F474731

General Info

Members Datasets Scaffolds Average Seq Length
679 399 1358 512

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0027374|Ga0495660_0027374_1124_2992
Length 605
Sequence VSNVNVVHSLWTTAADSADKIQAPKIEYAQLAPVLIVFGAAVIGIMIEAFLPRRSRYLAQVGVSILGMAAAFAAVVALAAGGYASTKAHIAAMGAVAVDGPALFLQGTVLLVGIVAVFTFAERRLDPKAHGRHVDSFAAQGSAIPGSEQEKDAVKAGFTTTEVFPLLLFAVGGMLVFPAANDLLTLFVALEVFSLPLYLLCALARRRRVMSQEAAVKYFLLGAFSSAFLLFGIALLYGYAGTVTYSGIASVIDGSATLTPALANSSANDALLLIGTALVVMGLLFKVGAVPFHMWTPDVYEGAPTPVTGFMAAATKVAAFGALLRLLYVVLPELRWDWRPVLWGVAILTMLAGAIIAVTQTDVKRLLAYSSIAHAGFILAGVIATSPDGVSSVLFYLAAYSFVTLGAFAVVTLVRDAGGEATHLSRWAGLGRRSPLVAAVFAVFLLAFAGIPLTSGFAGKFAVFKAAAQGGAVPLVIVGVFFSEPKADGPTVAVPSPLTSAAIAIGVAVTXXLGVAPQYFLDLAGQAGVFVRKWRPGVGGSRGAVMCLKSSQCPKKSCRNAQFGLSFLSGHGRGGPLDTVTIGGNSGEFRVCDQCCRTRTYRQDR

Samples

Sample ID Description Type Environment
1 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
49 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
89 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
136 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
274 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
275 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
287 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
288 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
289 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
290 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
291 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
292 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
293 2643221548 Streptomyces sp. Root55 Isolate Unclassified
294 2643221578 Streptomyces sp. Root63 Isolate Unclassified
295 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
296 2643221647 Streptomyces sp. Root369 Isolate Unclassified
297 2643221670 Streptomyces sp. Root431 Isolate Unclassified
298 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
299 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
300 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
301 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
302 2643221714 Streptomyces sp. Root264 Isolate Unclassified
303 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
304 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
305 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
306 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
307 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
308 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
309 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
310 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
311 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
312 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
313 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
314 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
315 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
316 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
317 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
318 2808606448 Streptomyces sp. 193411 Isolate Unclassified
319 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
320 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
321 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
322 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
323 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
324 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
325 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
326 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
327 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
328 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
329 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
330 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
331 2862574272 Streptomyces sp. AcE210 Isolate Nodule
332 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
333 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
334 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
335 2867369537 Streptomyces sp. Z26 Isolate Unclassified
336 2867428634 Streptomyces sp. RP5T Isolate Unclassified
337 2867475112 Streptomyces sp. TM32 Isolate Unclassified
338 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
339 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
340 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
341 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
342 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
343 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
344 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
345 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
346 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
347 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
348 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
349 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
350 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
351 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
352 2922554459 Rhodococcus sp. 66b Isolate Unclassified
353 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
354 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
355 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
356 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
357 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
358 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
359 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
360 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
361 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
362 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
363 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
364 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
365 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
366 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
367 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
368 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
369 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
370 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
371 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
372 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
373 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
374 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
375 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
376 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
377 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
378 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
379 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
380 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
381 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
382 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
383 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
384 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
385 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
386 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
