F474692

General Info

Members Datasets Scaffolds Average Seq Length
678 314 650 369

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2885427238|2885427557
Length 462
Sequence LKMPALSPTMEEGTLAKWLIKEGDTVASGDILAEIETDKATMEFEAVDEGKVLKILVAEGSDGVKVGTPIAMIGEEGEEGGVAGAATAPAQAPAPADTDKEQPSPGQPAAGGSYAPTAAPPAPGGGETPTAPASPAQSGGGDGDTGYRPPPIPKGEPAARANDSARIKASPLARRLAEAQGIDLSTITGSGPGGRIVRADLGDKGGGRPSQVQPAAAPAPALQPQASQVDPGEIPHEAVKLSNMRKTIARRLTESKQQVPHIYLTVDVQLDRLLKLRAELNDGLASRGVKLSVNDMLIKALALALIEVPECNVSFAGDTLIKYSRADISVAVSIPGGLITPIIAGANDKTLSKISTEMGELAGRAKEGKLQPHEYQGGTASLSNMGMFGIKQFEAVINPPQGMIMAIGAGEKRPFVIADSLQIATVMSATGSFDHRAIDGADGARLMQAFRALCERPMGLVA

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
13 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
14 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
15 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
16 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
20 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
21 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
22 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
23 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
24 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
25 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
26 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
27 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
28 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
29 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
312 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0
Rhizoplane 5.01
Rhizosphere 78.02
Stem 0
Stem Tuber 0.15
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001126 3300001904 Bacteria 4898
2 JGI24741J21665_1000819 3300001915 Bacteria 9353
3 JGI24740J21852_10006234 3300001979 Bacteria 4962
4 JGI24740J21852_10009346 3300001979 Bacteria 3846
5 JGI24739J22299_10004115 3300001989 Bacteria 5563
6 JGI24737J22298_10001056 3300001990 Bacteria 9731
7 JGI24744J21845_10001869 3300002077 Bacteria 4226
8 JGI25165J46597_1000023 3300003214 Bacteria 338873
9 JGI25165J46597_1000095 3300003214 Bacteria 163883
10 JGI25153J46596_10000010 3300003215 Bacteria 337769
11 JGI25153J46596_10000031 3300003215 Bacteria 196926
12 Ga0055525_1000012 3300003759 Bacteria 486564
13 Ga0055542_1000322 3300003762 Bacteria 51124
14 Ga0055529_1000014 3300003763 Bacteria 367283
15 Ga0055536_1000422 3300003781 Bacteria 30230
16 Ga0055534_1004498 3300003784 Bacteria 4020
17 Ga0055530_10000013 3300003791 Bacteria 153390
18 Ga0055531_10000449 3300003794 Bacteria 38308
19 Ga0055531_10005592 3300003794 Bacteria 7320
20 Ga0065165_1003177 3300005262 Bacteria 12034
21 Ga0065704_10081931 3300005289 Bacteria 3681
22 Ga0070658_10000536 3300005327 Bacteria 32936
23 Ga0070658_10001914 3300005327 Bacteria 17560
24 Ga0070658_10002770 3300005327 Bacteria 14576
25 Ga0070658_10023150 3300005327 Bacteria 4987
26 Ga0070658_10070918 3300005327 Bacteria 2853
27 Ga0070658_10112917 3300005327 Bacteria 2252
28 Ga0070658_10145987 3300005327 Bacteria 1978
29 Ga0070676_10000031 3300005328 Bacteria 42113
30 Ga0070683_100012146 3300005329 Bacteria 7474
31 Ga0070683_100096732 3300005329 Bacteria 2777
32 Ga0070670_100000344 3300005331 Bacteria 39044
33 Ga0070670_100001938 3300005331 Bacteria 16935
34 Ga0070670_100005554 3300005331 Bacteria 10638
35 Ga0070670_100005597 3300005331 Bacteria 10598
36 Ga0070670_100007510 3300005331 Bacteria 9256
37 Ga0070670_100019126 3300005331 Bacteria 5873
38 Ga0070670_100057317 3300005331 Bacteria 3345
39 Ga0070670_100216764 3300005331 Bacteria 1665
40 Ga0070666_10000160 3300005335 Bacteria 46166
