F474710

General Info

Members Datasets Scaffolds Average Seq Length
679 262 1358 86

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_101223231|Ga0068871_1012232312
Length 94
Sequence MSDSPSVVTADELSQLQKKFSEIKHSINNALAVMMALSEMSQRRPDYAEKLATTVLAKAPQIVSSLQEFTDALNSKAASAKPEGMPGSDPASAA

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
93 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
94 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.04
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_101223231 3300006358 Bacteria 705
2 CNXas_1012336 3300000545 Bacteria 608
3 JGI25406J46586_10000005 3300003203 Bacteria 118289
4 Ga0065704_10020889 3300005289 Bacteria 2082
5 Ga0065704_10023518 3300005289 Bacteria 1371
6 Ga0065712_10037794 3300005290 Bacteria 1264
7 Ga0065712_10130130 3300005290 Bacteria 1560
8 Ga0065715_10175111 3300005293 Bacteria 1517
9 Ga0065715_10247393 3300005293 Bacteria 1179
10 Ga0065715_10432750 3300005293 Bacteria 840
11 Ga0065715_10859038 3300005293 Unclassified 589
12 Ga0065715_10948180 3300005293 Bacteria 560
13 Ga0065707_10023810 3300005295 Bacteria 2724
14 Ga0065707_10205528 3300005295 Bacteria 1290
15 Ga0070676_10093919 3300005328 Bacteria 1842
16 Ga0070676_10115620 3300005328 Bacteria 1676
17 Ga0070676_10243622 3300005328 Bacteria 1197
18 Ga0070676_10695786 3300005328 Bacteria 742
19 Ga0070676_10925342 3300005328 Bacteria 651
20 Ga0070683_100575441 3300005329 Bacteria 1077
21 Ga0070683_100823850 3300005329 Bacteria 890
22 Ga0070690_100081666 3300005330 Bacteria 2115
23 Ga0070690_100227372 3300005330 Bacteria 1310
24 Ga0070690_100252100 3300005330 Bacteria 1249
25 Ga0070690_100320279 3300005330 Bacteria 1117
26 Ga0070690_100852741 3300005330 Bacteria 710
27 Ga0070690_101081644 3300005330 Bacteria 635
28 Ga0070690_101369142 3300005330 Unclassified 569
29 Ga0070690_101389791 3300005330 Unclassified 565
30 Ga0070670_100008014 3300005331 Bacteria 8985
31 Ga0070670_100075045 3300005331 Bacteria 2905
32 Ga0070670_100608173 3300005331 Unclassified 978
33 Ga0070670_100988116 3300005331 Unclassified 765
34 Ga0070670_101206282 3300005331 Bacteria 692
35 Ga0070670_101770705 3300005331 Bacteria 569
36 Ga0070670_102216847 3300005331 Bacteria 506
37 Ga0070677_10144375 3300005333 Bacteria 1101
38 Ga0070677_10299465 3300005333 Bacteria 817
39 Ga0070677_10320450 3300005333 Bacteria 794
40 Ga0068869_100609609 3300005334 Bacteria 923
41 Ga0068869_101035886 3300005334 Bacteria 716
42 Ga0070666_10014224 3300005335 Bacteria 5065
43 Ga0070666_10014905 3300005335 Bacteria 4951
44 Ga0070666_10019653 3300005335 Bacteria 4365
45 Ga0070666_10045852 3300005335 Unclassified 2930
46 Ga0070666_10841999 3300005335 Bacteria 677
47 Ga0070680_100430216 3300005336 Bacteria 1126
48 Ga0068868_100076098 3300005338 Bacteria 2683
49 Ga0068868_100138525 3300005338 Bacteria 1996
50 Ga0068868_100780592 3300005338 Bacteria 860
51 Ga0068868_101363156 3300005338 Bacteria 660
52 Ga0068868_101870049 3300005338 Bacteria 568
53 Ga0070660_100259145 3300005339 Bacteria 1420
54 Ga0070689_100155191 3300005340 Bacteria 1848
55 Ga0070689_100167355 3300005340 Bacteria 1780
56 Ga0070689_100534021 3300005340 Bacteria 1009
57 Ga0070689_101815897 3300005340 Unclassified 556
58 Ga0070687_100456611 3300005343 Bacteria 851
59 Ga0070687_100599874 3300005343 Bacteria 756
60 Ga0070661_101029838 3300005344 Bacteria 684
61 Ga0070668_100155495 3300005347 Bacteria 1852
62 Ga0070668_100234098 3300005347 Bacteria 1519
63 Ga0070668_100287734 3300005347 Bacteria 1374
64 Ga0070668_100417965 3300005347 Bacteria 1148
65 Ga0070669_100033594 3300005353 Bacteria 3711
66 Ga0070669_100048389 3300005353 Bacteria 3103
67 Ga0070669_100193503 3300005353 Bacteria 1596
68 Ga0070669_100501819 3300005353 Bacteria 1006
69 Ga0070669_101275055 3300005353 Bacteria 636
70 Ga0070669_101916519 3300005353 Bacteria 518
71 Ga0070675_100044438 3300005354 Bacteria 3633
72 Ga0070675_100046630 3300005354 Bacteria 3549
73 Ga0070675_100214778 3300005354 Bacteria 1673
74 Ga0070675_100259753 3300005354 Bacteria 1522
75 Ga0070675_100265702 3300005354 Bacteria 1504
76 Ga0070675_100621261 3300005354 Bacteria 981
77 Ga0070675_101202937 3300005354 Bacteria 698
78 Ga0070671_100000603 3300005355 Bacteria 25668
79 Ga0070671_100019618 3300005355 Bacteria 5504
80 Ga0070671_100440528 3300005355 Bacteria 1117
81 Ga0070671_101073697 3300005355 Bacteria 707
82 Ga0070671_101078321 3300005355 Bacteria 705
83 Ga0070671_101530014 3300005355 Bacteria 591
84 Ga0070671_101755830 3300005355 Unclassified 551
85 Ga0070671_101769758 3300005355 Bacteria 549
86 Ga0070674_100053556 3300005356 Bacteria 2787
87 Ga0070674_100174525 3300005356 Bacteria 1641
88 Ga0070674_100311992 3300005356 Bacteria 1258
89 Ga0070674_100315936 3300005356 Bacteria 1251
90 Ga0070674_100676977 3300005356 Bacteria 879
91 Ga0070674_101218299 3300005356 Unclassified 669
92 Ga0070673_100061698 3300005364 Unclassified 2975
93 Ga0070673_100202361 3300005364 Bacteria 1710
94 Ga0070673_100257744 3300005364 Bacteria 1522
95 Ga0070673_100387820 3300005364 Bacteria 1247
96 Ga0070673_100640964 3300005364 Unclassified 972
97 Ga0070673_100758982 3300005364 Bacteria 893
98 Ga0070673_101355901 3300005364 Unclassified 669
99 Ga0070673_101960680 3300005364 Bacteria 556
100 Ga0070688_100008152 3300005365 Bacteria 5676
101 Ga0070688_100632949 3300005365 Bacteria 822
102 Ga0070688_100678966 3300005365 Bacteria 796
103 Ga0070688_101010622 3300005365 Bacteria 661
104 Ga0070659_100348531 3300005366 Bacteria 1242
105 Ga0070659_100567301 3300005366 Bacteria 973
106 Ga0070667_100013547 3300005367 Bacteria 6736
107 Ga0070667_100089421 3300005367 Bacteria 2645
108 Ga0070667_100219628 3300005367 Bacteria 1691
109 Ga0070667_100423853 3300005367 Bacteria 1213
110 Ga0070667_100938946 3300005367 Bacteria 806
111 Ga0070703_10157830 3300005406 Bacteria 858
112 Ga0070703_10465741 3300005406 Unclassified 562
113 Ga0070709_10027472 3300005434 Bacteria 3384
114 Ga0070714_100633467 3300005435 Bacteria 1028
115 Ga0070714_100951761 3300005435 Bacteria 835
116 Ga0070713_100166612 3300005436 Bacteria 1971
117 Ga0070713_100438412 3300005436 Bacteria 1225
118 Ga0070710_10265401 3300005437 Bacteria 1108
119 Ga0070711_100064196 3300005439 Bacteria 2565
120 Ga0070711_100131544 3300005439 Bacteria 1864
121 Ga0070705_100015926 3300005440 Bacteria 3896
122 Ga0070705_100101047 3300005440 Bacteria 1821