387 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
388 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
389 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
390 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
391 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
392 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
393 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
394 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
395 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
396 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
397 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
398 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
399 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.92
Metatranscriptomes 0.29
Isolates 16.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.44
Rhizoplane 4.57
Rhizosphere 76.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495660_0027374 3300046810 Bacteria 3226
2 JGI25153J46596_10015223 3300003215 Bacteria 3149
3 Ga0006562J51391_1080308 3300003578 Bacteria 2260
4 Ga0006562J51391_1111409 3300003578 Bacteria 4110
5 Ga0055540_1000003 3300003792 Bacteria 428375
6 Ga0070658_10011130 3300005327 Bacteria 7212
7 Ga0070682_100033676 3300005337 Bacteria 3115
8 Ga0068868_100163993 3300005338 Bacteria 1837
9 Ga0070667_100000854 3300005367 Bacteria 28370
10 Ga0070709_10001783 3300005434 Bacteria 11699
11 Ga0070709_10002508 3300005434 Bacteria 9938
12 Ga0070709_10005879 3300005434 Bacteria 6654
13 Ga0070709_10046532 3300005434 Bacteria 2698
14 Ga0070714_100001268 3300005435 Bacteria 18229
15 Ga0070714_100005582 3300005435 Bacteria 9610
16 Ga0070714_100006851 3300005435 Bacteria 8831
17 Ga0070714_100033643 3300005435 Bacteria 4287
18 Ga0070714_100039200 3300005435 Bacteria 3987
19 Ga0070713_100000369 3300005436 Bacteria 28941
20 Ga0070713_100022747 3300005436 Bacteria 4849
21 Ga0070713_100023714 3300005436 Bacteria 4767
22 Ga0070713_100105556 3300005436 Bacteria 2447
23 Ga0070710_10000264 3300005437 Bacteria 24986
24 Ga0070710_10000267 3300005437 Bacteria 24789
25 Ga0070710_10004252 3300005437 Bacteria 6787
26 Ga0070710_10020029 3300005437 Bacteria 3466
27 Ga0070711_100001708 3300005439 Bacteria 12169
28 Ga0070711_100038602 3300005439 Bacteria 3212
29 Ga0070711_100040425 3300005439 Bacteria 3145
30 Ga0070705_100011928 3300005440 Bacteria 4402
31 Ga0070708_100005904 3300005445 Bacteria 9728
32 Ga0070663_100086012 3300005455 Bacteria 2321
33 Ga0070706_100020244 3300005467 Bacteria 6131
34 Ga0070706_100028237 3300005467 Bacteria 5164
35 Ga0070706_100043623 3300005467 Bacteria 4144
36 Ga0070707_100015181 3300005468 Bacteria 7227
37 Ga0070698_100000073 3300005471 Bacteria 75512
38 Ga0070698_100010204 3300005471 Bacteria 10032
39 Ga0070698_100047176 3300005471 Bacteria 4403
40 Ga0070698_100157208 3300005471 Bacteria 2219
41 Ga0070679_100146724 3300005530 Bacteria 2336
42 Ga0070695_100054913 3300005545 Bacteria 2566
43 Ga0070665_100045935 3300005548 Bacteria 4387
44 Ga0070704_100114846 3300005549 Bacteria 2056
45 Ga0068855_100005770 3300005563 Bacteria 15115
46 Ga0068854_100002127 3300005578 Bacteria 12160
47 Ga0068856_100007423 3300005614 Bacteria 10696
48 Ga0068856_100014411 3300005614 Bacteria 7641
49 Ga0068852_100004180 3300005616 Bacteria 10173
50 Ga0068852_100060171 3300005616 Bacteria 3297
51 Ga0068863_100128334 3300005841 Bacteria 2420
52 Ga0081540_1001294 3300005983 Bacteria 21844
53 Ga0070717_10015347 3300006028 Bacteria 5916
54 Ga0070717_10024758 3300006028 Bacteria 4769
55 Ga0070717_10118691 3300006028 Bacteria 2264
56 Ga0075364_10080383 3300006051 Bacteria 2155
57 Ga0075364_10090337 3300006051 Bacteria 2031
58 Ga0070716_100001114 3300006173 Bacteria 11834
59 Ga0070716_100006134 3300006173 Bacteria 5865
60 Ga0070716_100036106 3300006173 Bacteria 2723
61 Ga0070712_100025772 3300006175 Bacteria 3911
62 Ga0070712_100027524 3300006175 Bacteria 3796
63 Ga0075433_10024593 3300006852 Bacteria 5086
64 Ga0075434_100025331 3300006871 Bacteria 5804
65 Ga0105240_10015644 3300009093 Bacteria 10302
66 Ga0105245_10028105 3300009098 Bacteria 4957
67 Ga0105245_10160471 3300009098 Bacteria 2133
68 Ga0105243_10000636 3300009148 Bacteria 34702
69 Ga0105248_10114196 3300009177 Bacteria 3046
70 Ga0105237_10077757 3300009545 Bacteria 3308
71 Ga0105238_10000200 3300009551 Bacteria 66219
72 Ga0157370_10024989 3300013104 Bacteria 5912
73 Ga0157370_10083600 3300013104 Bacteria 3001
74 Ga0157369_10066681 3300013105 Bacteria 3872
75 Ga0157375_10099523 3300013308 Bacteria 2987
76 Ga0182008_10002958 3300014497 Bacteria 10453
77 Ga0182006_1019582 3300015261 Bacteria 2847
78 Ga0182007_10007455 3300015262 Bacteria 4584
79 Ga0183367_1002 3300015688 Bacteria 1101531
80 Ga0213873_10000037 3300021358 Bacteria 34798
81 Ga0213875_10000336 3300021388 Bacteria 44356
82 Ga0213875_10005392 3300021388 Bacteria 6868
83 Ga0213875_10007298 3300021388 Bacteria 5722
84 Ga0213875_10024638 3300021388 Bacteria 2868
85 Ga0213875_10028186 3300021388 Bacteria 2669
86 Ga0209758_1007953 3300025297 Bacteria 7028
87 Ga0207426_1003792 3300025302 Bacteria 7845
88 Ga0209051_1000011 3300025303 Bacteria 610828
89 Ga0209051_1007434 3300025303 Bacteria 5986
90 Ga0207692_10000049 3300025898 Bacteria 35853
91 Ga0207692_10000079 3300025898 Bacteria 27914
92 Ga0207692_10016436 3300025898 Bacteria 3277
93 Ga0207692_10025779 3300025898 Bacteria 2751
94 Ga0207647_10000384 3300025904 Bacteria 35996
95 Ga0207647_10010815 3300025904 Bacteria 6423
96 Ga0207699_10000297 3300025906 Bacteria 26655
97 Ga0207699_10001937 3300025906 Bacteria 9750
98 Ga0207699_10006555 3300025906 Bacteria 5646
99 Ga0207699_10029862 3300025906 Bacteria 3044
100 Ga0207699_10077192 3300025906 Bacteria 2054
101 Ga0207705_10004355 3300025909 Bacteria 10703
102 Ga0207684_10051591 3300025910 Bacteria 3490
103 Ga0207684_10077277 3300025910 Bacteria 2830
104 Ga0207684_10078134 3300025910 Bacteria 2815
105 Ga0207654_10002806 3300025911 Bacteria 8844
106 Ga0207695_10000449 3300025913 Bacteria 89856
107 Ga0207671_10000052 3300025914 Bacteria 188462
108 Ga0207693_10003378 3300025915 Bacteria 13631
109 Ga0207693_10005398 3300025915 Bacteria 10683
110 Ga0207693_10009896 3300025915 Bacteria 7754
111 Ga0207663_10001646 3300025916 Bacteria 10535
112 Ga0207663_10009920 3300025916 Bacteria 5042
113 Ga0207663_10026757 3300025916 Bacteria 3352
114 Ga0207646_10124800 3300025922 Bacteria 2314
115 Ga0207694_10000079 3300025924 Bacteria 111767
116 Ga0207687_10016217 3300025927 Bacteria 4892
117 Ga0207700_10000270 3300025928 Bacteria 30934
118 Ga0207700_10002724 3300025928 Bacteria 10191
119 Ga0207700_10020533 3300025928 Bacteria 4489
120 Ga0207664_10002335 3300025929 Bacteria 12539
121 Ga0207664_10005266 3300025929 Bacteria 8833
122 Ga0207664_10032506 3300025929 Bacteria 3999
123 Ga0207664_10047933 3300025929 Bacteria 3359
124 Ga0207664_10063345 3300025929 Bacteria 2955
125 Ga0207709_10057891 3300025935 Bacteria 2406
126 Ga0207665_10000611 3300025939 Bacteria 24040
127 Ga0207665_10000635 3300025939 Bacteria 23623
128 Ga0207665_10001386 3300025939 Bacteria 16319