41 Ga0070666_10006279 3300005335 Bacteria 7308
42 Ga0070666_10012951 3300005335 Bacteria 5278
43 Ga0070666_10041785 3300005335 Bacteria 3065
44 Ga0070680_100006780 3300005336 Bacteria 8725
45 Ga0070680_100081701 3300005336 Bacteria 2666
46 Ga0070680_100121595 3300005336 Bacteria 2180
47 Ga0068868_100000403 3300005338 Bacteria 29340
48 Ga0068868_100039288 3300005338 Bacteria 3677
49 Ga0070660_100000700 3300005339 Bacteria 22233
50 Ga0070660_100004814 3300005339 Bacteria 9338
51 Ga0070660_100035146 3300005339 Bacteria 3792
52 Ga0070660_100035906 3300005339 Bacteria 3752
53 Ga0070660_100037408 3300005339 Bacteria 3679
54 Ga0070660_100043991 3300005339 Bacteria 3413
55 Ga0070660_100072829 3300005339 Bacteria 2685
56 Ga0070660_100101908 3300005339 Bacteria 2275
57 Ga0070661_100000130 3300005344 Bacteria 62986
58 Ga0070661_100004468 3300005344 Bacteria 9646
59 Ga0070661_100005092 3300005344 Bacteria 9069
60 Ga0070661_100023171 3300005344 Bacteria 4449
61 Ga0070661_100039939 3300005344 Bacteria 3420
62 Ga0070661_100042155 3300005344 Bacteria 3331
63 Ga0070661_100055001 3300005344 Bacteria 2915
64 Ga0070668_100000028 3300005347 Bacteria 89707
65 Ga0070668_100000049 3300005347 Bacteria 74953
66 Ga0070668_100034913 3300005347 Bacteria 3833
67 Ga0070669_100000013 3300005353 Bacteria 210577
68 Ga0070669_100000715 3300005353 Bacteria 24287
69 Ga0070669_100028017 3300005353 Bacteria 4056
70 Ga0070675_100002284 3300005354 Bacteria 14214
71 Ga0070675_100090365 3300005354 Bacteria 2565
72 Ga0070671_100000009 3300005355 Bacteria 206508
73 Ga0070671_100000269 3300005355 Bacteria 35055
74 Ga0070671_100002542 3300005355 Bacteria 14135
75 Ga0070671_100003648 3300005355 Bacteria 12059
76 Ga0070671_100007269 3300005355 Bacteria 8850
77 Ga0070671_100073908 3300005355 Bacteria 2847
78 Ga0070674_100057051 3300005356 Bacteria 2710
79 Ga0070673_100000022 3300005364 Bacteria 92156
80 Ga0070659_100013393 3300005366 Bacteria 6102
81 Ga0070659_100030333 3300005366 Bacteria 4185
82 Ga0070659_100032663 3300005366 Bacteria 4038
83 Ga0070667_100000009 3300005367 Bacteria 281488
84 Ga0070667_100004908 3300005367 Bacteria 11207
85 Ga0070667_100013603 3300005367 Bacteria 6723
86 Ga0070667_100061234 3300005367 Bacteria 3186
87 Ga0070705_100008071 3300005440 Bacteria 5206
88 Ga0070663_100001359 3300005455 Bacteria 13373
89 Ga0070663_100022084 3300005455 Bacteria 4247
90 Ga0070663_100064573 3300005455 Bacteria 2646
91 Ga0070678_100000060 3300005456 Bacteria 39901
92 Ga0070678_100097180 3300005456 Bacteria 2274
93 Ga0070662_100040801 3300005457 Bacteria 3307
94 Ga0070662_100101657 3300005457 Bacteria 2176
95 Ga0070681_10002429 3300005458 Bacteria 17046
96 Ga0068867_100000023 3300005459 Bacteria 92322
97 Ga0068867_100003900 3300005459 Bacteria 10494
98 Ga0068867_100046955 3300005459 Bacteria 3173
99 Ga0070679_100000021 3300005530 Bacteria 124652
100 Ga0070679_100016861 3300005530 Bacteria 7060
101 Ga0070679_100023181 3300005530 Bacteria 6075
102 Ga0068853_100009284 3300005539 Bacteria 7932
103 Ga0068853_100147801 3300005539 Bacteria 2113
104 Ga0070672_100219300 3300005543 Bacteria 1595
105 Ga0070686_100047865 3300005544 Bacteria 2706
106 Ga0070696_100015568 3300005546 Bacteria 5109
107 Ga0070665_100000115 3300005548 Bacteria 151164
108 Ga0070665_100002028 3300005548 Bacteria 22780
109 Ga0070665_100007685 3300005548 Bacteria 10951
110 Ga0070665_100272455 3300005548 Bacteria 1694
111 Ga0068855_100040917 3300005563 Bacteria 5497
112 Ga0068855_100230639 3300005563 Bacteria 2073
113 Ga0070664_100005447 3300005564 Bacteria 10217
114 Ga0070664_100101878 3300005564 Bacteria 2497
115 Ga0068857_100015874 3300005577 Bacteria 6591