123 Ga0070705_100132751 3300005440 Bacteria 1627
124 Ga0070700_100734882 3300005441 Unclassified 788
125 Ga0070700_100750712 3300005441 Bacteria 781
126 Ga0070694_100266852 3300005444 Bacteria 1300
127 Ga0070708_100704199 3300005445 Bacteria 950
128 Ga0070708_100821434 3300005445 Bacteria 874
129 Ga0070708_100854412 3300005445 Bacteria 855
130 Ga0070708_101938064 3300005445 Bacteria 546
131 Ga0070708_102019998 3300005445 Bacteria 534
132 Ga0070663_100502406 3300005455 Bacteria 1007
133 Ga0070678_100056369 3300005456 Bacteria 2874
134 Ga0070678_100121608 3300005456 Bacteria 2059
135 Ga0070678_100226156 3300005456 Bacteria 1557
136 Ga0070678_100616070 3300005456 Bacteria 970
137 Ga0070678_102288850 3300005456 Bacteria 513
138 Ga0070662_100468310 3300005457 Bacteria 1048
139 Ga0068867_100095686 3300005459 Bacteria 2260
140 Ga0068867_100124107 3300005459 Bacteria 1999
141 Ga0070685_10433645 3300005466 Bacteria 917
142 Ga0070706_100001327 3300005467 Bacteria 26298
143 Ga0070706_100042632 3300005467 Bacteria 4193
144 Ga0070706_100068781 3300005467 Bacteria 3275
145 Ga0070706_100119000 3300005467 Bacteria 2461
146 Ga0070706_100234722 3300005467 Bacteria 1712
147 Ga0070706_100291452 3300005467 Bacteria 1523
148 Ga0070706_100613562 3300005467 Bacteria 1010
149 Ga0070706_100699496 3300005467 Bacteria 940
150 Ga0070707_100021759 3300005468 Bacteria 6061
151 Ga0070707_100089594 3300005468 Bacteria 2977
152 Ga0070707_100104811 3300005468 Bacteria 2742
153 Ga0070707_100146365 3300005468 Bacteria 2300
154 Ga0070707_100403270 3300005468 Bacteria 1327
155 Ga0070707_100455542 3300005468 Bacteria 1240
156 Ga0070707_100620843 3300005468 Bacteria 1043
157 Ga0070707_100625980 3300005468 Bacteria 1039
158 Ga0070707_101208445 3300005468 Bacteria 722
159 Ga0070707_101875238 3300005468 Bacteria 567
160 Ga0070707_101916994 3300005468 Unclassified 560
161 Ga0070698_100013758 3300005471 Bacteria 8565
162 Ga0070698_100027427 3300005471 Bacteria 5923
163 Ga0070698_100141008 3300005471 Bacteria 2361
164 Ga0070699_100503867 3300005518 Bacteria 1100
165 Ga0070699_100720908 3300005518 Bacteria 911
166 Ga0070699_100838669 3300005518 Bacteria 841
167 Ga0070697_100015613 3300005536 Bacteria 5963
168 Ga0070697_100020289 3300005536 Bacteria 5256
169 Ga0070697_100159752 3300005536 Bacteria 1904
170 Ga0070697_100186451 3300005536 Bacteria 1759
171 Ga0070697_100306426 3300005536 Bacteria 1366
172 Ga0070697_100676868 3300005536 Bacteria 909
173 Ga0070697_100717158 3300005536 Unclassified 883
174 Ga0070697_101039427 3300005536 Bacteria 728
175 Ga0070697_101319755 3300005536 Unclassified 644
176 Ga0068853_101029128 3300005539 Bacteria 793
177 Ga0070672_100250244 3300005543 Bacteria 1492
178 Ga0070672_100278473 3300005543 Unclassified 1413
179 Ga0070672_100433782 3300005543 Unclassified 1130
180 Ga0070672_100728304 3300005543 Bacteria 869
181 Ga0070672_101664264 3300005543 Bacteria 573
182 Ga0070672_102080571 3300005543 Unclassified 511
183 Ga0070695_100027928 3300005545 Bacteria 3499
184 Ga0070695_100222791 3300005545 Bacteria 1360
185 Ga0070696_100278921 3300005546 Bacteria 1273
186 Ga0070696_100625900 3300005546 Bacteria 870
187 Ga0070693_100895568 3300005547 Bacteria 665
188 Ga0070665_100169288 3300005548 Bacteria 2186
189 Ga0070665_100402705 3300005548 Bacteria 1376
190 Ga0070665_100448609 3300005548 Bacteria 1299
191 Ga0070665_100557649 3300005548 Bacteria 1158
192 Ga0070704_100525705 3300005549 Bacteria 1030
193 Ga0070704_100744721 3300005549 Bacteria 872
194 Ga0070664_100181841 3300005564 Bacteria 1869
195 Ga0070664_100189753 3300005564 Bacteria 1831
196 Ga0068856_100183383 3300005614 Bacteria 2107
197 Ga0068856_100309588 3300005614 Bacteria 1597
198 Ga0068856_101463980 3300005614 Bacteria 697
199 Ga0070702_100219426 3300005615 Bacteria 1270
200 Ga0070702_101546649 3300005615 Bacteria 547
201 Ga0068852_101396804 3300005616 Bacteria 722
202 Ga0068866_10131556 3300005718 Bacteria 1424
203 Ga0068866_10242658 3300005718 Bacteria 1098
204 Ga0068866_10606104 3300005718 Bacteria 740
205 Ga0068861_101847495 3300005719 Bacteria 600
206 Ga0068851_10302112 3300005834 Bacteria 921
207 Ga0068870_10679513 3300005840 Bacteria 708
208 Ga0068860_100256390 3300005843 Bacteria 1704
209 Ga0068860_100540169 3300005843 Bacteria 1167
210 Ga0081540_1343391 3300005983 Unclassified 511
211 Ga0081539_10000026 3300005985 Bacteria 330830
212 Ga0081539_10001307 3300005985 Bacteria 43573
213 Ga0081539_10159775 3300005985 Bacteria 1075
214 Ga0070717_10000233 3300006028 Bacteria 38420
215 Ga0070717_10022647 3300006028 Bacteria 4968
216 Ga0070717_10230751 3300006028 Bacteria 1630
217 Ga0070717_11923153 3300006028 Unclassified 534
218 Ga0070716_100280342 3300006173 Bacteria 1150
219 Ga0070716_100661141 3300006173 Bacteria 794
220 Ga0070716_101154624 3300006173 Bacteria 620
221 Ga0070712_100206253 3300006175 Bacteria 1547
222 Ga0070712_100502984 3300006175 Bacteria 1016
223 Ga0070712_100507052 3300006175 Bacteria 1012
224 Ga0070712_100568765 3300006175 Bacteria 957
225 Ga0070712_100951720 3300006175 Bacteria 742
226 Ga0070712_101824218 3300006175 Unclassified 532
227 Ga0097621_100093835 3300006237 Bacteria 2515
228 Ga0097621_100227493 3300006237 Bacteria 1627
229 Ga0097621_100568858 3300006237 Bacteria 1033
230 Ga0097621_100808278 3300006237 Bacteria 869
231 Ga0097621_100834977 3300006237 Bacteria 855
232 Ga0097621_101209278 3300006237 Bacteria 712
233 Ga0097621_101838274 3300006237 Unclassified 578
234 Ga0068871_100035798 3300006358 Bacteria 3947
235 Ga0068871_100254567 3300006358 Bacteria 1530
236 Ga0068871_100702801 3300006358 Unclassified 926
237 Ga0075433_10339804 3300006852 Bacteria 1327
238 Ga0075433_10456748 3300006852 Bacteria 1126
239 Ga0075434_100126547 3300006871 Bacteria 2572
240 Ga0075434_100277001 3300006871 Bacteria 1697
241 Ga0075434_100430964 3300006871 Bacteria 1340
242 Ga0075434_101298529 3300006871 Bacteria 739
243 Ga0068865_100027399 3300006881 Bacteria 3765
244 Ga0068865_100989161 3300006881 Bacteria 736
245 Ga0068865_101604754 3300006881 Bacteria 585
246 Ga0075436_100299754 3300006914 Bacteria 1152
247 Ga0075436_100596372 3300006914 Bacteria 814
248 Ga0075436_100717845 3300006914 Bacteria 741
249 Ga0097620_100925356 3300006931 Bacteria 956
250 Ga0075435_100207854 3300007076 Bacteria 1660
251 Ga0075435_100321018 3300007076 Bacteria 1325
