalonyl-CoA epimerase 0.9882 1 251 GO:0004462
GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9PNI7-F1-model_v4 VOC family protein 0.9868 1 78 GO:0004493
GO:0046491
GO:0046872
AF-A0A661UXV8-F1-model_v4 Methylmalonyl-CoA epimerase 0.986 2 111 GO:0004493
GO:0046491
GO:0046872

Map