116 Ga0068857_100025761 3300005577 Bacteria 5178
117 Ga0068854_100011704 3300005578 Bacteria 5721
118 Ga0068854_100014036 3300005578 Bacteria 5273
119 Ga0068854_100026006 3300005578 Bacteria 4018
120 Ga0068856_100004367 3300005614 Bacteria 14088
121 Ga0068856_100252040 3300005614 Bacteria 1780
122 Ga0068852_100091189 3300005616 Bacteria 2727
123 Ga0068859_100000202 3300005617 Bacteria 58573
124 Ga0068859_100141010 3300005617 Bacteria 2484
125 Ga0068859_100235364 3300005617 Bacteria 1920
126 Ga0068864_100001677 3300005618 Bacteria 18219
127 Ga0068864_100002974 3300005618 Bacteria 14012
128 Ga0068864_100143016 3300005618 Bacteria 2160
129 Ga0068851_10008051 3300005834 Bacteria 4864
130 Ga0068851_10024511 3300005834 Bacteria 2954
131 Ga0068863_100000092 3300005841 Bacteria 97076
132 Ga0068863_100006027 3300005841 Bacteria 11892
133 Ga0068863_100027707 3300005841 Bacteria 5406
134 Ga0068863_100030672 3300005841 Bacteria 5133
135 Ga0068863_100053836 3300005841 Bacteria 3815
136 Ga0068863_100071078 3300005841 Bacteria 3292
137 Ga0068858_100000261 3300005842 Bacteria 56197
138 Ga0068858_100000380 3300005842 Bacteria 46520
139 Ga0068858_100001609 3300005842 Bacteria 23039
140 Ga0068858_100042830 3300005842 Bacteria 4197
141 Ga0068858_100058043 3300005842 Bacteria 3577
142 Ga0068860_100000042 3300005843 Bacteria 227404
143 Ga0068860_100064458 3300005843 Bacteria 3480
144 Ga0068862_100000411 3300005844 Bacteria 46404
145 Ga0068862_100008302 3300005844 Bacteria 8594
146 Ga0068862_100010722 3300005844 Bacteria 7567
147 Ga0081539_10066829 3300005985 Bacteria 1947
148 Ga0075369_10025086 3300006186 Bacteria 2477
149 Ga0075366_10063596 3300006195 Bacteria 2193
150 Ga0068865_100000031 3300006881 Bacteria 88580
151 Ga0097620_100000202 3300006931 Bacteria 58573
152 Ga0097620_100141005 3300006931 Bacteria 2484
153 Ga0097620_100235363 3300006931 Bacteria 1920
154 Ga0075435_100013014 3300007076 Bacteria 6176
155 Ga0105240_10009242 3300009093 Bacteria 13982
156 Ga0105240_10021138 3300009093 Bacteria 8663
157 Ga0105240_10390038 3300009093 Bacteria 1571
158 Ga0105245_10002151 3300009098 Bacteria 17853
159 Ga0105245_10013418 3300009098 Bacteria 7137
160 Ga0105243_10000156 3300009148 Bacteria 78467
161 Ga0105243_10001186 3300009148 Bacteria 23513
162 Ga0105241_10209037 3300009174 Bacteria 1634
163 Ga0105242_10004742 3300009176 Bacteria 10529
164 Ga0105248_10001787 3300009177 Bacteria 23901
165 Ga0105248_10005414 3300009177 Bacteria 14027
166 Ga0105248_10016331 3300009177 Bacteria 8171
167 Ga0105248_10054516 3300009177 Bacteria 4484
168 Ga0105237_10005078 3300009545 Bacteria 14953
169 Ga0105237_10170457 3300009545 Bacteria 2176
170 Ga0105238_10112091 3300009551 Bacteria 2707
171 Ga0105249_10001604 3300009553 Bacteria 19800
172 Ga0105249_10004663 3300009553 Bacteria 11838
173 Ga0105249_10031092 3300009553 Bacteria 4827
174 Ga0105249_10125159 3300009553 Bacteria 2447
175 Ga0105246_10000157 3300011119 Bacteria 32454
176 Ga0157373_10019332 3300013100 Bacteria 4961
177 Ga0157373_10105584 3300013100 Bacteria 1981
178 Ga0157371_10000193 3300013102 Bacteria 90182
179 Ga0157371_10014561 3300013102 Bacteria 5931
180 Ga0157371_10130838 3300013102 Bacteria 1785
181 Ga0157370_10007287 3300013104 Bacteria 12070
182 Ga0157370_10028708 3300013104 Bacteria 5469
183 Ga0157369_10005353 3300013105 Bacteria 14954
184 Ga0157369_10056253 3300013105 Bacteria 4245
185 Ga0157369_10062188 3300013105 Bacteria 4024
186 Ga0157369_10091370 3300013105 Bacteria 3250
187 Ga0157369_10215604 3300013105 Bacteria 2011
188 Ga0157369_10264064 3300013105 Bacteria 1795
189 Ga0157374_10000656 3300013296 Bacteria 30436