252 Ga0075435_100648137 3300007076 Bacteria 917
253 Ga0075435_100991002 3300007076 Bacteria 734
254 Ga0075435_101407194 3300007076 Bacteria 611
255 Ga0099794_10134250 3300007265 Bacteria 1251
256 Ga0099794_10260349 3300007265 Bacteria 895
257 Ga0099795_10011302 3300007788 Bacteria 2665
258 Ga0099795_10414583 3300007788 Bacteria 614
259 Ga0105240_10202461 3300009093 Bacteria 2325
260 Ga0105240_10482642 3300009093 Bacteria 1381
261 Ga0105240_10514153 3300009093 Bacteria 1330
262 Ga0111539_10248948 3300009094 Bacteria 2069
263 Ga0111539_11239672 3300009094 Bacteria 866
264 Ga0111539_11349484 3300009094 Unclassified 827
265 Ga0111539_11670053 3300009094 Unclassified 739
266 Ga0105245_10026035 3300009098 Bacteria 5147
267 Ga0105245_11034100 3300009098 Bacteria 866
268 Ga0105245_11098451 3300009098 Bacteria 842
269 Ga0105245_11528483 3300009098 Bacteria 719
270 Ga0105245_11763569 3300009098 Unclassified 672
271 Ga0105245_11782448 3300009098 Unclassified 668
272 Ga0105247_10779616 3300009101 Bacteria 727
273 Ga0114129_10198370 3300009147 Bacteria 2720
274 Ga0114129_11927460 3300009147 Unclassified 716
275 Ga0105243_12527282 3300009148 Bacteria 553
276 Ga0105242_10124776 3300009176 Bacteria 2215
277 Ga0105242_10997164 3300009176 Bacteria 845
278 Ga0105242_11366813 3300009176 Bacteria 734
279 Ga0105242_11460417 3300009176 Unclassified 713
280 Ga0105237_11107621 3300009545 Bacteria 799
281 Ga0105249_12157782 3300009553 Unclassified 630
282 Ga0105249_13198348 3300009553 Bacteria 526
283 Ga0099796_10003653 3300010159 Bacteria 3605
284 Ga0105239_10759087 3300010375 Bacteria 1110
285 Ga0105246_10826116 3300011119 Bacteria 824
286 Ga0105246_11448360 3300011119 Bacteria 643
287 Ga0157344_1017676 3300012476 Unclassified 587
288 Ga0157324_1016570 3300012506 Bacteria 703
289 Ga0157315_1036430 3300012508 Bacteria 603
290 Ga0157373_10899777 3300013100 Bacteria 657
291 Ga0157373_10933635 3300013100 Bacteria 645
292 Ga0157373_11343861 3300013100 Bacteria 542
293 Ga0157371_11093550 3300013102 Unclassified 611
294 Ga0157369_11185722 3300013105 Unclassified 780
295 Ga0157369_11627615 3300013105 Unclassified 656
296 Ga0157374_10010188 3300013296 Bacteria 8082
297 Ga0157374_10019441 3300013296 Bacteria 6011
298 Ga0157374_10036113 3300013296 Bacteria 4525
299 Ga0157374_10036648 3300013296 Bacteria 4494
300 Ga0157374_10085412 3300013296 Bacteria 3001
301 Ga0157374_10149164 3300013296 Bacteria 2273
302 Ga0157374_10411211 3300013296 Bacteria 1351
303 Ga0157374_10554260 3300013296 Bacteria 1157
304 Ga0157374_10687268 3300013296 Bacteria 1036
305 Ga0157374_10709148 3300013296 Bacteria 1019
306 Ga0157374_10769321 3300013296 Bacteria 978
307 Ga0157374_11159645 3300013296 Bacteria 794
308 Ga0157374_11529913 3300013296 Unclassified 691
309 Ga0157374_12062343 3300013296 Bacteria 597
310 Ga0157374_12376113 3300013296 Bacteria 557
311 Ga0157378_10027421 3300013297 Bacteria 5027
312 Ga0157378_10064092 3300013297 Bacteria 3286
313 Ga0157378_10152760 3300013297 Unclassified 2152
314 Ga0157378_10154579 3300013297 Bacteria 2140
315 Ga0157378_10282941 3300013297 Bacteria 1599
316 Ga0157378_10305186 3300013297 Bacteria 1542
317 Ga0157378_10462153 3300013297 Bacteria 1261
318 Ga0157378_10471684 3300013297 Bacteria 1249
319 Ga0157378_10736076 3300013297 Bacteria 1008
320 Ga0157378_11072515 3300013297 Unclassified 842
321 Ga0157378_11507808 3300013297 Unclassified 717
322 Ga0157378_13130170 3300013297 Unclassified 514
323 Ga0163162_10011180 3300013306 Bacteria 8746
324 Ga0163162_10058309 3300013306 Bacteria 3889
325 Ga0163162_10252552 3300013306 Bacteria 1895
326 Ga0163162_10830221 3300013306 Bacteria 1040
327 Ga0163162_10984332 3300013306 Bacteria 953
328 Ga0163162_11346222 3300013306 Unclassified 812
329 Ga0163162_11875544 3300013306 Bacteria 686
330 Ga0157372_10251035 3300013307 Bacteria 2053
331 Ga0157372_10362887 3300013307 Bacteria 1688
332 Ga0157372_10731733 3300013307 Bacteria 1150
333 Ga0157372_11169849 3300013307 Bacteria 889
334 Ga0157375_10000310 3300013308 Bacteria 44149
335 Ga0157375_10014009 3300013308 Bacteria 7151
336 Ga0157375_10065814 3300013308 Bacteria 3614
337 Ga0157375_10367869 3300013308 Bacteria 1604
338 Ga0157375_10554506 3300013308 Bacteria 1311
339 Ga0157375_10586836 3300013308 Bacteria 1274
340 Ga0157375_10605198 3300013308 Bacteria 1255
341 Ga0157375_12543879 3300013308 Bacteria 611
342 Ga0163163_10489635 3300014325 Bacteria 1291
343 Ga0163163_10533724 3300014325 Bacteria 1236
344 Ga0163163_12794422 3300014325 Unclassified 545
345 Ga0157380_10203510 3300014326 Bacteria 1758
346 Ga0157380_13252149 3300014326 Bacteria 519
347 Ga0157377_11211556 3300014745 Bacteria 585
348 Ga0157379_10107700 3300014968 Bacteria 2502
349 Ga0157379_10906995 3300014968 Bacteria 836
350 Ga0157376_10093433 3300014969 Bacteria 2611
351 Ga0157376_10158757 3300014969 Bacteria 2047
352 Ga0157376_10163758 3300014969 Unclassified 2018
353 Ga0157376_10394188 3300014969 Bacteria 1337
354 Ga0182005_1181425 3300015265 Bacteria 625
355 Ga0163161_10004316 3300017792 Bacteria 9906
356 Ga0163161_10842978 3300017792 Unclassified 773
357 Ga0163161_10912552 3300017792 Bacteria 745
358 Ga0163161_11028205 3300017792 Bacteria 705
359 Ga0213874_10041669 3300021377 Bacteria 1376
360 Ga0207666_1024192 3300025271 Bacteria 906
361 Ga0207666_1053187 3300025271 Unclassified 644
362 Ga0207673_1027606 3300025290 Bacteria 781
363 Ga0207697_10001434 3300025315 Bacteria 13052
364 Ga0207697_10006410 3300025315 Bacteria 5329
365 Ga0207697_10017000 3300025315 Bacteria 2992
366 Ga0207682_10067362 3300025893 Bacteria 1511
367 Ga0207682_10633584 3300025893 Bacteria 503
368 Ga0207692_10075850 3300025898 Bacteria 1785
369 Ga0207692_10470434 3300025898 Bacteria 794
370 Ga0207692_10558146 3300025898 Bacteria 732
371 Ga0207692_10973056 3300025898 Unclassified 560
372 Ga0207692_11191334 3300025898 Unclassified 506
373 Ga0207642_10099270 3300025899 Bacteria 1458
374 Ga0207642_10290904 3300025899 Bacteria 943
375 Ga0207688_10006245 3300025901 Bacteria 6484
376 Ga0207688_10016345 3300025901 Bacteria 4024
377 Ga0207688_10325819 3300025901 Unclassified 943
378 Ga0207688_10456327 3300025901 Bacteria 797
379 Ga0207680_10067031 3300025903 Bacteria 2209
380 Ga0207680_10357658 3300025903 Bacteria 1026
381 Ga0207680_10545676 3300025903 Bacteria 827
382 Ga0207680_10657789 3300025903 Bacteria 750
383 Ga0207699_10192305 3300025906 Bacteria 1378