129 Ga0207665_10006669 3300025939 Bacteria 7660
130 Ga0207665_10032818 3300025939 Bacteria 3438
131 Ga0207667_10012052 3300025949 Bacteria 9998
132 Ga0207640_10011379 3300025981 Bacteria 5036
133 Ga0207658_10000449 3300025986 Bacteria 38511
134 Ga0207678_10041252 3300026067 Bacteria 4001
135 Ga0207683_10178799 3300026121 Bacteria 1923
136 Ga0207698_10008404 3300026142 Bacteria 6528
137 Ga0207698_10075408 3300026142 Bacteria 2695
138 Ga0265337_1000389 3300028556 Bacteria 23661
139 Ga0265326_10000357 3300028558 Bacteria 19299
140 Ga0265319_1001349 3300028563 Bacteria 14768
141 Ga0265334_10011557 3300028573 Bacteria 3713
142 Ga0265323_10006314 3300028653 Bacteria 4983
143 Ga0265336_10008967 3300028666 Bacteria 3479
144 Ga0307517_10004659 3300028786 Bacteria 21023
145 Ga0307517_10005623 3300028786 Bacteria 18815
146 Ga0307515_10001177 3300028794 Bacteria 59836
147 Ga0307515_10034411 3300028794 Bacteria 8295
148 Ga0307515_10096391 3300028794 Bacteria 3628
149 Ga0307515_10119339 3300028794 Bacteria 3001
150 Ga0265338_10001255 3300028800 Bacteria 41829
151 Ga0265338_10015415 3300028800 Bacteria 8398
152 Ga0265338_10016987 3300028800 Bacteria 7872
153 Ga0265324_10000773 3300029957 Bacteria 21095
154 Ga0307511_10001462 3300030521 Bacteria 24966
155 Ga0307512_10030070 3300030522 Bacteria 4732
156 Ga0307512_10041139 3300030522 Bacteria 3845
157 Ga0307512_10088375 3300030522 Bacteria 2176
158 Ga0314311_1057543 3300030733 Bacteria 4715
159 Ga0316180_1129606 3300030736 Bacteria 2460
160 Ga0265332_10002502 3300031238 Bacteria 9339
161 Ga0265320_10000980 3300031240 Bacteria 21245
162 Ga0265340_10001509 3300031247 Bacteria 13356
163 Ga0265339_10014930 3300031249 Bacteria 4670
164 Ga0265327_10000630 3300031251 Bacteria 57536
165 Ga0265316_10017659 3300031344 Bacteria 6155
166 Ga0307513_10054950 3300031456 Bacteria 4264
167 Ga0307509_10065669 3300031507 Bacteria 3809
168 Ga0307509_10107813 3300031507 Bacteria 2800
169 Ga0265313_10006874 3300031595 Bacteria 7926
170 Ga0307508_10001775 3300031616 Bacteria 23968
171 Ga0307508_10020650 3300031616 Bacteria 5981
172 Ga0307508_10037943 3300031616 Bacteria 4332
173 Ga0307508_10055687 3300031616 Bacteria 3502
174 Ga0307508_10095846 3300031616 Bacteria 2558
175 Ga0307514_10014628 3300031649 Bacteria 6491
176 Ga0265314_10020636 3300031711 Bacteria 5085
177 Ga0265342_10001351 3300031712 Bacteria 22957
178 Ga0316576_10002126 3300031727 Bacteria 11152
179 Ga0307516_10007060 3300031730 Bacteria 12997
180 Ga0307516_10023113 3300031730 Bacteria 6378
181 Ga0307516_10039708 3300031730 Bacteria 4690
182 Ga0307518_10076954 3300031838 Bacteria 2411
183 Ga0307409_100200205 3300031995 Bacteria 1786
184 Ga0307507_10009696 3300033179 Bacteria 12719
185 Ga0307510_10017067 3300033180 Bacteria 8564
186 Ga0307510_10052520 3300033180 Bacteria 4295
187 Ga0373926_0004731 3300035083 Bacteria 4475
188 Ga0373934_0006443 3300035086 Bacteria 4356
189 Ga0373934_0008791 3300035086 Bacteria 3773
190 Ga0373934_0010978 3300035086 Bacteria 3406
191 Ga0373932_0006697 3300035112 Bacteria 2731
192 Ga0373953_0002988 3300035117 Bacteria 5175
193 Ga0373953_0005734 3300035117 Bacteria 4049
194 Ga0373954_0026691 3300035118 Bacteria 2648
195 Ga0373956_0015830 3300035119 Bacteria 3162
196 Ga0373956_0021564 3300035119 Bacteria 2748
197 Ga0373957_0024605 3300035120 Bacteria 2163
198 Ga0373960_0011373 3300035121 Bacteria 2191
199 Ga0373955_0013056 3300035172 Bacteria 4005
200 Ga0373924_0006312 3300035410 Bacteria 4241
201 Ga0373935_0015322 3300035692 Bacteria 4632
202 Ga0373935_0030306 3300035692 Bacteria 3352
203 Ga0373933_0030053 3300035724 Bacteria 3144
204 Ga0373933_0092342 3300035724 Bacteria 1869
205 Ga0373947_0000009 3300035725 Bacteria 172751
206 Ga0373937_0002378 3300036401 Bacteria 15653
207 Ga0373937_0055470 3300036401 Bacteria 3637
208 Ga0373937_0103019 3300036401 Bacteria 2650
209 Ga0373925_0000006 3300037068 Bacteria 278942
210 Ga0395898_0006692 3300037466 Bacteria 12285
211 Ga0395898_0113134 3300037466 Bacteria 2601
212 Ga0395905_0063002 3300037471 Bacteria 3469
213 Ga0436364_0516238 3300037853 Bacteria 122645
214 Ga0436364_0696641 3300037853 Bacteria 19004
215 Ga0436364_0735260 3300037853 Bacteria 16919
216 Ga0436364_0834160 3300037853 Bacteria 4768
217 Ga0436364_1218450 3300037853 Bacteria 12688
218 Ga0395901_0018201 3300038443 Bacteria 7173
219 Ga0395901_0082838 3300038443 Bacteria 3352
220 Ga0436363_0807244 3300039450 Bacteria 3959
221 Ga0439436_0000571 3300041404 Bacteria 9752
222 Ga0451837_0008945 3300041494 Bacteria 7473
223 Ga0451853_0219758 3300041512 Bacteria 2564
224 Ga0451853_1344316 3300041512 Bacteria 2934
225 Ga0451853_3356587 3300041512 Bacteria 2206
226 Ga0439457_002109 3300042014 Bacteria 5787
227 Ga0439457_003796 3300042014 Bacteria 4056
228 Ga0450894_000142 3300042131 Bacteria 12667
229 Ga0450903_000121 3300042138 Bacteria 16870
230 Ga0450906_001111 3300042145 Bacteria 5958
231 Ga0466969_0007793 3300044656 Bacteria 5693
232 Ga0466969_0015955 3300044656 Bacteria 3937
233 Ga0466969_0075914 3300044656 Bacteria 1610
234 Ga0466972_0009172 3300044658 Bacteria 4969
235 Ga0466972_0009639 3300044658 Bacteria 4846
236 Ga0466972_0012839 3300044658 Bacteria 4207
237 Ga0466972_0023794 3300044658 Bacteria 3044
238 Ga0466965_0001784 3300044683 Bacteria 8909
239 Ga0466965_0006622 3300044683 Bacteria 5279
240 Ga0466965_0016079 3300044683 Bacteria 3555
241 Ga0466965_0072116 3300044683 Bacteria 1738
242 Ga0466966_0000436 3300044684 Bacteria 26836
243 Ga0466966_0002655 3300044684 Bacteria 11713
244 Ga0466966_0015471 3300044684 Bacteria 5043
245 Ga0466966_0075259 3300044684 Bacteria 2109
246 Ga0466961_0009102 3300044693 Bacteria 6329
247 Ga0466961_0015853 3300044693 Bacteria 4835
248 Ga0466961_0021961 3300044693 Bacteria 4106
249 Ga0466961_0047126 3300044693 Bacteria 2756
250 Ga0466963_0000236 3300044694 Bacteria 23896
251 Ga0466963_0000656 3300044694 Bacteria 16684
252 Ga0466963_0001704 3300044694 Bacteria 11975
253 Ga0466963_0017570 3300044694 Bacteria 4461
254 Ga0466964_0002609 3300044706 Bacteria 6441
255 Ga0466971_0000161 3300044719 Bacteria 25159
256 Ga0466971_0008971 3300044719 Bacteria 4372
257 Ga0466968_0000188 3300044735 Bacteria 18761
258 Ga0466970_0000292 3300044765 Bacteria 24512
259 Ga0466970_0003281 3300044765 Bacteria 7860
260 Ga0466970_0011006 3300044765 Bacteria 4603
261 Ga0466957_0001084 3300044842 Bacteria 14046
262 Ga0466957_0001267 3300044842 Bacteria 13152
263 Ga0466957_0002078 3300044842 Bacteria 10712
264 Ga0466957_0106015 3300044842 Bacteria 1777
265 Ga0466960_0001597 3300044901 Bacteria 8294
266 Ga0466960_0005195 3300044901 Bacteria 5145
267 Ga0466959_0001597 3300045049 Bacteria 13978
268 Ga0466959_0004929 3300045049 Bacteria 9041
269 Ga0466959_0021088 3300045049 Bacteria 4804
270 Ga0466959_0051396 3300045049 Bacteria 3023
271 Ga0466967_0000825 3300045976 Bacteria 16309
272 Ga0466967_0055208 3300045976 Bacteria 3499
273 Ga0466967_0112180 3300045976 Bacteria 2507
274 Ga0466967_0171196 3300045976 Bacteria 2043
275 Ga0495617_019029 3300046452 Bacteria 2322