190 Ga0157374_10002399 3300013296 Bacteria 15803
191 Ga0157378_10000504 3300013297 Bacteria 37070
192 Ga0163162_10017961 3300013306 Bacteria 6921
193 Ga0163162_10113135 3300013306 Bacteria 2813
194 Ga0163162_10132014 3300013306 Bacteria 2606
195 Ga0157372_10030188 3300013307 Bacteria 5927
196 Ga0157372_10060288 3300013307 Bacteria 4246
197 Ga0157375_10003473 3300013308 Bacteria 13661
198 Ga0157375_10104117 3300013308 Bacteria 2926
199 Ga0157375_10278903 3300013308 Bacteria 1834
200 Ga0163163_10136381 3300014325 Bacteria 2495
201 Ga0157380_10004583 3300014326 Bacteria 9594
202 Ga0157377_10003378 3300014745 Bacteria 7219
203 Ga0157379_10005137 3300014968 Bacteria 11231
204 Ga0157379_10224012 3300014968 Bacteria 1704
205 Ga0157376_10000124 3300014969 Bacteria 53299
206 Ga0213876_10003188 3300021384 Bacteria 9435
207 Ga0213875_10007292 3300021388 Bacteria 5723
208 Ga0209563_100030 3300025230 Bacteria 489259
209 Ga0209437_103045 3300025233 Bacteria 3099
210 Ga0209026_1002932 3300025250 Bacteria 5962
211 Ga0209677_107247 3300025253 Bacteria 2404
212 Ga0209148_1000011 3300025254 Bacteria 1196503
213 Ga0209148_1000059 3300025254 Bacteria 350224
214 Ga0209233_1000003 3300025261 Bacteria 1607366
215 Ga0209233_1000052 3300025261 Bacteria 445813
216 Ga0209455_1000006 3300025272 Bacteria 1196503
217 Ga0209675_1000025 3300025291 Bacteria 294102
218 Ga0209676_1000221 3300025292 Bacteria 124715
219 Ga0209676_1000483 3300025292 Bacteria 65133
220 Ga0209025_1010313 3300025294 Bacteria 6346
221 Ga0209758_1000001 3300025297 Bacteria 1981790
222 Ga0209758_1000033 3300025297 Bacteria 469998
223 Ga0209050_1000042 3300025298 Bacteria 402842
224 Ga0209050_1001210 3300025298 Bacteria 30282
225 Ga0209257_1000135 3300025304 Bacteria 205668
226 Ga0209257_1000532 3300025304 Bacteria 66089
227 Ga0209257_1015531 3300025304 Bacteria 3161
228 Ga0207697_10019384 3300025315 Bacteria 2786
229 Ga0207697_10033709 3300025315 Bacteria 2095
230 Ga0207656_10002880 3300025321 Bacteria 5865
231 Ga0207656_10004383 3300025321 Bacteria 4925
232 Ga0207696_1014662 3300025711 Bacteria 2681
233 Ga0207682_10002218 3300025893 Bacteria 8762
234 Ga0207680_10001079 3300025903 Bacteria 12871
235 Ga0207680_10004576 3300025903 Bacteria 6568
236 Ga0207647_10000038 3300025904 Bacteria 94897
237 Ga0207647_10024022 3300025904 Bacteria 4022
238 Ga0207647_10040387 3300025904 Bacteria 2939
239 Ga0207645_10028697 3300025907 Bacteria 3591
240 Ga0207705_10000059 3300025909 Bacteria 155683
241 Ga0207705_10000178 3300025909 Bacteria 67084
242 Ga0207705_10000237 3300025909 Bacteria 54736
243 Ga0207705_10000511 3300025909 Bacteria 33036
244 Ga0207705_10002823 3300025909 Bacteria 13285
245 Ga0207705_10014106 3300025909 Bacteria 5757
246 Ga0207705_10021462 3300025909 Bacteria 4609
247 Ga0207654_10000227 3300025911 Bacteria 34512
248 Ga0207654_10048133 3300025911 Bacteria 2439
249 Ga0207707_10034592 3300025912 Bacteria 4421
250 Ga0207695_10015591 3300025913 Bacteria 8939
251 Ga0207695_10025115 3300025913 Bacteria 6683
252 Ga0207695_10051267 3300025913 Bacteria 4335
253 Ga0207695_10080646 3300025913 Bacteria 3295
254 Ga0207671_10002570 3300025914 Bacteria 19248
255 Ga0207671_10004432 3300025914 Bacteria 13437
256 Ga0207671_10009213 3300025914 Bacteria 8280
257 Ga0207660_10003328 3300025917 Bacteria 10490
258 Ga0207660_10036415 3300025917 Bacteria 3421
259 Ga0207657_10000289 3300025919 Bacteria 53536
260 Ga0207657_10001241 3300025919 Bacteria 27265
261 Ga0207657_10001372 3300025919 Bacteria 25957
262 Ga0207657_10011870 3300025919 Bacteria 8623
263 Ga0207657_10026062 3300025919 Bacteria 5379
264 Ga0207657_10071295 3300025919 Bacteria 2942