384 Ga0207699_10315470 3300025906 Bacteria 1095
385 Ga0207645_10005383 3300025907 Bacteria 9291
386 Ga0207645_10006924 3300025907 Bacteria 8076
387 Ga0207645_10074037 3300025907 Bacteria 2180
388 Ga0207643_10144091 3300025908 Bacteria 1425
389 Ga0207684_10001353 3300025910 Bacteria 26848
390 Ga0207684_10085882 3300025910 Bacteria 2680
391 Ga0207684_10090169 3300025910 Bacteria 2612
392 Ga0207684_10110683 3300025910 Bacteria 2351
393 Ga0207684_10534245 3300025910 Bacteria 1004
394 Ga0207695_10211333 3300025913 Bacteria 1851
395 Ga0207695_10535678 3300025913 Bacteria 1052
396 Ga0207671_10640545 3300025914 Bacteria 846
397 Ga0207671_11321379 3300025914 Unclassified 561
398 Ga0207693_10005744 3300025915 Bacteria 10297
399 Ga0207693_10240573 3300025915 Bacteria 1421
400 Ga0207693_10387635 3300025915 Bacteria 1093
401 Ga0207693_10487641 3300025915 Unclassified 962
402 Ga0207693_10762450 3300025915 Bacteria 747
403 Ga0207663_10023042 3300025916 Bacteria 3568
404 Ga0207663_10214946 3300025916 Bacteria 1396
405 Ga0207663_10371597 3300025916 Bacteria 1087
406 Ga0207663_10719072 3300025916 Unclassified 792
407 Ga0207662_10368685 3300025918 Bacteria 968
408 Ga0207649_10159546 3300025920 Bacteria 1562
409 Ga0207646_10000761 3300025922 Bacteria 41842
410 Ga0207646_10001268 3300025922 Bacteria 31646
411 Ga0207646_10031998 3300025922 Bacteria 4761
412 Ga0207646_10156073 3300025922 Bacteria 2058
413 Ga0207646_10290301 3300025922 Bacteria 1478
414 Ga0207646_10375198 3300025922 Bacteria 1285
415 Ga0207646_10621414 3300025922 Bacteria 969
416 Ga0207646_10622175 3300025922 Bacteria 968
417 Ga0207646_11197316 3300025922 Bacteria 666
418 Ga0207646_11286608 3300025922 Unclassified 639
419 Ga0207681_10018554 3300025923 Bacteria 4384
420 Ga0207681_10151964 3300025923 Bacteria 1736
421 Ga0207681_10354945 3300025923 Bacteria 1174
422 Ga0207681_10362676 3300025923 Unclassified 1163
423 Ga0207681_10449195 3300025923 Bacteria 1048
424 Ga0207681_10578269 3300025923 Bacteria 926
425 Ga0207681_11060078 3300025923 Bacteria 680
426 Ga0207650_10122980 3300025925 Bacteria 2022
427 Ga0207650_10317061 3300025925 Bacteria 1276
428 Ga0207650_10414611 3300025925 Bacteria 1117
429 Ga0207650_10601607 3300025925 Bacteria 925
430 Ga0207650_10707990 3300025925 Bacteria 851
431 Ga0207659_10015869 3300025926 Bacteria 4893
432 Ga0207659_10212287 3300025926 Bacteria 1552
433 Ga0207659_10319006 3300025926 Bacteria 1281
434 Ga0207687_10134716 3300025927 Bacteria 1867
435 Ga0207687_10567663 3300025927 Bacteria 953
436 Ga0207700_10183950 3300025928 Bacteria 1752
437 Ga0207700_11226122 3300025928 Bacteria 669
438 Ga0207664_10739424 3300025929 Bacteria 885
439 Ga0207664_11104124 3300025929 Bacteria 709
440 Ga0207644_10022306 3300025931 Unclassified 4324
441 Ga0207644_10035506 3300025931 Bacteria 3494
442 Ga0207644_10119889 3300025931 Bacteria 2001
443 Ga0207706_10024784 3300025933 Bacteria 5376
444 Ga0207706_10117966 3300025933 Bacteria 2334
445 Ga0207706_10156889 3300025933 Bacteria 2001
446 Ga0207670_10070809 3300025936 Bacteria 2410
447 Ga0207670_10289631 3300025936 Bacteria 1279
448 Ga0207670_10357085 3300025936 Bacteria 1159
449 Ga0207670_10602991 3300025936 Bacteria 902
450 Ga0207669_10073323 3300025937 Bacteria 2159
451 Ga0207669_10092563 3300025937 Bacteria 1973
452 Ga0207669_10166049 3300025937 Bacteria 1565
453 Ga0207669_10207459 3300025937 Bacteria 1427
454 Ga0207669_10230113 3300025937 Bacteria 1367
455 Ga0207669_10755088 3300025937 Bacteria 803
456 Ga0207704_10129052 3300025938 Bacteria 1747
457 Ga0207704_10409478 3300025938 Bacteria 1072
458 Ga0207704_11918002 3300025938 Unclassified 510
459 Ga0207665_10029233 3300025939 Bacteria 3644
460 Ga0207665_10042417 3300025939 Bacteria 3041
461 Ga0207665_10300166 3300025939 Bacteria 1200
462 Ga0207665_10773776 3300025939 Unclassified 758
463 Ga0207665_11034603 3300025939 Bacteria 654
464 Ga0207691_10000682 3300025940 Bacteria 33522
465 Ga0207691_10006884 3300025940 Bacteria 10968
466 Ga0207691_10009950 3300025940 Bacteria 9132
467 Ga0207691_10027046 3300025940 Bacteria 5383
468 Ga0207691_10361430 3300025940 Unclassified 1241
469 Ga0207691_10970809 3300025940 Unclassified 710
470 Ga0207689_10487250 3300025942 Bacteria 1032
471 Ga0207661_10460483 3300025944 Bacteria 1159
472 Ga0207661_11379059 3300025944 Bacteria 647
473 Ga0207679_10340504 3300025945 Bacteria 1304
474 Ga0207679_11148446 3300025945 Bacteria 713
475 Ga0207651_10011089 3300025960 Bacteria 5028
476 Ga0207651_11105398 3300025960 Bacteria 710
477 Ga0207651_11205849 3300025960 Unclassified 679
478 Ga0207651_11867120 3300025960 Bacteria 540
479 Ga0207668_10101416 3300025972 Bacteria 2139
480 Ga0207668_10401804 3300025972 Bacteria 1158
481 Ga0207658_10012820 3300025986 Bacteria 5725
482 Ga0207658_10079824 3300025986 Bacteria 2504
483 Ga0207658_10176986 3300025986 Bacteria 1762
484 Ga0207658_10968959 3300025986 Bacteria 775
485 Ga0207658_11333224 3300025986 Bacteria 656
486 Ga0207677_10071821 3300026023 Bacteria 2444
487 Ga0207677_10114473 3300026023 Bacteria 2016
488 Ga0207677_10937450 3300026023 Bacteria 782
489 Ga0207703_10594302 3300026035 Bacteria 1046
490 Ga0207639_11701202 3300026041 Bacteria 591
491 Ga0207678_10429756 3300026067 Bacteria 1146
492 Ga0207678_10694431 3300026067 Bacteria 895
493 Ga0207678_11965190 3300026067 Unclassified 509
494 Ga0207708_10239802 3300026075 Bacteria 1458
495 Ga0207702_10229412 3300026078 Bacteria 1734
496 Ga0207702_10332470 3300026078 Bacteria 1450
497 Ga0207641_11157590 3300026088 Bacteria 773
498 Ga0207641_11502270 3300026088 Bacteria 675
499 Ga0207641_11865319 3300026088 Unclassified 603
500 Ga0207641_12536237 3300026088 Unclassified 511
501 Ga0207648_10121728 3300026089 Bacteria 2294
502 Ga0207675_100113874 3300026118 Bacteria 2554
503 Ga0207683_10003219 3300026121 Bacteria 14243
504 Ga0207683_10028386 3300026121 Bacteria 4838
505 Ga0207683_10077821 3300026121 Bacteria 2938
506 Ga0207683_10080425 3300026121 Bacteria 2891
507 Ga0207683_10396109 3300026121 Bacteria 1270
508 Ga0207683_10742274 3300026121 Bacteria 911
509 Ga0207683_11700755 3300026121 Bacteria 580
510 Ga0207683_11831051 3300026121 Bacteria 556
511 Ga0209968_1074015 3300027526 Unclassified 609
512 Ga0209588_1082967 3300027671 Bacteria 1035
513 Ga0209974_10022394 3300027876 Bacteria 2093
514 Ga0268266_10029234 3300028379 Bacteria 4685