276 Ga0495592_0005902 3300046454 Bacteria 9091
277 Ga0495592_0014811 3300046454 Bacteria 5920
278 Ga0495592_0022587 3300046454 Bacteria 4785
279 Ga0495592_0074802 3300046454 Bacteria 2460
280 Ga0495603_0005893 3300046455 Bacteria 7323
281 Ga0495603_0007219 3300046455 Bacteria 6671
282 Ga0495629_0004519 3300046459 Bacteria 10405
283 Ga0495629_0007791 3300046459 Bacteria 7882
284 Ga0495629_0008011 3300046459 Bacteria 7774
285 Ga0495629_0011231 3300046459 Bacteria 6503
286 Ga0495629_0012446 3300046459 Bacteria 6162
287 Ga0495629_0040099 3300046459 Bacteria 3294
288 Ga0495629_0043483 3300046459 Bacteria 3154
289 Ga0495638_0027868 3300046460 Bacteria 3652
290 Ga0495638_0059845 3300046460 Bacteria 2357
291 Ga0495651_0002505 3300046462 Bacteria 14206
292 Ga0495651_0013713 3300046462 Bacteria 6265
293 Ga0495651_0024478 3300046462 Bacteria 4696
294 Ga0495651_0024687 3300046462 Bacteria 4675
295 Ga0495653_0024635 3300046463 Bacteria 4845
296 Ga0495653_0029711 3300046463 Bacteria 4359
297 Ga0495653_0029758 3300046463 Bacteria 4355
298 Ga0495653_0091033 3300046463 Bacteria 2230
299 Ga0495582_0063541 3300046473 Bacteria 2039
300 Ga0495605_0001918 3300046474 Bacteria 13238
301 Ga0495639_0004613 3300046475 Bacteria 5912
302 Ga0495662_0003988 3300046476 Bacteria 7436
303 Ga0495662_0007534 3300046476 Bacteria 5374
304 Ga0495662_0024665 3300046476 Bacteria 2902
305 Ga0495664_0092645 3300046477 Bacteria 1817
306 Ga0495585_0022570 3300046492 Bacteria 3612
307 Ga0495585_0048245 3300046492 Bacteria 2368
308 Ga0495594_0000809 3300046499 Bacteria 16155
309 Ga0495594_0063241 3300046499 Bacteria 2050
310 Ga0495606_0002492 3300046507 Bacteria 21287
311 Ga0495608_0017646 3300046511 Bacteria 4935
312 Ga0495608_0025150 3300046511 Bacteria 4064
313 Ga0495618_0008183 3300046514 Bacteria 6332
314 Ga0495618_0068564 3300046514 Bacteria 2255
315 Ga0495628_0032325 3300046516 Bacteria 4224
316 Ga0495630_0014794 3300046517 Bacteria 5690
317 Ga0495630_0067670 3300046517 Bacteria 2685
318 Ga0495637_0044282 3300046520 Bacteria 1895
319 Ga0495643_0002976 3300046522 Bacteria 12812
320 Ga0495652_0018209 3300046529 Bacteria 6267
321 Ga0495652_0024841 3300046529 Bacteria 5302
322 Ga0495652_0024842 3300046529 Bacteria 5302
323 Ga0495652_0042689 3300046529 Bacteria 3909
324 Ga0495652_0130461 3300046529 Bacteria 1990
325 Ga0495652_0137011 3300046529 Bacteria 1930
326 Ga0495665_0008914 3300046531 Bacteria 5443
327 Ga0495587_0012600 3300046536 Bacteria 5317
328 Ga0495587_0014853 3300046536 Bacteria 4872
329 Ga0495587_0048492 3300046536 Bacteria 2515
330 Ga0495609_0004676 3300046538 Bacteria 7418
331 Ga0495645_0059445 3300046543 Bacteria 2771
332 Ga0495645_0095418 3300046543 Bacteria 2120
333 Ga0495622_0002593 3300046557 Bacteria 8718
334 Ga0495667_0019017 3300046559 Bacteria 4636
335 Ga0495667_0032695 3300046559 Bacteria 3484
336 Ga0495668_0000123 3300046616 Bacteria 115173
337 Ga0495668_0033195 3300046616 Bacteria 2900
338 Ga0495634_0006120 3300046642 Bacteria 9162
339 Ga0495634_0013475 3300046642 Bacteria 5906
340 Ga0495634_0057651 3300046642 Bacteria 2591
341 Ga0495611_0036941 3300046648 Bacteria 2169
342 Ga0495625_0011790 3300046660 Bacteria 7101
343 Ga0495635_0002007 3300046663 Bacteria 13820
344 Ga0495635_0002565 3300046663 Bacteria 12433
345 Ga0495661_0011932 3300046665 Bacteria 5881
346 Ga0495588_0007660 3300046674 Bacteria 4928
347 Ga0495588_0020750 3300046674 Bacteria 3232
348 Ga0495588_0039330 3300046674 Bacteria 2409
349 Ga0495657_0004839 3300046675 Bacteria 10733
350 Ga0495657_0007083 3300046675 Bacteria 8700
351 Ga0495657_0017555 3300046675 Bacteria 5192
352 Ga0495657_0070319 3300046675 Bacteria 2287
353 Ga0495623_0028339 3300046679 Bacteria 3603
354 Ga0495623_0033441 3300046679 Bacteria 3299
355 Ga0495646_0008137 3300046680 Bacteria 6665
356 Ga0495646_0017778 3300046680 Bacteria 4507
357 Ga0495613_0001664 3300046689 Bacteria 16910
358 Ga0495613_0003471 3300046689 Bacteria 11793
359 Ga0495613_0030896 3300046689 Bacteria 3978
360 Ga0495624_0010341 3300046690 Bacteria 6427
361 Ga0495670_0016567 3300046691 Bacteria 3624
362 Ga0495671_0022034 3300046692 Bacteria 3341
363 Ga0495589_0008453 3300046794 Bacteria 5375
364 Ga0495600_0011220 3300046809 Bacteria 5582
365 Ga0495600_0063220 3300046809 Bacteria 2418
366 Ga0495581_0068334 3300047315 Bacteria 2054
367 Ga0495581_0100408 3300047315 Bacteria 1681
368 Ga0495604_0002351 3300047317 Bacteria 15156
369 Ga0495604_0003419 3300047317 Bacteria 12659
370 Ga0495604_0013209 3300047317 Bacteria 6576
371 Ga0495604_0013954 3300047317 Bacteria 6407
372 Ga0495604_0047727 3300047317 Bacteria 3334
373 Ga0495636_0004713 3300047318 Bacteria 5350
374 Ga0495636_0007267 3300047318 Bacteria 4360
375 Ga0495674_0068291 3300047319 Bacteria 3076
376 Ga0495676_0001590 3300047321 Bacteria 19706
377 Ga0495676_0002415 3300047321 Bacteria 16590
378 Ga0495676_0032006 3300047321 Bacteria 4443
379 Ga0495680_0003800 3300047322 Bacteria 14659
380 Ga0495680_0022554 3300047322 Bacteria 5243
381 Ga0495680_0057872 3300047322 Bacteria 2996
382 Ga0495687_001147 3300047443 Bacteria 25643
383 Ga0495687_005672 3300047443 Bacteria 7885
384 Ga0495687_012402 3300047443 Bacteria 4509
385 Ga0495675_0016789 3300047444 Bacteria 4629
386 Ga0495675_0049660 3300047444 Bacteria 2666
387 Ga0495675_0051595 3300047444 Bacteria 2612
388 Ga0495675_0090150 3300047444 Bacteria 1924
389 Ga0495685_001275 3300047447 Bacteria 7695
390 Ga0495685_002570 3300047447 Bacteria 5708
391 Ga0495685_005265 3300047447 Bacteria 4214
392 Ga0495685_007555 3300047447 Bacteria 3591
393 Ga0495681_0002939 3300047470 Bacteria 12037
394 Ga0495681_0003151 3300047470 Bacteria 11550
395 Ga0495684_0056651 3300047471 Bacteria 2987
396 Ga0495686_0024050 3300047472 Bacteria 4007
397 Ga0495593_0006509 3300047673 Bacteria 6843
398 Ga0495602_0053073 3300048088 Bacteria 3593
399 Ga0495602_0071510 3300048088 Bacteria 2962
400 Ga0495614_0000229 3300048089 Bacteria 21780
401 Ga0495614_0006382 3300048089 Bacteria 5293
402 Ga0495614_0025543 3300048089 Bacteria 2547
403 Ga0496100_0000067 3300048903 Bacteria 58703
404 Ga0496100_0021707 3300048903 Bacteria 3872
405 Ga0496101_0000099 3300048904 Bacteria 90235
406 Ga0496102_0005671 3300048905 Bacteria 10599
407 Ga0496102_0168601 3300048905 Bacteria 2061
408 Ga0496103_0000116 3300048906 Bacteria 86969
409 Ga0496103_0046643 3300048906 Bacteria 2676
410 Ga0496104_0000724 3300048907 Bacteria 28401
411 Ga0496104_0006327 3300048907 Bacteria 10416
412 Ga0496105_0000853 3300048908 Bacteria 20802
413 Ga0496105_0033049 3300048908 Bacteria 4246
414 Ga0496105_0044487 3300048908 Bacteria 3662
415 Ga0496106_0001741 3300048909 Bacteria 16250
416 Ga0496107_0000254 3300048910 Bacteria 28236
417 Ga0496108_0006695 3300048911 Bacteria 9332
418 Ga0496108_0027291 3300048911 Bacteria 4713
419 Ga0496108_0037301 3300048911 Bacteria 4047
420 Ga0496108_0135791 3300048911 Bacteria 2116
421 Ga0496109_0000159 3300048912 Bacteria 66124
422 Ga0496109_0010817 3300048912 Bacteria 7812
423 Ga0496109_0017554 3300048912 Bacteria 6274
424 Ga0496109_0081405 3300048912 Bacteria 2983