265 Ga0207657_10077725 3300025919 Bacteria 2796
266 Ga0207657_10115251 3300025919 Bacteria 2215
267 Ga0207649_10000134 3300025920 Bacteria 63335
268 Ga0207649_10003792 3300025920 Bacteria 8244
269 Ga0207649_10004660 3300025920 Bacteria 7421
270 Ga0207649_10012897 3300025920 Bacteria 4654
271 Ga0207649_10131843 3300025920 Bacteria 1699
272 Ga0207652_10000047 3300025921 Bacteria 125286
273 Ga0207652_10005457 3300025921 Bacteria 10320
274 Ga0207652_10015360 3300025921 Bacteria 6218
275 Ga0207652_10044682 3300025921 Bacteria 3775
276 Ga0207681_10000008 3300025923 Bacteria 414329
277 Ga0207681_10002989 3300025923 Bacteria 10627
278 Ga0207681_10048215 3300025923 Bacteria 2874
279 Ga0207694_10000683 3300025924 Bacteria 30452
280 Ga0207650_10001881 3300025925 Bacteria 14819
281 Ga0207650_10018173 3300025925 Bacteria 4931
282 Ga0207650_10101789 3300025925 Bacteria 2212
283 Ga0207650_10136167 3300025925 Bacteria 1927
284 Ga0207659_10021352 3300025926 Bacteria 4296
285 Ga0207687_10000798 3300025927 Bacteria 21269
286 Ga0207664_10028396 3300025929 Bacteria 4251
287 Ga0207644_10000006 3300025931 Bacteria 408793
288 Ga0207644_10000088 3300025931 Bacteria 65977
289 Ga0207644_10000094 3300025931 Bacteria 64592
290 Ga0207644_10003333 3300025931 Bacteria 10365
291 Ga0207644_10048321 3300025931 Bacteria 3041
292 Ga0207644_10074058 3300025931 Bacteria 2498
293 Ga0207690_10001226 3300025932 Bacteria 16188
294 Ga0207690_10031664 3300025932 Bacteria 3387
295 Ga0207690_10068645 3300025932 Bacteria 2436
296 Ga0207706_10001712 3300025933 Bacteria 21630
297 Ga0207706_10053046 3300025933 Bacteria 3580
298 Ga0207686_10001385 3300025934 Bacteria 13769
299 Ga0207709_10000246 3300025935 Bacteria 66685
300 Ga0207709_10000447 3300025935 Bacteria 38701
301 Ga0207669_10000030 3300025937 Bacteria 88341
302 Ga0207669_10000989 3300025937 Bacteria 12093
303 Ga0207669_10039652 3300025937 Bacteria 2724
304 Ga0207669_10057738 3300025937 Bacteria 2364
305 Ga0207704_10000008 3300025938 Bacteria 204682
306 Ga0207691_10023274 3300025940 Bacteria 5832
307 Ga0207691_10062142 3300025940 Bacteria 3391
308 Ga0207691_10085922 3300025940 Bacteria 2823
309 Ga0207691_10287244 3300025940 Bacteria 1415
310 Ga0207711_10000946 3300025941 Bacteria 27905
311 Ga0207711_10001082 3300025941 Bacteria 26041
312 Ga0207711_10006078 3300025941 Bacteria 10202
313 Ga0207689_10000701 3300025942 Bacteria 32104
314 Ga0207689_10025288 3300025942 Bacteria 4975
315 Ga0207661_10015224 3300025944 Bacteria 5656
316 Ga0207661_10128219 3300025944 Bacteria 2169
317 Ga0207679_10028352 3300025945 Bacteria 3884
318 Ga0207679_10062649 3300025945 Bacteria 2772
319 Ga0207679_10153505 3300025945 Bacteria 1877
320 Ga0207667_10000002 3300025949 Bacteria 895662
321 Ga0207667_10006208 3300025949 Bacteria 14505
322 Ga0207667_10027810 3300025949 Bacteria 6150
323 Ga0207667_10034843 3300025949 Bacteria 5403
324 Ga0207667_10064884 3300025949 Bacteria 3810
325 Ga0207667_10161261 3300025949 Bacteria 2306
326 Ga0207667_10178536 3300025949 Bacteria 2181
327 Ga0207651_10000008 3300025960 Bacteria 204538
328 Ga0207712_10008250 3300025961 Bacteria 6584
329 Ga0207712_10033435 3300025961 Bacteria 3476
330 Ga0207668_10000076 3300025972 Bacteria 75056
331 Ga0207668_10000731 3300025972 Bacteria 20103
332 Ga0207668_10189232 3300025972 Bacteria 1630
333 Ga0207640_10002626 3300025981 Bacteria 9629
334 Ga0207640_10006133 3300025981 Bacteria 6575
335 Ga0207640_10022315 3300025981 Bacteria 3786
336 Ga0207640_10081303 3300025981 Bacteria 2215
337 Ga0207658_10000002 3300025986 Bacteria 1364188
338 Ga0207658_10001246 3300025986 Bacteria 20116