515 Ga0268266_10060934 3300028379 Bacteria 3253
516 Ga0268266_10250640 3300028379 Bacteria 1637
517 Ga0268266_11287850 3300028379 Bacteria 706
518 Ga0268265_10356958 3300028380 Bacteria 1337
519 Ga0268264_10248374 3300028381 Bacteria 1652
520 Ga0268264_10405532 3300028381 Bacteria 1311
521 Ga0268264_10444775 3300028381 Bacteria 1254
522 Ga0268264_10672859 3300028381 Bacteria 1026
523 Ga0307513_10028758 3300031456 Bacteria 6349
524 Ga0373929_0107493 3300035085 Bacteria 710
525 Ga0373940_0218143 3300035088 Bacteria 633
526 Ga0373944_0009293 3300035089 Bacteria 2665
527 Ga0373944_0244544 3300035089 Bacteria 661
528 Ga0373952_0015051 3300035092 Bacteria 1557
529 Ga0373952_0299227 3300035092 Unclassified 501
530 Ga0373923_0244225 3300035111 Bacteria 839
531 Ga0373936_0078475 3300035113 Bacteria 1371
532 Ga0373936_0273784 3300035113 Bacteria 758
533 Ga0373939_0369781 3300035114 Bacteria 588
534 Ga0373945_0025016 3300035116 Bacteria 2072
535 Ga0373945_0089001 3300035116 Bacteria 1193
536 Ga0373945_0453232 3300035116 Bacteria 567
537 Ga0373953_0085373 3300035117 Unclassified 1317
538 Ga0373956_0223457 3300035119 Bacteria 894
539 Ga0373960_0261219 3300035121 Bacteria 632
540 Ga0373943_0022234 3300035170 Bacteria 2936
541 Ga0373943_0040512 3300035170 Bacteria 2249
542 Ga0373943_0459081 3300035170 Bacteria 741
543 Ga0373943_0929200 3300035170 Unclassified 520
544 Ga0373946_0043059 3300035171 Bacteria 1859
545 Ga0373942_0084053 3300035207 Bacteria 950
546 Ga0373962_0078588 3300035242 Bacteria 998
547 Ga0373924_0037896 3300035410 Bacteria 1965
548 Ga0373931_0325639 3300035691 Bacteria 956
549 Ga0373931_1142471 3300035691 Unclassified 531
550 Ga0373935_0036950 3300035692 Bacteria 3055
551 Ga0373935_0047298 3300035692 Bacteria 2720
552 Ga0373935_1156355 3300035692 Bacteria 576
553 Ga0373927_0161496 3300035695 Bacteria 1468
554 Ga0373927_0679217 3300035695 Bacteria 680
555 Ga0373933_1087114 3300035724 Bacteria 527
556 Ga0373947_0047114 3300035725 Bacteria 2582
557 Ga0373947_0180656 3300035725 Bacteria 1373
558 Ga0373947_0429250 3300035725 Bacteria 894
559 Ga0373947_0774937 3300035725 Bacteria 655
560 Ga0373937_0064697 3300036401 Bacteria 3364
561 Ga0373925_0054995 3300037068 Unclassified 2978
562 Ga0373925_0128861 3300037068 Bacteria 1971
563 Ga0373925_0241649 3300037068 Bacteria 1446
564 Ga0373925_0293526 3300037068 Bacteria 1311
565 Ga0373925_0616936 3300037068 Bacteria 893
566 Ga0373925_0633906 3300037068 Bacteria 881
567 Ga0395899_0363811 3300037312 Bacteria 965
568 Ga0395900_0009962 3300037418 Bacteria 9730
569 Ga0395905_0712238 3300037471 Bacteria 906
570 Ga0436364_0211304 3300037853 Bacteria 1155
571 Ga0395901_0018755 3300038443 Bacteria 7068
572 Ga0436365_1701796 3300039437 Bacteria 817
573 Ga0436363_0028360 3300039450 Bacteria 1016
574 Ga0436363_0764338 3300039450 Bacteria 1824
575 Ga0436362_0578505 3300039453 Bacteria 636
576 Ga0436362_0741553 3300039453 Unclassified 547
577 Ga0451791_1442531 3300041451 Bacteria 716
578 Ga0451800_1097366 3300041459 Unclassified 537
579 Ga0451807_0854782 3300041486 Unclassified 500
580 Ga0451807_1140449 3300041486 Bacteria 768
581 Ga0451839_0690170 3300041496 Bacteria 690
582 Ga0451847_0027848 3300041503 Bacteria 845
583 Ga0451853_2823564 3300041512 Bacteria 867
584 Ga0466967_0143304 3300045976 Bacteria 2227
585 Ga0495651_0021210 3300046462 Bacteria 5048
586 Ga0495651_0441022 3300046462 Bacteria 843
587 Ga0495653_0088901 3300046463 Bacteria 2265
588 Ga0495580_0174488 3300046472 Bacteria 1485
589 Ga0495582_0163700 3300046473 Bacteria 1266
590 Ga0495584_0258466 3300046491 Bacteria 885
591 Ga0495584_0475587 3300046491 Unclassified 636
592 Ga0495585_0099877 3300046492 Bacteria 1553
593 Ga0495583_0255403 3300046506 Unclassified 702
594 Ga0495616_0429815 3300046513 Bacteria 538
595 Ga0495630_0141821 3300046517 Bacteria 1827
596 Ga0495630_1045259 3300046517 Unclassified 620
597 Ga0495637_0257317 3300046520 Unclassified 627
598 Ga0495642_0066211 3300046528 Bacteria 1505
599 Ga0495652_0029626 3300046529 Bacteria 4808
600 Ga0495586_0607060 3300046535 Bacteria 632
601 Ga0495587_0435746 3300046536 Bacteria 727
602 Ga0495598_0022222 3300046537 Bacteria 1695
603 Ga0495621_0114564 3300046539 Bacteria 1037
604 Ga0495645_0034369 3300046543 Bacteria 3699
605 Ga0495667_0311444 3300046559 Bacteria 997
606 Ga0495659_0002866 3300046664 Bacteria 5539
607 Ga0495659_0116765 3300046664 Bacteria 1047
608 Ga0495588_0333827 3300046674 Bacteria 797
609 Ga0495657_0238608 3300046675 Bacteria 1098
610 Ga0495599_0181751 3300046678 Bacteria 1296
611 Ga0495599_0441031 3300046678 Bacteria 772
612 Ga0495647_0023130 3300046681 Bacteria 2252
613 Ga0495647_0137706 3300046681 Bacteria 1039
614 Ga0495658_0098735 3300046683 Bacteria 1740
615 Ga0495658_0850372 3300046683 Bacteria 584
616 Ga0495669_0019428 3300046684 Bacteria 2933
617 Ga0495613_0623329 3300046689 Bacteria 716
618 Ga0495613_0736170 3300046689 Bacteria 647
619 Ga0495670_0151368 3300046691 Unclassified 1217
620 Ga0495589_0455297 3300046794 Bacteria 585
621 Ga0495600_0547291 3300046809 Bacteria 707
622 Ga0495660_0355077 3300046810 Unclassified 651
623 Ga0495604_0064731 3300047317 Bacteria 2785
624 Ga0495680_0121918 3300047322 Bacteria 1924
625 Ga0495683_0119658 3300047323 Bacteria 1251
626 Ga0495685_032867 3300047447 Bacteria 1783
627 Ga0495681_0220900 3300047470 Bacteria 760
628 Ga0495684_0082041 3300047471 Bacteria 2447
629 Ga0496100_0424174 3300048903 Bacteria 1016
630 Ga0496100_0585312 3300048903 Bacteria 865
631 Ga0496101_0090607 3300048904 Bacteria 2274
632 Ga0496101_0395534 3300048904 Bacteria 1088
633 Ga0496102_0135269 3300048905 Bacteria 2309
634 Ga0496102_0764552 3300048905 Bacteria 889
635 Ga0496104_0487229 3300048907 Bacteria 1144
636 Ga0496104_0590570 3300048907 Unclassified 1021
637 Ga0496104_0709172 3300048907 Bacteria 914
638 Ga0496104_0977653 3300048907 Unclassified 751
639 Ga0496105_0034851 3300048908 Bacteria 4142
640 Ga0496105_0191665 3300048908 Bacteria 1671
641 Ga0496106_0005830 3300048909 Bacteria 9110
642 Ga0496106_0048858 3300048909 Bacteria 3187
643 Ga0496107_0241105 3300048910 Bacteria 1345
644 Ga0496108_0469880 3300048911 Bacteria 1099
645 Ga0496108_0548862 3300048911 Bacteria 1008
646 Ga0496109_0032418 3300048912 Bacteria 4697
647 Ga0496109_0090738 3300048912 Bacteria 2826
648 Ga0496109_0429371 3300048912 Bacteria 1248