425 Ga0496110_0006109 3300048913 Bacteria 9492
426 Ga0496110_0054431 3300048913 Bacteria 3520
427 Ga0496111_0009376 3300048914 Bacteria 6528
428 Ga0496111_0029613 3300048914 Bacteria 3889
429 Ga0496112_0002048 3300048915 Bacteria 15973
430 Ga0496113_0000928 3300048916 Bacteria 15540
431 Ga0496114_0000116 3300048917 Bacteria 57632
432 Ga0496114_0099655 3300048917 Bacteria 2478
433 Ga0496117_0019421 3300048920 Bacteria 5581
434 Ga0496118_0049614 3300048921 Bacteria 3230
435 Ga0496119_0009307 3300048922 Bacteria 8451
436 Ga0496119_0035544 3300048922 Bacteria 3263
437 Ga0496120_0002960 3300048923 Bacteria 16171
438 Ga0496121_0000016 3300048924 Bacteria 562911
439 Ga0496122_0000284 3300048925 Bacteria 113244
440 Ga0496124_0000015 3300048927 Bacteria 460700
441 Ga0496125_0000021 3300048928 Bacteria 460688
442 Ga0496125_0053379 3300048928 Bacteria 3313
443 Ga0496126_0000015 3300048929 Bacteria 663212
444 Ga0496126_0017245 3300048929 Bacteria 7195
445 Ga0501031_0000144 3300049568 Bacteria 40113
446 Ga0501031_0001068 3300049568 Bacteria 16636
447 Ga0501031_0021857 3300049568 Bacteria 4168
448 Ga0501031_0051356 3300049568 Bacteria 2685
449 Ga0501032_0000686 3300049569 Bacteria 27531
450 Ga0501032_0014320 3300049569 Bacteria 5617
451 Ga0501032_0043343 3300049569 Bacteria 3048
452 Ga0501033_0015747 3300049570 Bacteria 5732
453 Ga0501033_0021996 3300049570 Bacteria 4810
454 Ga0501033_0027832 3300049570 Bacteria 4248
455 Ga0501033_0028919 3300049570 Bacteria 4164
456 Ga0501033_0057624 3300049570 Bacteria 2870
457 Ga0501034_0000987 3300049571 Bacteria 40823
458 Ga0501034_0022128 3300049571 Bacteria 6476
459 Ga0501034_0030062 3300049571 Bacteria 5522
460 Ga0501034_0039050 3300049571 Bacteria 4809
461 Ga0501034_0051717 3300049571 Bacteria 4142
462 Ga0501034_0140139 3300049571 Bacteria 2398
463 Ga0501036_0001560 3300049572 Bacteria 17694
464 Ga0501036_0010970 3300049572 Bacteria 7492
465 Ga0501036_0021180 3300049572 Bacteria 5461
466 Ga0501036_0027940 3300049572 Bacteria 4769
467 Ga0501037_0000465 3300049573 Bacteria 32981
468 Ga0501037_0009904 3300049573 Bacteria 6992
469 Ga0501037_0031458 3300049573 Bacteria 3918
470 Ga0501038_0001242 3300049574 Bacteria 23113
471 Ga0501038_0005265 3300049574 Bacteria 12029
472 Ga0501038_0006036 3300049574 Bacteria 11214
473 Ga0501038_0025253 3300049574 Bacteria 5297
474 Ga0501038_0025467 3300049574 Bacteria 5273
475 Ga0501038_0043058 3300049574 Bacteria 3928
476 Ga0501038_0072371 3300049574 Bacteria 2921
477 Ga0501039_0002923 3300049575 Bacteria 12788
478 Ga0501039_0018461 3300049575 Bacteria 5354
479 Ga0501039_0019816 3300049575 Bacteria 5157
480 Ga0501039_0023283 3300049575 Bacteria 4755
481 Ga0501039_0037513 3300049575 Bacteria 3740
482 Ga0501040_0070721 3300049576 Bacteria 2408
483 Ga0501041_0000883 3300049577 Bacteria 16205
484 Ga0501041_0008355 3300049577 Bacteria 6089
485 Ga0501042_0009170 3300049578 Bacteria 6579
486 Ga0501042_0019320 3300049578 Bacteria 4729
487 Ga0501043_0000867 3300049579 Bacteria 26805
488 Ga0501043_0005384 3300049579 Bacteria 10336
489 Ga0501043_0013915 3300049579 Bacteria 6296
490 Ga0501043_0020027 3300049579 Bacteria 5250
491 Ga0501043_0028015 3300049579 Bacteria 4421
492 Ga0501043_0101149 3300049579 Bacteria 2265
493 Ga0501046_0003795 3300049580 Bacteria 13830
494 Ga0501046_0005700 3300049580 Bacteria 11112
495 Ga0501046_0013539 3300049580 Bacteria 6901
496 Ga0501047_0000112 3300049581 Bacteria 98939
497 Ga0501047_0000216 3300049581 Bacteria 69275
498 Ga0501047_0000544 3300049581 Bacteria 40681
499 Ga0501047_0024159 3300049581 Bacteria 5837
500 Ga0501047_0032135 3300049581 Bacteria 5065
501 Ga0501047_0083237 3300049581 Bacteria 3075
502 Ga0501047_0118365 3300049581 Bacteria 2531
503 Ga0501048_0005351 3300049582 Bacteria 9767
504 Ga0501048_0017048 3300049582 Bacteria 5353
505 Ga0501048_0028025 3300049582 Bacteria 4090
506 Ga0501048_0044554 3300049582 Bacteria 3172
507 Ga0501067_0002500 3300049583 Bacteria 10156
508 Ga0501067_0016066 3300049583 Bacteria 4140
509 Ga0501067_0020615 3300049583 Bacteria 3648
510 Ga0501069_0000515 3300049585 Bacteria 17655
511 Ga0501069_0005601 3300049585 Bacteria 6532
512 Ga0501070_0007603 3300049586 Bacteria 9201
513 Ga0501070_0019161 3300049586 Bacteria 5740
514 Ga0501070_0021228 3300049586 Bacteria 5450
515 Ga0501071_0018444 3300049587 Bacteria 4831
516 Ga0501072_0002534 3300049588 Bacteria 13689
517 Ga0501072_0005287 3300049588 Bacteria 9832
518 Ga0501073_0006527 3300049589 Bacteria 8679
519 Ga0501074_0007950 3300049590 Bacteria 7683
520 Ga0501074_0008553 3300049590 Bacteria 7415
521 Ga0501075_0030006 3300049591 Bacteria 4024
522 Ga0501076_0050891 3300049592 Bacteria 3278
523 Ga0501076_0059410 3300049592 Bacteria 3041
524 Ga0501077_0040580 3300049593 Bacteria 2965
525 Ga0501079_0028641 3300049741 Bacteria 4274
526 Ga0501079_0116551 3300049741 Bacteria 2076
527 Ga0501080_0013818 3300049742 Bacteria 7433
528 Ga0501080_0048569 3300049742 Bacteria 3950
529 Ga0501080_0073601 3300049742 Bacteria 3178
530 Ga0501081_0023044 3300049743 Bacteria 4170
531 Ga0501083_0001307 3300049744 Bacteria 16868
532 Ga0501035_0000870 3300049822 Bacteria 32141
533 Ga0501035_0010236 3300049822 Bacteria 8701
534 Ga0501035_0023580 3300049822 Bacteria 5645
535 Ga0501035_0079048 3300049822 Bacteria 2905
536 Ga0501035_0082032 3300049822 Bacteria 2846
537 Ga0501035_0097154 3300049822 Bacteria 2587
538 Ga0501044_0002317 3300049823 Bacteria 21701
539 Ga0501044_0121482 3300049823 Bacteria 2612
540 Ga0501045_0023458 3300049824 Bacteria 4423
541 nmdc:mga03n38_29567_c1 3300050490 Bacteria 2295
542 nmdc:mga0yw44_2716_c1 3300050492 Bacteria 7644
543 nmdc:mga06z11_533_c1 3300050494 Bacteria 14010
544 nmdc:mga0rr50_13260_c1 3300050513 Bacteria 5360
545 Ga0495601_0021399 3300053077 Bacteria 3961
546 Ga0495595_0037037 3300053084 Bacteria 2216
547 Ga0495619_0048019 3300053085 Bacteria 2812
548 Ga0500654_023835 3300053099 Bacteria 3848
549 Ga0500560_000574 3300053107 Bacteria 5301
550 Ga0500569_004529 3300053109 Bacteria 2926
551 Ga0500652_001989 3300053131 Bacteria 6153
552 Ga0500561_0014017 3300053137 Bacteria 1750
553 Ga0500573_0003378 3300053140 Bacteria 8258
554 Ga0500573_0027919 3300053140 Bacteria 3247
555 Ga0500573_0066724 3300053140 Bacteria 2057
556 Ga0500633_0020071 3300053160 Bacteria 2010
557 Ga0500645_006993 3300053730 Bacteria 3970
558 Ga0500587_001291 3300053739 Bacteria 3507
559 Ga0501084_0001814 3300054114 Bacteria 17044
560 Ga0501084_0023738 3300054114 Bacteria 5114
561 Ga0501082_0003705 3300060353 Bacteria 13353
562 Ga0501082_0026286 3300060353 Bacteria 5015
563 Ga0466962_0000729 3300061719 Bacteria 14725
564 Ga0466962_0005507 3300061719 Bacteria 6083
565 Ga0530510_0018326 3300061734 Bacteria 4964
566 2554256879 2554235005 Bacteria 6457341
567 2566996609 2565956761 Bacteria 6601618
568 2585299422 2582581312 Bacteria 7308206
569 2585308193 2582581313 Bacteria 10042643
570 2585319183 2582581314 Bacteria 11452267
571 2616696884 2616644814 Bacteria 11555299
572 2616902023 2616644941 Bacteria 8510691
573 2643764855 2643221548 Bacteria 8053412