339 Ga0207658_10008943 3300025986 Bacteria 6793
340 Ga0207658_10009111 3300025986 Bacteria 6733
341 Ga0207677_10000091 3300026023 Bacteria 74163
342 Ga0207677_10010628 3300026023 Bacteria 5214
343 Ga0207703_10000253 3300026035 Bacteria 60255
344 Ga0207703_10000847 3300026035 Bacteria 30021
345 Ga0207703_10000896 3300026035 Bacteria 29159
346 Ga0207703_10001312 3300026035 Bacteria 23010
347 Ga0207703_10022154 3300026035 Bacteria 4980
348 Ga0207639_10012330 3300026041 Bacteria 5952
349 Ga0207639_10027739 3300026041 Bacteria 4128
350 Ga0207639_10061676 3300026041 Bacteria 2897
351 Ga0207639_10266005 3300026041 Bacteria 1502
352 Ga0207678_10001389 3300026067 Bacteria 22281
353 Ga0207678_10002781 3300026067 Bacteria 15861
354 Ga0207678_10079085 3300026067 Bacteria 2816
355 Ga0207702_10011067 3300026078 Bacteria 7531
356 Ga0207702_10034470 3300026078 Bacteria 4232
357 Ga0207702_10115054 3300026078 Bacteria 2398
358 Ga0207702_10150367 3300026078 Bacteria 2117
359 Ga0207702_10213199 3300026078 Bacteria 1796
360 Ga0207641_10000004 3300026088 Bacteria 481088
361 Ga0207641_10001025 3300026088 Bacteria 28336
362 Ga0207641_10004732 3300026088 Bacteria 11737
363 Ga0207641_10006197 3300026088 Bacteria 10119
364 Ga0207641_10007148 3300026088 Bacteria 9321
365 Ga0207641_10032708 3300026088 Bacteria 4319
366 Ga0207648_10000009 3300026089 Bacteria 204229
367 Ga0207648_10016823 3300026089 Bacteria 6668
368 Ga0207648_10032807 3300026089 Bacteria 4582
369 Ga0207676_10001115 3300026095 Bacteria 20336
370 Ga0207676_10012257 3300026095 Bacteria 6136
371 Ga0207676_10068907 3300026095 Bacteria 2831
372 Ga0207674_10003055 3300026116 Bacteria 20711
373 Ga0207674_10012450 3300026116 Bacteria 9506
374 Ga0207674_10023243 3300026116 Bacteria 6641
375 Ga0207674_10024567 3300026116 Bacteria 6435
376 Ga0207674_10060765 3300026116 Bacteria 3821
377 Ga0207675_100006088 3300026118 Bacteria 11475
378 Ga0207675_100031426 3300026118 Bacteria 4946
379 Ga0207683_10000075 3300026121 Bacteria 77829
380 Ga0207683_10014781 3300026121 Bacteria 6644
381 Ga0207683_10019752 3300026121 Bacteria 5755
382 Ga0207683_10127463 3300026121 Bacteria 2288
383 Ga0207683_10143593 3300026121 Bacteria 2151
384 Ga0207683_10177557 3300026121 Bacteria 1930
385 Ga0207683_10303379 3300026121 Bacteria 1461
386 Ga0207698_10008427 3300026142 Bacteria 6521
387 Ga0268266_10000015 3300028379 Bacteria 630629
388 Ga0268266_10005032 3300028379 Bacteria 12478
389 Ga0268266_10030749 3300028379 Bacteria 4561
390 Ga0268266_10037453 3300028379 Bacteria 4132
391 Ga0268265_10000392 3300028380 Bacteria 46740
392 Ga0268265_10000582 3300028380 Bacteria 36910
393 Ga0268265_10028903 3300028380 Bacteria 3974
394 Ga0268265_10070971 3300028380 Bacteria 2710
395 Ga0268265_10103527 3300028380 Bacteria 2305
396 Ga0268264_10000001 3300028381 Bacteria 1221000
397 Ga0268264_10000310 3300028381 Bacteria 78142
398 Ga0268264_10004774 3300028381 Bacteria 11499
399 Ga0307517_10074308 3300028786 Bacteria 2999
400 Ga0307515_10259608 3300028794 Bacteria 1476
401 Ga0265320_10082223 3300031240 Bacteria 1502
402 Ga0307513_10008420 3300031456 Bacteria 13207
403 Ga0307513_10043231 3300031456 Bacteria 4952
404 Ga0307408_100006783 3300031548 Bacteria 7590
405 Ga0307408_100011783 3300031548 Bacteria 5783
406 Ga0307408_100023154 3300031548 Bacteria 4228
407 Ga0307408_100046549 3300031548 Bacteria 3103
408 Ga0307508_10000317 3300031616 Bacteria 58176
409 Ga0307405_10021699 3300031731 Bacteria 3615
410 Ga0307405_10118278 3300031731 Bacteria 1808
411 Ga0307405_10151293 3300031731 Bacteria 1632
412 Ga0307413_10010952 3300031824 Bacteria 4430
413 Ga0307413_10034949 3300031824 Bacteria 2878