649 Ga0496110_0231628 3300048913 Bacteria 1680
650 Ga0496110_0289024 3300048913 Bacteria 1493
651 Ga0496111_0374710 3300048914 Bacteria 1053
652 Ga0496112_0018692 3300048915 Bacteria 6531
653 Ga0496112_0059307 3300048915 Bacteria 3771
654 Ga0496112_0162831 3300048915 Bacteria 2197
655 Ga0496112_0162997 3300048915 Bacteria 2196
656 Ga0496112_0225037 3300048915 Bacteria 1831
657 Ga0496112_0316278 3300048915 Bacteria 1506
658 Ga0496112_0478867 3300048915 Bacteria 1181
659 Ga0496113_0170830 3300048916 Bacteria 1722
660 Ga0496113_0258750 3300048916 Bacteria 1390
661 Ga0496113_0384102 3300048916 Bacteria 1127
662 Ga0496113_1165795 3300048916 Unclassified 603
663 Ga0496114_0347962 3300048917 Bacteria 1311
664 Ga0496115_0006052 3300048918 Bacteria 8836
665 Ga0496115_1035481 3300048918 Bacteria 625
666 nmdc:mga05p37_132841_c1 3300050507 Bacteria 3053
667 nmdc:mga05p37_1558429_c1 3300050507 Unclassified 654
668 nmdc:mga09592_1611249_c1 3300050508 Bacteria 525
669 nmdc:mga0n895_168964_c1 3300050512 Bacteria 2219
670 nmdc:mga0n895_171958_c1 3300050512 Bacteria 2198
671 nmdc:mga0n895_384885_c1 3300050512 Bacteria 1419
672 nmdc:mga0n895_522036_c1 3300050512 Bacteria 1195
673 nmdc:mga0rr50_1427751_c1 3300050513 Unclassified 586
674 nmdc:mga0rr50_759004_c1 3300050513 Bacteria 828
675 nmdc:mga0a205_1399726_c1 3300050515 Unclassified 547
676 nmdc:mga0a205_422364_c1 3300050515 Bacteria 1195
677 Ga0495601_0128117 3300053077 Bacteria 1652
678 Ga0495655_0001395 3300053083 Bacteria 3713
679 Ga0495619_0046735 3300053085 Bacteria 2848
680 Ga0068871_101223231
681 CNXas_1012336
682 JGI25406J46586_10000005
683 Ga0065704_10020889
684 Ga0065704_10023518
685 Ga0065712_10037794
686 Ga0065712_10130130
687 Ga0065715_10175111
688 Ga0065715_10247393
689 Ga0065715_10432750
690 Ga0065715_10859038
691 Ga0065715_10948180
692 Ga0065707_10023810
693 Ga0065707_10205528
694 Ga0070676_10093919
695 Ga0070676_10115620
696 Ga0070676_10243622
697 Ga0070676_10695786
698 Ga0070676_10925342
699 Ga0070683_100575441
700 Ga0070683_100823850
701 Ga0070690_100081666
702 Ga0070690_100227372
703 Ga0070690_100252100
704 Ga0070690_100320279
705 Ga0070690_100852741
706 Ga0070690_101081644
707 Ga0070690_101369142
708 Ga0070690_101389791
709 Ga0070670_100008014
710 Ga0070670_100075045
711 Ga0070670_100608173
712 Ga0070670_100988116
713 Ga0070670_101206282
714 Ga0070670_101770705
715 Ga0070670_102216847
716 Ga0070677_10144375
717 Ga0070677_10299465
718 Ga0070677_10320450
719 Ga0068869_100609609
720 Ga0068869_101035886
721 Ga0070666_10014224
722 Ga0070666_10014905
723 Ga0070666_10019653
724 Ga0070666_10045852
725 Ga0070666_10841999
726 Ga0070680_100430216
727 Ga0068868_100076098
728 Ga0068868_100138525
729 Ga0068868_100780592
730 Ga0068868_101363156
731 Ga0068868_101870049
732 Ga0070660_100259145
733 Ga0070689_100155191
734 Ga0070689_100167355
735 Ga0070689_100534021
736 Ga0070689_101815897
737 Ga0070687_100456611
738 Ga0070687_100599874
739 Ga0070661_101029838
740 Ga0070668_100155495
741 Ga0070668_100234098
742 Ga0070668_100287734
743 Ga0070668_100417965
744 Ga0070669_100033594
745 Ga0070669_100048389
746 Ga0070669_100193503
747 Ga0070669_100501819
748 Ga0070669_101275055
749 Ga0070669_101916519
750 Ga0070675_100044438
751 Ga0070675_100046630
752 Ga0070675_100214778
753 Ga0070675_100259753
754 Ga0070675_100265702
755 Ga0070675_100621261
756 Ga0070675_101202937
757 Ga0070671_100000603
758 Ga0070671_100019618
759 Ga0070671_100440528
760 Ga0070671_101073697
761 Ga0070671_101078321
762 Ga0070671_101530014
763 Ga0070671_101755830
764 Ga0070671_101769758
765 Ga0070674_100053556
766 Ga0070674_100174525
767 Ga0070674_100311992
768 Ga0070674_100315936
769 Ga0070674_100676977
770 Ga0070674_101218299
771 Ga0070673_100061698
772 Ga0070673_100202361
773 Ga0070673_100257744
774 Ga0070673_100387820
775 Ga0070673_100640964
776 Ga0070673_100758982
777 Ga0070673_101355901
778 Ga0070673_101960680
779 Ga0070688_100008152
780 Ga0070688_100632949
781 Ga0070688_100678966
782 Ga0070688_101010622
783 Ga0070659_100348531
784 Ga0070659_100567301
785 Ga0070667_100013547
786 Ga0070667_100089421
787 Ga0070667_100219628
788 Ga0070667_100423853
789 Ga0070667_100938946
790 Ga0070703_10157830
791 Ga0070703_10465741
792 Ga0070709_10027472
793 Ga0070714_100633467
794 Ga0070714_100951761
795 Ga0070713_100166612
796 Ga0070713_100438412
797 Ga0070710_10265401
798 Ga0070711_100064196
799 Ga0070711_100131544
800 Ga0070705_100015926
801 Ga0070705_100101047
802 Ga0070705_100132751
803 Ga0070700_100734882
804 Ga0070700_100750712
805 Ga0070694_100266852
806 Ga0070708_100704199
807 Ga0070708_100821434
808 Ga0070708_100854412
809 Ga0070708_101938064
810 Ga0070708_102019998
811 Ga0070663_100502406
812 Ga0070678_100056369
813 Ga0070678_100121608
814 Ga0070678_100226156
815 Ga0070678_100616070
816 Ga0070678_102288850
817 Ga0070662_100468310
818 Ga0068867_100095686
819 Ga0068867_100124107
820 Ga0070685_10433645
821 Ga0070706_100001327
822 Ga0070706_100042632
823 Ga0070706_100068781
824 Ga0070706_100119000
825 Ga0070706_100234722
826 Ga0070706_100291452
827 Ga0070706_100613562
828 Ga0070706_100699496
829 Ga0070707_100021759
830 Ga0070707_100089594
831 Ga0070707_100104811
832 Ga0070707_100146365
833 Ga0070707_100403270
834 Ga0070707_100455542
835 Ga0070707_100620843
836 Ga0070707_100625980
837 Ga0070707_101208445
838 Ga0070707_101875238
839 Ga0070707_101916994
840 Ga0070698_100013758
841 Ga0070698_100027427
842 Ga0070698_100141008
843 Ga0070699_100503867
844 Ga0070699_100720908
845 Ga0070699_100838669
846 Ga0070697_100015613
847 Ga0070697_100020289
848 Ga0070697_100159752
849 Ga0070697_100186451
850 Ga0070697_100306426
851 Ga0070697_100676868
852 Ga0070697_100717158
853 Ga0070697_101039427
854 Ga0070697_101319755
855 Ga0068853_101029128
856 Ga0070672_100250244
857 Ga0070672_100278473
858 Ga0070672_100433782
859 Ga0070672_100728304
860 Ga0070672_101664264
861 Ga0070672_102080571
862 Ga0070695_100027928
863 Ga0070695_100222791
864 Ga0070696_100278921
865 Ga0070696_100625900
866 Ga0070693_100895568
867 Ga0070665_100169288
868 Ga0070665_100402705
869 Ga0070665_100448609
870 Ga0070665_100557649
871 Ga0070704_100525705
872 Ga0070704_100744721
873 Ga0070664_100181841
874 Ga0070664_100189753
875 Ga0068856_100183383
876 Ga0068856_100309588
877 Ga0068856_101463980
878 Ga0070702_100219426
879 Ga0070702_101546649
880 Ga0068852_101396804
881 Ga0068866_10131556