574 2643902804 2643221578 Bacteria 9213798
575 2643942073 2643221587 Bacteria 7586415
576 2644261698 2643221647 Bacteria 10741251
577 2644389732 2643221670 Bacteria 6497041
578 2644404687 2643221673 Bacteria 9196637
579 2644429156 2643221677 Bacteria 7584031
580 2644439227 2643221678 Bacteria 9540101
581 2644461305 2643221682 Bacteria 6743283
582 2644633414 2643221714 Bacteria 9015452
583 2731908883 2731639228 Bacteria 4187555
584 2738667092 2738541264 Bacteria 5935393
585 2738891347 2738541308 Bacteria 7020677
586 2739145936 2738541356 Bacteria 5935017
587 2739205428 2738543005 Bacteria 5278128
588 2739239485 2738543011 Bacteria 5731169
589 2744955752 2744054611 Bacteria 5611514
590 2768643408 2767802112 Bacteria 6465194
591 2784589632 2784132148 Bacteria 8627943
592 2785341971 2784746763 Bacteria 9783172
593 2785370676 2784746768 Bacteria 10036182
594 2786671859 2786546132 Bacteria 10419719
595 2804845654 2802429296 Bacteria 7227771
596 2808843232 2808606359 Bacteria 9866990
597 2808912821 2808606375 Bacteria 9466072
598 2809233312 2808606448 Bacteria 8656184
599 2811845193 2808606982 Bacteria 7791042
600 2812356816 2811994879 Bacteria 9313447
601 2812479531 2811994917 Bacteria 7761064
602 2819695306 2818991463 Bacteria 7948711
603 2837268963 2837268691 Bacteria 7850704
604 2852640430 2852635781 Bacteria 8251373
605 2861525295 2861520306 Bacteria 8348283
606 2862181688 2862178590 Bacteria 8583590
607 2862286761 2862281513 Bacteria 9621493
608 2862292192 2862290372 Bacteria 7471434
609 2862387717 2862382967 Bacteria 10317375
610 2862514384 2862507626 Bacteria 9425308
611 2862578275 2862574272 Bacteria 10567477
612 2862706074 2862705112 Bacteria 6563286
613 2863411662 2863404153 Bacteria 9672205
614 2867351633 2867346516 Bacteria 7608576
615 2867373126 2867369537 Bacteria 6501581
616 2867434708 2867428634 Bacteria 9590268
617 2867479141 2867475112 Bacteria 6909112
618 2868090604 2868088558 Bacteria 7609351
619 2873154773 2873151551 Bacteria 8625867
620 2875395938 2875391855 Bacteria 7600475
621 2877679912 2877676314 Bacteria 9512378
622 2883826506 2883821847 Bacteria 5121194
623 2889301904 2889300758 Bacteria 5690814
624 2902804395 2902799365 Bacteria 5419524
625 2902812372 2902810491 Bacteria 6794147
626 2904539127 2904535858 Bacteria 6308016
627 2912718558 2912715099 Bacteria 9460473
628 2912730875 2912723979 Bacteria 8557534
629 2912762045 2912757875 Bacteria 7940295
630 2918505726 2918501144 Bacteria 8668083
631 2919475447 2919468124 Bacteria 9133025
632 2922555795 2922554459 Bacteria 6683962
633 2935394871 2935390628 Bacteria 7043367
634 2939747096 2939743619 Bacteria 5762299
635 2946048697 2946045630 Bacteria 8527308
636 2946069056 2946064051 Bacteria 8957905
637 2946077002 2946072368 Bacteria 8999607
638 2947227882 2947224130 Bacteria 9938529
639 2954003035 2954002825 Bacteria 9173742
640 2954384867 2954380949 Bacteria 10050426
641 2954678137 2954673503 Bacteria 9685905
642 2954686022 2954682443 Bacteria 9862841
643 2954695680 2954691527 Bacteria 10720516
644 2954710873 2954701450 Bacteria 10834262
645 2954715096 2954711539 Bacteria 10867210
646 2954725038 2954721474 Bacteria 10456478
647 2954736780 2954731030 Bacteria 10243860
648 2954743971 2954740390 Bacteria 10229294
649 2954762911 2954759201 Bacteria 9358192
650 2966601540 2966598605 Bacteria 7676064
651 2990045365 2990044586 Bacteria 6603797
652 2990062208 2990059506 Bacteria 9321252
653 2990088999 2990088156 Bacteria 6657676
654 2997458159 2997451912 Bacteria 8492419
655 2997606381 2997600082 Bacteria 9896405
656 3006326303 3006321560 Bacteria 8247479
657 3006393468 3006393351 Bacteria 6615579
658 3006427236 3006425503 Bacteria 6491253
659 3006492635 3006486233 Bacteria 8157040
660 3006499674 3006493962 Bacteria 8825450
661 8008490398 8008485437 Bacteria 7198341
662 8008566441 8008558824 Bacteria 10610750
663 8008577886 8008574985 Bacteria 7815457
664 8023626427 8023623736 Bacteria 8593882
665 8025419676 8025413630 Bacteria 7014048
666 8025529700 8025524527 Bacteria 7197316
667 8025534828 8025530807 Bacteria 8495698
668 8033689148 8033684223 Bacteria 6906479
669 8047897058 8047893842 Bacteria 11723082
670 8048134678 8048127548 Bacteria 11053136
671 8048361894 8048356638 Bacteria 11044339
672 8048374042 8048369669 Bacteria 11666822
673 8048384184 8048379754 Bacteria 11877923
674 8048410737 8048406513 Bacteria 8936924
675 8054160732 8054160619 Bacteria 7783213
676 8056448880 8056447290 Bacteria 7680491
677 8056667950 8056667051 Bacteria 6953971
678 8056833875 8056829672 Bacteria 9045328
679 8057574026 8057568493 Bacteria 7221719
680 Ga0495660_0027374
681 JGI25153J46596_10015223
682 Ga0006562J51391_1080308
683 Ga0006562J51391_1111409
684 Ga0055540_1000003
685 Ga0070658_10011130
686 Ga0070682_100033676
687 Ga0068868_100163993
688 Ga0070667_100000854
689 Ga0070709_10001783
690 Ga0070709_10002508
691 Ga0070709_10005879
692 Ga0070709_10046532
693 Ga0070714_100001268
694 Ga0070714_100005582
695 Ga0070714_100006851
696 Ga0070714_100033643
697 Ga0070714_100039200
698 Ga0070713_100000369
699 Ga0070713_100022747
700 Ga0070713_100023714
701 Ga0070713_100105556
702 Ga0070710_10000264
703 Ga0070710_10000267
704 Ga0070710_10004252
705 Ga0070710_10020029
706 Ga0070711_100001708
707 Ga0070711_100038602
708 Ga0070711_100040425
709 Ga0070705_100011928
710 Ga0070708_100005904
711 Ga0070663_100086012
712 Ga0070706_100020244
713 Ga0070706_100028237
714 Ga0070706_100043623
715 Ga0070707_100015181
716 Ga0070698_100000073
717 Ga0070698_100010204
718 Ga0070698_100047176
719 Ga0070698_100157208
720 Ga0070679_100146724
721 Ga0070695_100054913
722 Ga0070665_100045935
723 Ga0070704_100114846
724 Ga0068855_100005770
725 Ga0068854_100002127
726 Ga0068856_100007423
727 Ga0068856_100014411
728 Ga0068852_100004180
729 Ga0068852_100060171
730 Ga0068863_100128334
731 Ga0081540_1001294
732 Ga0070717_10015347
733 Ga0070717_10024758
734 Ga0070717_10118691
735 Ga0075364_10080383
736 Ga0075364_10090337
737 Ga0070716_100001114
738 Ga0070716_100006134
739 Ga0070716_100036106
740 Ga0070712_100025772
741 Ga0070712_100027524
742 Ga0075433_10024593
743 Ga0075434_100025331
744 Ga0105240_10015644
745 Ga0105245_10028105
746 Ga0105245_10160471
747 Ga0105243_10000636
748 Ga0105248_10114196
749 Ga0105237_10077757
750 Ga0105238_10000200
751 Ga0157370_10024989
752 Ga0157370_10083600
753 Ga0157369_10066681
754 Ga0157375_10099523
755 Ga0182008_10002958
756 Ga0182006_1019582
757 Ga0182007_10007455
758 Ga0183367_1002
759 Ga0213873_10000037
760 Ga0213875_10000336
761 Ga0213875_10005392
762 Ga0213875_10007298
763 Ga0213875_10024638
764 Ga0213875_10028186
765 Ga0209758_1007953
766 Ga0207426_1003792
767 Ga0209051_1000011
768 Ga0209051_1007434
769 Ga0207692_10000049
770 Ga0207692_10000079
771 Ga0207692_10016436
772 Ga0207692_10025779
773 Ga0207647_10000384
774 Ga0207647_10010815
775 Ga0207699_10000297
776 Ga0207699_10001937
777 Ga0207699_10006555
778 Ga0207699_10029862
779 Ga0207699_10077192
780 Ga0207705_10004355
781 Ga0207684_10051591
782 Ga0207684_10077277
783 Ga0207684_10078134