414 Ga0307413_10120854 3300031824 Bacteria 1774
415 Ga0307410_10003471 3300031852 Bacteria 7910
416 Ga0307410_10055511 3300031852 Bacteria 2689
417 Ga0307410_10065496 3300031852 Bacteria 2499
418 Ga0307410_10075957 3300031852 Bacteria 2344
419 Ga0307410_10089542 3300031852 Bacteria 2181
420 Ga0307410_10124425 3300031852 Bacteria 1885
421 Ga0307406_10022142 3300031901 Bacteria 3768
422 Ga0307406_10088807 3300031901 Bacteria 2075
423 Ga0307406_10124168 3300031901 Bacteria 1800
424 Ga0307407_10053599 3300031903 Bacteria 2321
425 Ga0307407_10079225 3300031903 Bacteria 1981
426 Ga0307412_10000557 3300031911 Bacteria 22165
427 Ga0307412_10001749 3300031911 Bacteria 12005
428 Ga0307412_10005086 3300031911 Bacteria 7355
429 Ga0307412_10027029 3300031911 Bacteria 3573
430 Ga0307412_10083568 3300031911 Bacteria 2214
431 Ga0307412_10093027 3300031911 Bacteria 2114
432 Ga0307412_10123685 3300031911 Bacteria 1867
433 Ga0307409_100010084 3300031995 Bacteria 5847
434 Ga0307409_100028665 3300031995 Bacteria 3971
435 Ga0307409_100037418 3300031995 Bacteria 3578
436 Ga0307409_100052098 3300031995 Bacteria 3136
437 Ga0307409_100139807 3300031995 Bacteria 2084
438 Ga0307409_100183054 3300031995 Bacteria 1857
439 Ga0307416_100016486 3300032002 Bacteria 5139
440 Ga0307416_100087366 3300032002 Bacteria 2661
441 Ga0307416_100251629 3300032002 Bacteria 1720
442 Ga0307414_10000288 3300032004 Bacteria 29634
443 Ga0307414_10006350 3300032004 Bacteria 6585
444 Ga0307414_10015729 3300032004 Bacteria 4576
445 Ga0307414_10018174 3300032004 Bacteria 4320
446 Ga0307414_10070228 3300032004 Bacteria 2521
447 Ga0307414_10081531 3300032004 Bacteria 2369
448 Ga0307414_10085284 3300032004 Bacteria 2326
449 Ga0307414_10170380 3300032004 Bacteria 1740
450 Ga0307411_10005369 3300032005 Bacteria 6285
451 Ga0307411_10005662 3300032005 Bacteria 6165
452 Ga0307411_10008930 3300032005 Bacteria 5231
453 Ga0307411_10009704 3300032005 Bacteria 5082
454 Ga0307411_10043799 3300032005 Bacteria 2865
455 Ga0307411_10059278 3300032005 Bacteria 2537
456 Ga0307411_10084853 3300032005 Bacteria 2192
457 Ga0307411_10198859 3300032005 Bacteria 1537
458 Ga0307415_100007272 3300032126 Bacteria 6047
459 Ga0307415_100018321 3300032126 Bacteria 4225
460 Ga0307415_100216765 3300032126 Bacteria 1531
461 Ga0316583_10003553 3300032133 Bacteria 5502
462 Ga0307510_10005954 3300033180 Bacteria 14551
463 Ga0316584_0129385 3300036712 Bacteria 1886
464 Ga0395899_0000406 3300037312 Bacteria 50248
465 Ga0395899_0065327 3300037312 Bacteria 2674
466 Ga0395899_0091624 3300037312 Bacteria 2202
467 Ga0395899_0188444 3300037312 Bacteria 1444
468 Ga0395900_0004543 3300037418 Bacteria 14685
469 Ga0395900_0009343 3300037418 Bacteria 10053
470 Ga0395900_0009895 3300037418 Bacteria 9765
471 Ga0395900_0012195 3300037418 Bacteria 8786
472 Ga0395900_0033345 3300037418 Bacteria 5299
473 Ga0395900_0055176 3300037418 Bacteria 4091
474 Ga0395898_0001585 3300037466 Bacteria 31078
475 Ga0395898_0023344 3300037466 Bacteria 6251
476 Ga0395898_0047627 3300037466 Bacteria 4206
477 Ga0395905_0000089 3300037471 Bacteria 152196
478 Ga0395905_0000412 3300037471 Bacteria 60157
479 Ga0395905_0002105 3300037471 Bacteria 22623
480 Ga0395905_0014350 3300037471 Bacteria 7570
481 Ga0395905_0020721 3300037471 Bacteria 6225
482 Ga0395905_0025055 3300037471 Bacteria 5626
483 Ga0395905_0053079 3300037471 Bacteria 3795
484 Ga0395905_0083023 3300037471 Bacteria 3002
485 Ga0395905_0101480 3300037471 Bacteria 2701
486 Ga0436364_1247405 3300037853 Bacteria 1652
487 Ga0436364_1473539 3300037853 Bacteria 7661
488 Ga0395901_0005879 3300038443 Bacteria 12416
489 Ga0395901_0089589 3300038443 Bacteria 3219