882 Ga0068866_10242658
883 Ga0068866_10606104
884 Ga0068861_101847495
885 Ga0068851_10302112
886 Ga0068870_10679513
887 Ga0068860_100256390
888 Ga0068860_100540169
889 Ga0081540_1343391
890 Ga0081539_10000026
891 Ga0081539_10001307
892 Ga0081539_10159775
893 Ga0070717_10000233
894 Ga0070717_10022647
895 Ga0070717_10230751
896 Ga0070717_11923153
897 Ga0070716_100280342
898 Ga0070716_100661141
899 Ga0070716_101154624
900 Ga0070712_100206253
901 Ga0070712_100502984
902 Ga0070712_100507052
903 Ga0070712_100568765
904 Ga0070712_100951720
905 Ga0070712_101824218
906 Ga0097621_100093835
907 Ga0097621_100227493
908 Ga0097621_100568858
909 Ga0097621_100808278
910 Ga0097621_100834977
911 Ga0097621_101209278
912 Ga0097621_101838274
913 Ga0068871_100035798
914 Ga0068871_100254567
915 Ga0068871_100702801
916 Ga0075433_10339804
917 Ga0075433_10456748
918 Ga0075434_100126547
919 Ga0075434_100277001
920 Ga0075434_100430964
921 Ga0075434_101298529
922 Ga0068865_100027399
923 Ga0068865_100989161
924 Ga0068865_101604754
925 Ga0075436_100299754
926 Ga0075436_100596372
927 Ga0075436_100717845
928 Ga0097620_100925356
929 Ga0075435_100207854
930 Ga0075435_100321018
931 Ga0075435_100648137
932 Ga0075435_100991002
933 Ga0075435_101407194
934 Ga0099794_10134250
935 Ga0099794_10260349
936 Ga0099795_10011302
937 Ga0099795_10414583
938 Ga0105240_10202461
939 Ga0105240_10482642
940 Ga0105240_10514153
941 Ga0111539_10248948
942 Ga0111539_11239672
943 Ga0111539_11349484
944 Ga0111539_11670053
945 Ga0105245_10026035
946 Ga0105245_11034100
947 Ga0105245_11098451
948 Ga0105245_11528483
949 Ga0105245_11763569
950 Ga0105245_11782448
951 Ga0105247_10779616
952 Ga0114129_10198370
953 Ga0114129_11927460
954 Ga0105243_12527282
955 Ga0105242_10124776
956 Ga0105242_10997164
957 Ga0105242_11366813
958 Ga0105242_11460417
959 Ga0105237_11107621
960 Ga0105249_12157782
961 Ga0105249_13198348
962 Ga0099796_10003653
963 Ga0105239_10759087
964 Ga0105246_10826116
965 Ga0105246_11448360
966 Ga0157344_1017676
967 Ga0157324_1016570
968 Ga0157315_1036430
969 Ga0157373_10899777
970 Ga0157373_10933635
971 Ga0157373_11343861
972 Ga0157371_11093550
973 Ga0157369_11185722
974 Ga0157369_11627615
975 Ga0157374_10010188
976 Ga0157374_10019441
977 Ga0157374_10036113
978 Ga0157374_10036648
979 Ga0157374_10085412
980 Ga0157374_10149164
981 Ga0157374_10411211
982 Ga0157374_10554260
983 Ga0157374_10687268
984 Ga0157374_10709148
985 Ga0157374_10769321
986 Ga0157374_11159645
987 Ga0157374_11529913
988 Ga0157374_12062343
989 Ga0157374_12376113
990 Ga0157378_10027421
991 Ga0157378_10064092
992 Ga0157378_10152760
993 Ga0157378_10154579
994 Ga0157378_10282941
995 Ga0157378_10305186
996 Ga0157378_10462153
997 Ga0157378_10471684
998 Ga0157378_10736076
999 Ga0157378_11072515
1000 Ga0157378_11507808
1001 Ga0157378_13130170
1002 Ga0163162_10011180
1003 Ga0163162_10058309
1004 Ga0163162_10252552
1005 Ga0163162_10830221
1006 Ga0163162_10984332
1007 Ga0163162_11346222
1008 Ga0163162_11875544
1009 Ga0157372_10251035
1010 Ga0157372_10362887
1011 Ga0157372_10731733
1012 Ga0157372_11169849
1013 Ga0157375_10000310
1014 Ga0157375_10014009
1015 Ga0157375_10065814
1016 Ga0157375_10367869
1017 Ga0157375_10554506
1018 Ga0157375_10586836
1019 Ga0157375_10605198
1020 Ga0157375_12543879
1021 Ga0163163_10489635
1022 Ga0163163_10533724
1023 Ga0163163_12794422
1024 Ga0157380_10203510
1025 Ga0157380_13252149
1026 Ga0157377_11211556
1027 Ga0157379_10107700
1028 Ga0157379_10906995
1029 Ga0157376_10093433
1030 Ga0157376_10158757
1031 Ga0157376_10163758
1032 Ga0157376_10394188
1033 Ga0182005_1181425
1034 Ga0163161_10004316
1035 Ga0163161_10842978
1036 Ga0163161_10912552
1037 Ga0163161_11028205
1038 Ga0213874_10041669
1039 Ga0207666_1024192
1040 Ga0207666_1053187
1041 Ga0207673_1027606
1042 Ga0207697_10001434
1043 Ga0207697_10006410
1044 Ga0207697_10017000
1045 Ga0207682_10067362
1046 Ga0207682_10633584
1047 Ga0207692_10075850
1048 Ga0207692_10470434
1049 Ga0207692_10558146
1050 Ga0207692_10973056
1051 Ga0207692_11191334
1052 Ga0207642_10099270
1053 Ga0207642_10290904
1054 Ga0207688_10006245
1055 Ga0207688_10016345
1056 Ga0207688_10325819
1057 Ga0207688_10456327
1058 Ga0207680_10067031
1059 Ga0207680_10357658
1060 Ga0207680_10545676
1061 Ga0207680_10657789
1062 Ga0207699_10192305
1063 Ga0207699_10315470
1064 Ga0207645_10005383
1065 Ga0207645_10006924
1066 Ga0207645_10074037
1067 Ga0207643_10144091
1068 Ga0207684_10001353
1069 Ga0207684_10085882
1070 Ga0207684_10090169
1071 Ga0207684_10110683
1072 Ga0207684_10534245
1073 Ga0207695_10211333
1074 Ga0207695_10535678
1075 Ga0207671_10640545
1076 Ga0207671_11321379
1077 Ga0207693_10005744
1078 Ga0207693_10240573
1079 Ga0207693_10387635
1080 Ga0207693_10487641
1081 Ga0207693_10762450
1082 Ga0207663_10023042
1083 Ga0207663_10214946
1084 Ga0207663_10371597
1085 Ga0207663_10719072
1086 Ga0207662_10368685
1087 Ga0207649_10159546
1088 Ga0207646_10000761
1089 Ga0207646_10001268
1090 Ga0207646_10031998
1091 Ga0207646_10156073
1092 Ga0207646_10290301
1093 Ga0207646_10375198
1094 Ga0207646_10621414
1095 Ga0207646_10622175
1096 Ga0207646_11197316
1097 Ga0207646_11286608
1098 Ga0207681_10018554
1099 Ga0207681_10151964
1100 Ga0207681_10354945
1101 Ga0207681_10362676
1102 Ga0207681_10449195
1103 Ga0207681_10578269
1104 Ga0207681_11060078
1105 Ga0207650_10122980
1106 Ga0207650_10317061
1107 Ga0207650_10414611
1108 Ga0207650_10601607
1109 Ga0207650_10707990
1110 Ga0207659_10015869
1111 Ga0207659_10212287
1112 Ga0207659_10319006
1113 Ga0207687_10134716
1114 Ga0207687_10567663
1115 Ga0207700_10183950
1116 Ga0207700_11226122
1117 Ga0207664_10739424
1118 Ga0207664_11104124
1119 Ga0207644_10022306
1120 Ga0207644_10035506
1121 Ga0207644_10119889
1122 Ga0207706_10024784
1123 Ga0207706_10117966
1124 Ga0207706_10156889
1125 Ga0207670_10070809
1126 Ga0207670_10289631
1127 Ga0207670_10357085
1128 Ga0207670_10602991
1129 Ga0207669_10073323
1130 Ga0207669_10092563
1131 Ga0207669_10166049
1132 Ga0207669_10207459
1133 Ga0207669_10230113
1134 Ga0207669_10755088
1135 Ga0207704_10129052
1136 Ga0207704_10409478
1137 Ga0207704_11918002
1138 Ga0207665_10029233
1139 Ga0207665_10042417
1140 Ga0207665_10300166
1141 Ga0207665_10773776
1142 Ga0207665_11034603
1143 Ga0207691_10000682
1144 Ga0207691_10006884
1145 Ga0207691_10009950
1146 Ga0207691_10027046
1147 Ga0207691_10361430
1148 Ga0207691_10970809
1149 Ga0207689_10487250