784 Ga0207654_10002806
785 Ga0207695_10000449
786 Ga0207671_10000052
787 Ga0207693_10003378
788 Ga0207693_10005398
789 Ga0207693_10009896
790 Ga0207663_10001646
791 Ga0207663_10009920
792 Ga0207663_10026757
793 Ga0207646_10124800
794 Ga0207694_10000079
795 Ga0207687_10016217
796 Ga0207700_10000270
797 Ga0207700_10002724
798 Ga0207700_10020533
799 Ga0207664_10002335
800 Ga0207664_10005266
801 Ga0207664_10032506
802 Ga0207664_10047933
803 Ga0207664_10063345
804 Ga0207709_10057891
805 Ga0207665_10000611
806 Ga0207665_10000635
807 Ga0207665_10001386
808 Ga0207665_10006669
809 Ga0207665_10032818
810 Ga0207667_10012052
811 Ga0207640_10011379
812 Ga0207658_10000449
813 Ga0207678_10041252
814 Ga0207683_10178799
815 Ga0207698_10008404
816 Ga0207698_10075408
817 Ga0265337_1000389
818 Ga0265326_10000357
819 Ga0265319_1001349
820 Ga0265334_10011557
821 Ga0265323_10006314
822 Ga0265336_10008967
823 Ga0307517_10004659
824 Ga0307517_10005623
825 Ga0307515_10001177
826 Ga0307515_10034411
827 Ga0307515_10096391
828 Ga0307515_10119339
829 Ga0265338_10001255
830 Ga0265338_10015415
831 Ga0265338_10016987
832 Ga0265324_10000773
833 Ga0307511_10001462
834 Ga0307512_10030070
835 Ga0307512_10041139
836 Ga0307512_10088375
837 Ga0314311_1057543
838 Ga0316180_1129606
839 Ga0265332_10002502
840 Ga0265320_10000980
841 Ga0265340_10001509
842 Ga0265339_10014930
843 Ga0265327_10000630
844 Ga0265316_10017659
845 Ga0307513_10054950
846 Ga0307509_10065669
847 Ga0307509_10107813
848 Ga0265313_10006874
849 Ga0307508_10001775
850 Ga0307508_10020650
851 Ga0307508_10037943
852 Ga0307508_10055687
853 Ga0307508_10095846
854 Ga0307514_10014628
855 Ga0265314_10020636
856 Ga0265342_10001351
857 Ga0316576_10002126
858 Ga0307516_10007060
859 Ga0307516_10023113
860 Ga0307516_10039708
861 Ga0307518_10076954
862 Ga0307409_100200205
863 Ga0307507_10009696
864 Ga0307510_10017067
865 Ga0307510_10052520
866 Ga0373926_0004731
867 Ga0373934_0006443
868 Ga0373934_0008791
869 Ga0373934_0010978
870 Ga0373932_0006697
871 Ga0373953_0002988
872 Ga0373953_0005734
873 Ga0373954_0026691
874 Ga0373956_0015830
875 Ga0373956_0021564
876 Ga0373957_0024605
877 Ga0373960_0011373
878 Ga0373955_0013056
879 Ga0373924_0006312
880 Ga0373935_0015322
881 Ga0373935_0030306
882 Ga0373933_0030053
883 Ga0373933_0092342
884 Ga0373947_0000009
885 Ga0373937_0002378
886 Ga0373937_0055470
887 Ga0373937_0103019
888 Ga0373925_0000006
889 Ga0395898_0006692
890 Ga0395898_0113134
891 Ga0395905_0063002
892 Ga0436364_0516238
893 Ga0436364_0696641
894 Ga0436364_0735260
895 Ga0436364_0834160
896 Ga0436364_1218450
897 Ga0395901_0018201
898 Ga0395901_0082838
899 Ga0436363_0807244
900 Ga0439436_0000571
901 Ga0451837_0008945
902 Ga0451853_0219758
903 Ga0451853_1344316
904 Ga0451853_3356587
905 Ga0439457_002109
906 Ga0439457_003796
907 Ga0450894_000142
908 Ga0450903_000121
909 Ga0450906_001111
910 Ga0466969_0007793
911 Ga0466969_0015955
912 Ga0466969_0075914
913 Ga0466972_0009172
914 Ga0466972_0009639
915 Ga0466972_0012839
916 Ga0466972_0023794
917 Ga0466965_0001784
918 Ga0466965_0006622
919 Ga0466965_0016079
920 Ga0466965_0072116
921 Ga0466966_0000436
922 Ga0466966_0002655
923 Ga0466966_0015471
924 Ga0466966_0075259
925 Ga0466961_0009102
926 Ga0466961_0015853
927 Ga0466961_0021961
928 Ga0466961_0047126
929 Ga0466963_0000236
930 Ga0466963_0000656
931 Ga0466963_0001704
932 Ga0466963_0017570
933 Ga0466964_0002609
934 Ga0466971_0000161
935 Ga0466971_0008971
936 Ga0466968_0000188
937 Ga0466970_0000292
938 Ga0466970_0003281
939 Ga0466970_0011006
940 Ga0466957_0001084
941 Ga0466957_0001267
942 Ga0466957_0002078
943 Ga0466957_0106015
944 Ga0466960_0001597
945 Ga0466960_0005195
946 Ga0466959_0001597
947 Ga0466959_0004929
948 Ga0466959_0021088
949 Ga0466959_0051396
950 Ga0466967_0000825
951 Ga0466967_0055208
952 Ga0466967_0112180
953 Ga0466967_0171196
954 Ga0495617_019029
955 Ga0495592_0005902
956 Ga0495592_0014811
957 Ga0495592_0022587
958 Ga0495592_0074802
959 Ga0495603_0005893
960 Ga0495603_0007219
961 Ga0495629_0004519
962 Ga0495629_0007791
963 Ga0495629_0008011
964 Ga0495629_0011231
965 Ga0495629_0012446
966 Ga0495629_0040099
967 Ga0495629_0043483
968 Ga0495638_0027868
969 Ga0495638_0059845
970 Ga0495651_0002505
971 Ga0495651_0013713
972 Ga0495651_0024478
973 Ga0495651_0024687
974 Ga0495653_0024635
975 Ga0495653_0029711
976 Ga0495653_0029758
977 Ga0495653_0091033
978 Ga0495582_0063541
979 Ga0495605_0001918
980 Ga0495639_0004613
981 Ga0495662_0003988
982 Ga0495662_0007534
983 Ga0495662_0024665
984 Ga0495664_0092645
985 Ga0495585_0022570
986 Ga0495585_0048245
987 Ga0495594_0000809
988 Ga0495594_0063241
989 Ga0495606_0002492
990 Ga0495608_0017646
991 Ga0495608_0025150
992 Ga0495618_0008183
993 Ga0495618_0068564
994 Ga0495628_0032325
995 Ga0495630_0014794
996 Ga0495630_0067670
997 Ga0495637_0044282
998 Ga0495643_0002976
999 Ga0495652_0018209
1000 Ga0495652_0024841
1001 Ga0495652_0024842
1002 Ga0495652_0042689
1003 Ga0495652_0130461
1004 Ga0495652_0137011
1005 Ga0495665_0008914
1006 Ga0495587_0012600
1007 Ga0495587_0014853
1008 Ga0495587_0048492
1009 Ga0495609_0004676
1010 Ga0495645_0059445
1011 Ga0495645_0095418
1012 Ga0495622_0002593
1013 Ga0495667_0019017
1014 Ga0495667_0032695
1015 Ga0495668_0000123
1016 Ga0495668_0033195
1017 Ga0495634_0006120
1018 Ga0495634_0013475
1019 Ga0495634_0057651
1020 Ga0495611_0036941
1021 Ga0495625_0011790
1022 Ga0495635_0002007
1023 Ga0495635_0002565
1024 Ga0495661_0011932
1025 Ga0495588_0007660
1026 Ga0495588_0020750
1027 Ga0495588_0039330
1028 Ga0495657_0004839
1029 Ga0495657_0007083
1030 Ga0495657_0017555
1031 Ga0495657_0070319
1032 Ga0495623_0028339
1033 Ga0495623_0033441
1034 Ga0495646_0008137
1035 Ga0495646_0017778
1036 Ga0495613_0001664
1037 Ga0495613_0003471
1038 Ga0495613_0030896
1039 Ga0495624_0010341
1040 Ga0495670_0016567
1041 Ga0495671_0022034
1042 Ga0495589_0008453
1043 Ga0495600_0011220
1044 Ga0495600_0063220
1045 Ga0495581_0068334
1046 Ga0495581_0100408
1047 Ga0495604_0002351
1048 Ga0495604_0003419
1049 Ga0495604_0013209
1050 Ga0495604_0013954
1051 Ga0495604_0047727
1052 Ga0495636_0004713
1053 Ga0495636_0007267
1054 Ga0495674_0068291
1055 Ga0495676_0001590
1056 Ga0495676_0002415
1057 Ga0495676_0032006
1058 Ga0495680_0003800
1059 Ga0495680_0022554
1060 Ga0495680_0057872
1061 Ga0495687_001147
1062 Ga0495687_005672
1063 Ga0495687_012402
1064 Ga0495675_0016789
1065 Ga0495675_0049660
1066 Ga0495675_0051595
1067 Ga0495675_0090150
1068 Ga0495685_001275
1069 Ga0495685_002570
1070 Ga0495685_005265
1071 Ga0495685_007555
1072 Ga0495681_0002939
1073 Ga0495681_0003151
1074 Ga0495684_0056651
1075 Ga0495686_0024050
1076 Ga0495593_0006509
1077 Ga0495602_0053073
1078 Ga0495602_0071510
1079 Ga0495614_0000229
1080 Ga0495614_0006382
1081 Ga0495614_0025543
1082 Ga0496100_0000067
1083 Ga0496100_0021707
1084 Ga0496101_0000099
1085 Ga0496102_0005671
1086 Ga0496102_0168601
1087 Ga0496103_0000116
1088 Ga0496103_0046643
1089 Ga0496104_0000724
1090 Ga0496104_0006327
1091 Ga0496105_0000853
1092 Ga0496105_0033049
1093 Ga0496105_0044487
1094 Ga0496106_0001741
1095 Ga0496107_0000254