1150 Ga0207661_10460483
1151 Ga0207661_11379059
1152 Ga0207679_10340504
1153 Ga0207679_11148446
1154 Ga0207651_10011089
1155 Ga0207651_11105398
1156 Ga0207651_11205849
1157 Ga0207651_11867120
1158 Ga0207668_10101416
1159 Ga0207668_10401804
1160 Ga0207658_10012820
1161 Ga0207658_10079824
1162 Ga0207658_10176986
1163 Ga0207658_10968959
1164 Ga0207658_11333224
1165 Ga0207677_10071821
1166 Ga0207677_10114473
1167 Ga0207677_10937450
1168 Ga0207703_10594302
1169 Ga0207639_11701202
1170 Ga0207678_10429756
1171 Ga0207678_10694431
1172 Ga0207678_11965190
1173 Ga0207708_10239802
1174 Ga0207702_10229412
1175 Ga0207702_10332470
1176 Ga0207641_11157590
1177 Ga0207641_11502270
1178 Ga0207641_11865319
1179 Ga0207641_12536237
1180 Ga0207648_10121728
1181 Ga0207675_100113874
1182 Ga0207683_10003219
1183 Ga0207683_10028386
1184 Ga0207683_10077821
1185 Ga0207683_10080425
1186 Ga0207683_10396109
1187 Ga0207683_10742274
1188 Ga0207683_11700755
1189 Ga0207683_11831051
1190 Ga0209968_1074015
1191 Ga0209588_1082967
1192 Ga0209974_10022394
1193 Ga0268266_10029234
1194 Ga0268266_10060934
1195 Ga0268266_10250640
1196 Ga0268266_11287850
1197 Ga0268265_10356958
1198 Ga0268264_10248374
1199 Ga0268264_10405532
1200 Ga0268264_10444775
1201 Ga0268264_10672859
1202 Ga0307513_10028758
1203 Ga0373929_0107493
1204 Ga0373940_0218143
1205 Ga0373944_0009293
1206 Ga0373944_0244544
1207 Ga0373952_0015051
1208 Ga0373952_0299227
1209 Ga0373923_0244225
1210 Ga0373936_0078475
1211 Ga0373936_0273784
1212 Ga0373939_0369781
1213 Ga0373945_0025016
1214 Ga0373945_0089001
1215 Ga0373945_0453232
1216 Ga0373953_0085373
1217 Ga0373956_0223457
1218 Ga0373960_0261219
1219 Ga0373943_0022234
1220 Ga0373943_0040512
1221 Ga0373943_0459081
1222 Ga0373943_0929200
1223 Ga0373946_0043059
1224 Ga0373942_0084053
1225 Ga0373962_0078588
1226 Ga0373924_0037896
1227 Ga0373931_0325639
1228 Ga0373931_1142471
1229 Ga0373935_0036950
1230 Ga0373935_0047298
1231 Ga0373935_1156355
1232 Ga0373927_0161496
1233 Ga0373927_0679217
1234 Ga0373933_1087114
1235 Ga0373947_0047114
1236 Ga0373947_0180656
1237 Ga0373947_0429250
1238 Ga0373947_0774937
1239 Ga0373937_0064697
1240 Ga0373925_0054995
1241 Ga0373925_0128861
1242 Ga0373925_0241649
1243 Ga0373925_0293526
1244 Ga0373925_0616936
1245 Ga0373925_0633906
1246 Ga0395899_0363811
1247 Ga0395900_0009962
1248 Ga0395905_0712238
1249 Ga0436364_0211304
1250 Ga0395901_0018755
1251 Ga0436365_1701796
1252 Ga0436363_0028360
1253 Ga0436363_0764338
1254 Ga0436362_0578505
1255 Ga0436362_0741553
1256 Ga0451791_1442531
1257 Ga0451800_1097366
1258 Ga0451807_0854782
1259 Ga0451807_1140449
1260 Ga0451839_0690170
1261 Ga0451847_0027848
1262 Ga0451853_2823564
1263 Ga0466967_0143304
1264 Ga0495651_0021210
1265 Ga0495651_0441022
1266 Ga0495653_0088901
1267 Ga0495580_0174488
1268 Ga0495582_0163700
1269 Ga0495584_0258466
1270 Ga0495584_0475587
1271 Ga0495585_0099877
1272 Ga0495583_0255403
1273 Ga0495616_0429815
1274 Ga0495630_0141821
1275 Ga0495630_1045259
1276 Ga0495637_0257317
1277 Ga0495642_0066211
1278 Ga0495652_0029626
1279 Ga0495586_0607060
1280 Ga0495587_0435746
1281 Ga0495598_0022222
1282 Ga0495621_0114564
1283 Ga0495645_0034369
1284 Ga0495667_0311444
1285 Ga0495659_0002866
1286 Ga0495659_0116765
1287 Ga0495588_0333827
1288 Ga0495657_0238608
1289 Ga0495599_0181751
1290 Ga0495599_0441031
1291 Ga0495647_0023130
1292 Ga0495647_0137706
1293 Ga0495658_0098735
1294 Ga0495658_0850372
1295 Ga0495669_0019428
1296 Ga0495613_0623329
1297 Ga0495613_0736170
1298 Ga0495670_0151368
1299 Ga0495589_0455297
1300 Ga0495600_0547291
1301 Ga0495660_0355077
1302 Ga0495604_0064731
1303 Ga0495680_0121918
1304 Ga0495683_0119658
1305 Ga0495685_032867
1306 Ga0495681_0220900
1307 Ga0495684_0082041
1308 Ga0496100_0424174
1309 Ga0496100_0585312
1310 Ga0496101_0090607
1311 Ga0496101_0395534
1312 Ga0496102_0135269
1313 Ga0496102_0764552
1314 Ga0496104_0487229
1315 Ga0496104_0590570
1316 Ga0496104_0709172
1317 Ga0496104_0977653
1318 Ga0496105_0034851
1319 Ga0496105_0191665
1320 Ga0496106_0005830
1321 Ga0496106_0048858
1322 Ga0496107_0241105
1323 Ga0496108_0469880
1324 Ga0496108_0548862
1325 Ga0496109_0032418
1326 Ga0496109_0090738
1327 Ga0496109_0429371
1328 Ga0496110_0231628
1329 Ga0496110_0289024
1330 Ga0496111_0374710
1331 Ga0496112_0018692
1332 Ga0496112_0059307
1333 Ga0496112_0162831
1334 Ga0496112_0162997
1335 Ga0496112_0225037
1336 Ga0496112_0316278
1337 Ga0496112_0478867
1338 Ga0496113_0170830
1339 Ga0496113_0258750
1340 Ga0496113_0384102
1341 Ga0496113_1165795
1342 Ga0496114_0347962
1343 Ga0496115_0006052
1344 Ga0496115_1035481
1345 nmdc:mga05p37_132841_c1
1346 nmdc:mga05p37_1558429_c1
1347 nmdc:mga09592_1611249_c1
1348 nmdc:mga0n895_168964_c1
1349 nmdc:mga0n895_171958_c1
1350 nmdc:mga0n895_384885_c1
1351 nmdc:mga0n895_522036_c1
1352 nmdc:mga0rr50_1427751_c1
1353 nmdc:mga0rr50_759004_c1
1354 nmdc:mga0a205_1399726_c1
1355 nmdc:mga0a205_422364_c1
1356 Ga0495601_0128117
1357 Ga0495655_0001395
1358 Ga0495619_0046735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dlm-assembly1.cif.gz_B dhd127 0.8617 12 77
5j2l-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8543 12 77
7upp-assembly1.cif.gz_C crystal structure of designed heterotrimeric assembly dht03_2arm_a21/b21/c long 0.8397 9 75
5ka5-assembly1.cif.gz_A hiv-1 gp41 variant v549e resistance mutation 0.8305 11 77
6dkm-assembly3.cif.gz_F dhd131 0.8169 15 73
ID Description Score Start End Superfamily
5ka5A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8305 11 77 1.10.287.210
af_C2BR97_2_309_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.8256 16 72 1.25.40.180
af_A0A1D6PP97_44_154_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8206 11 73 1.10.287.40
af_Q2R068_48_158_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.8141 12 74 1.10.287.40
5ka6B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8141 11 77 1.10.287.210
ID Description Score Start End GO Terms
AF-A0A4P5QP38-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.9218 1 79
AF-A0A7V9J3S4-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.9151 1 78
AF-A0A7V1LLY1-F1-model_v4 PAS domain S-box protein 0.9147 12 76 GO:0000155
GO:0006355
GO:0016020
AF-B4CUG0-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.9119 4 78
AF-A0A2G8JGD9-F1-model_v4 Putative serine/threonine-protein kinase SMG1-like 0.9114 10 77 GO:0000184
GO:0004674
GO:0005634

Map