1096 Ga0496108_0006695
1097 Ga0496108_0027291
1098 Ga0496108_0037301
1099 Ga0496108_0135791
1100 Ga0496109_0000159
1101 Ga0496109_0010817
1102 Ga0496109_0017554
1103 Ga0496109_0081405
1104 Ga0496110_0006109
1105 Ga0496110_0054431
1106 Ga0496111_0009376
1107 Ga0496111_0029613
1108 Ga0496112_0002048
1109 Ga0496113_0000928
1110 Ga0496114_0000116
1111 Ga0496114_0099655
1112 Ga0496117_0019421
1113 Ga0496118_0049614
1114 Ga0496119_0009307
1115 Ga0496119_0035544
1116 Ga0496120_0002960
1117 Ga0496121_0000016
1118 Ga0496122_0000284
1119 Ga0496124_0000015
1120 Ga0496125_0000021
1121 Ga0496125_0053379
1122 Ga0496126_0000015
1123 Ga0496126_0017245
1124 Ga0501031_0000144
1125 Ga0501031_0001068
1126 Ga0501031_0021857
1127 Ga0501031_0051356
1128 Ga0501032_0000686
1129 Ga0501032_0014320
1130 Ga0501032_0043343
1131 Ga0501033_0015747
1132 Ga0501033_0021996
1133 Ga0501033_0027832
1134 Ga0501033_0028919
1135 Ga0501033_0057624
1136 Ga0501034_0000987
1137 Ga0501034_0022128
1138 Ga0501034_0030062
1139 Ga0501034_0039050
1140 Ga0501034_0051717
1141 Ga0501034_0140139
1142 Ga0501036_0001560
1143 Ga0501036_0010970
1144 Ga0501036_0021180
1145 Ga0501036_0027940
1146 Ga0501037_0000465
1147 Ga0501037_0009904
1148 Ga0501037_0031458
1149 Ga0501038_0001242
1150 Ga0501038_0005265
1151 Ga0501038_0006036
1152 Ga0501038_0025253
1153 Ga0501038_0025467
1154 Ga0501038_0043058
1155 Ga0501038_0072371
1156 Ga0501039_0002923
1157 Ga0501039_0018461
1158 Ga0501039_0019816
1159 Ga0501039_0023283
1160 Ga0501039_0037513
1161 Ga0501040_0070721
1162 Ga0501041_0000883
1163 Ga0501041_0008355
1164 Ga0501042_0009170
1165 Ga0501042_0019320
1166 Ga0501043_0000867
1167 Ga0501043_0005384
1168 Ga0501043_0013915
1169 Ga0501043_0020027
1170 Ga0501043_0028015
1171 Ga0501043_0101149
1172 Ga0501046_0003795
1173 Ga0501046_0005700
1174 Ga0501046_0013539
1175 Ga0501047_0000112
1176 Ga0501047_0000216
1177 Ga0501047_0000544
1178 Ga0501047_0024159
1179 Ga0501047_0032135
1180 Ga0501047_0083237
1181 Ga0501047_0118365
1182 Ga0501048_0005351
1183 Ga0501048_0017048
1184 Ga0501048_0028025
1185 Ga0501048_0044554
1186 Ga0501067_0002500
1187 Ga0501067_0016066
1188 Ga0501067_0020615
1189 Ga0501069_0000515
1190 Ga0501069_0005601
1191 Ga0501070_0007603
1192 Ga0501070_0019161
1193 Ga0501070_0021228
1194 Ga0501071_0018444
1195 Ga0501072_0002534
1196 Ga0501072_0005287
1197 Ga0501073_0006527
1198 Ga0501074_0007950
1199 Ga0501074_0008553
1200 Ga0501075_0030006
1201 Ga0501076_0050891
1202 Ga0501076_0059410
1203 Ga0501077_0040580
1204 Ga0501079_0028641
1205 Ga0501079_0116551
1206 Ga0501080_0013818
1207 Ga0501080_0048569
1208 Ga0501080_0073601
1209 Ga0501081_0023044
1210 Ga0501083_0001307
1211 Ga0501035_0000870
1212 Ga0501035_0010236
1213 Ga0501035_0023580
1214 Ga0501035_0079048
1215 Ga0501035_0082032
1216 Ga0501035_0097154
1217 Ga0501044_0002317
1218 Ga0501044_0121482
1219 Ga0501045_0023458
1220 nmdc:mga03n38_29567_c1
1221 nmdc:mga0yw44_2716_c1
1222 nmdc:mga06z11_533_c1
1223 nmdc:mga0rr50_13260_c1
1224 Ga0495601_0021399
1225 Ga0495595_0037037
1226 Ga0495619_0048019
1227 Ga0500654_023835
1228 Ga0500560_000574
1229 Ga0500569_004529
1230 Ga0500652_001989
1231 Ga0500561_0014017
1232 Ga0500573_0003378
1233 Ga0500573_0027919
1234 Ga0500573_0066724
1235 Ga0500633_0020071
1236 Ga0500645_006993
1237 Ga0500587_001291
1238 Ga0501084_0001814
1239 Ga0501084_0023738
1240 Ga0501082_0003705
1241 Ga0501082_0026286
1242 Ga0466962_0000729
1243 Ga0466962_0005507
1244 Ga0530510_0018326
1245 2554256879
1246 2566996609
1247 2585299422
1248 2585308193
1249 2585319183
1250 2616696884
1251 2616902023
1252 2643764855
1253 2643902804
1254 2643942073
1255 2644261698
1256 2644389732
1257 2644404687
1258 2644429156
1259 2644439227
1260 2644461305
1261 2644633414
1262 2731908883
1263 2738667092
1264 2738891347
1265 2739145936
1266 2739205428
1267 2739239485
1268 2744955752
1269 2768643408
1270 2784589632
1271 2785341971
1272 2785370676
1273 2786671859
1274 2804845654
1275 2808843232
1276 2808912821
1277 2809233312
1278 2811845193
1279 2812356816
1280 2812479531
1281 2819695306
1282 2837268963
1283 2852640430
1284 2861525295
1285 2862181688
1286 2862286761
1287 2862292192
1288 2862387717
1289 2862514384
1290 2862578275
1291 2862706074
1292 2863411662
1293 2867351633
1294 2867373126
1295 2867434708
1296 2867479141
1297 2868090604
1298 2873154773
1299 2875395938
1300 2877679912
1301 2883826506
1302 2889301904
1303 2902804395
1304 2902812372
1305 2904539127
1306 2912718558
1307 2912730875
1308 2912762045
1309 2918505726
1310 2919475447
1311 2922555795
1312 2935394871
1313 2939747096
1314 2946048697
1315 2946069056
1316 2946077002
1317 2947227882
1318 2954003035
1319 2954384867
1320 2954678137
1321 2954686022
1322 2954695680
1323 2954710873
1324 2954715096
1325 2954725038
1326 2954736780
1327 2954743971
1328 2954762911
1329 2966601540
1330 2990045365
1331 2990062208
1332 2990088999
1333 2997458159
1334 2997606381
1335 3006326303
1336 3006393468
1337 3006427236
1338 3006492635
1339 3006499674
1340 8008490398
1341 8008566441
1342 8008577886
1343 8023626427
1344 8025419676
1345 8025529700
1346 8025534828
1347 8033689148
1348 8047897058
1349 8048134678
1350 8048361894
1351 8048374042
1352 8048384184
1353 8048410737
1354 8054160732
1355 8056448880
1356 8056667950
1357 8056833875
1358 8057574026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

180

484

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9h-assembly1.cif.gz_N mycobacterial respiratory complex i, fully-inserted quinone 0.9433 22 536
8e9h-assembly1.cif.gz_N mycobacterial respiratory complex i, fully-inserted quinone 0.9344 22 536
3rko-assembly2.cif.gz_D crystal structure of the membrane domain of respiratory complex i from e. coli at 3.0 angstrom resolution 0.9015 27 528
4he8-assembly2.cif.gz_I crystal structure of the membrane domain of respiratory complex i from thermus thermophilus 0.8987 32 533
7nyh-assembly1.cif.gz_N respiratory complex i from escherichia coli - focused refinement of membrane arm 0.8956 27 531
ID Description Score Start End Superfamily
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7838 28 163 1.10.287.3510
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6016 28 163 1.10.287.3510
af_Q19663_438_713_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4082 196 375 1.20.58.60
1dovA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3192 274 464 1.20.120.230
1dovA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3112 274 464 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A531KCG8-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9764 325 464 GO:0012505
GO:0016020
AF-A0A351XEN3-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9662 315 532 GO:0012505
GO:0016020
AF-A0A3D3CLX8-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9599 315 525 GO:0012505
GO:0016020
AF-A0A661DNT4-F1-model_v4 NADH:ubiquinone oxidoreductase subunit N 0.9519 283 533 GO:0012505
GO:0016020
AF-A0A3D3CLX8-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter transmembrane domain-containing protein 0.9465 315 525 GO:0012505
GO:0016020

Map