490 Ga0436365_1311515 3300039437 Bacteria 11736
491 Ga0436365_1658932 3300039437 Bacteria 3238
492 Ga0436363_1537430 3300039450 Bacteria 2076
493 Ga0439461_0000051 3300041410 Bacteria 14159
494 Ga0439465_0001873 3300041413 Bacteria 6876
495 Ga0439431_0000131 3300041997 Bacteria 13310
496 Ga0439432_016384 3300042006 Bacteria 2495
497 Ga0439452_021228 3300042010 Bacteria 1695
498 Ga0439462_0002208 3300042015 Bacteria 4491
499 Ga0450905_003187 3300042142 Bacteria 2151
500 Ga0439434_0002140 3300042435 Bacteria 5719
501 Ga0466969_0002077 3300044656 Bacteria 10693
502 Ga0466966_0000003 3300044684 Bacteria 233677
503 Ga0466966_0029684 3300044684 Bacteria 3555
504 Ga0466961_0009726 3300044693 Bacteria 6120
505 Ga0466961_0064150 3300044693 Bacteria 2334
506 Ga0466971_0036363 3300044719 Bacteria 2208
507 Ga0466970_0022735 3300044765 Bacteria 3271
508 Ga0466957_0000273 3300044842 Bacteria 25062
509 Ga0466959_0005743 3300045049 Bacteria 8536
510 Ga0466959_0038923 3300045049 Bacteria 3513
511 Ga0451576_0000007 3300045051 Bacteria 782228
512 Ga0466958_0013352 3300045836 Bacteria 4674
513 Ga0466958_0074798 3300045836 Bacteria 2077
514 Ga0495638_0000128 3300046460 Bacteria 123567
515 Ga0495650_0000259 3300046471 Bacteria 102151
516 Ga0495585_0005032 3300046492 Bacteria 8431
517 Ga0495596_0000053 3300046500 Bacteria 84061
518 Ga0495596_0006657 3300046500 Bacteria 5290
519 Ga0495583_0001674 3300046506 Bacteria 21461
520 Ga0495583_0026464 3300046506 Bacteria 2875
521 Ga0495606_0000029 3300046507 Bacteria 250473
522 Ga0495616_0000140 3300046513 Bacteria 63080
523 Ga0495643_0002012 3300046522 Bacteria 16962
524 Ga0495643_0002280 3300046522 Bacteria 15503
525 Ga0495643_0023318 3300046522 Bacteria 3519
526 Ga0495648_0001484 3300046524 Bacteria 22938
527 Ga0495648_0099235 3300046524 Bacteria 1611
528 Ga0495663_0003305 3300046525 Bacteria 4670
529 Ga0495598_0000495 3300046537 Bacteria 7257
530 Ga0495609_0016952 3300046538 Bacteria 3389
531 Ga0495621_0000055 3300046539 Bacteria 21830
532 Ga0495621_0042758 3300046539 Bacteria 1596
533 Ga0495597_0024651 3300046542 Bacteria 2775
534 Ga0495633_0001942 3300046558 Bacteria 15031
535 Ga0495633_0003568 3300046558 Bacteria 10287
536 Ga0495668_0000016 3300046616 Bacteria 438197
537 Ga0495625_0000092 3300046660 Bacteria 146172
538 Ga0495625_0033599 3300046660 Bacteria 3791
539 Ga0495625_0072697 3300046660 Bacteria 2411
540 Ga0495659_0030286 3300046664 Bacteria 1883
541 Ga0495669_0000039 3300046684 Bacteria 92973
542 Ga0495670_0000015 3300046691 Bacteria 131137
543 Ga0495670_0000771 3300046691 Bacteria 15356
544 Ga0495671_0023659 3300046692 Bacteria 3208
545 Ga0495649_0032522 3300046694 Bacteria 2872
546 Ga0495600_0008265 3300046809 Bacteria 6388
547 Ga0495683_0008020 3300047323 Bacteria 5670
548 Ga0495683_0028132 3300047323 Bacteria 2874
549 Ga0495687_000471 3300047443 Bacteria 48815
550 Ga0495687_001946 3300047443 Bacteria 17689
551 Ga0495677_0004870 3300047445 Bacteria 5119
552 Ga0495677_0007290 3300047445 Bacteria 4137
553 Ga0495686_0000486 3300047472 Bacteria 58640
554 Ga0496101_0010489 3300048904 Bacteria 6120
555 Ga0496101_0020877 3300048904 Bacteria 4492
556 Ga0496102_0000961 3300048905 Bacteria 27087
557 Ga0496102_0013728 3300048905 Bacteria 7024
558 Ga0496102_0101584 3300048905 Bacteria 2672
559 Ga0496103_0000038 3300048906 Bacteria 178822
560 Ga0496103_0000145 3300048906 Bacteria 74388
561 Ga0496104_0000123 3300048907 Bacteria 71754
562 Ga0496104_0014613 3300048907 Bacteria 7092
563 Ga0496105_0000165 3300048908 Bacteria 43988
564 Ga0496105_0000218 3300048908 Bacteria 38487
565 Ga0496106_0004503 3300048909 Bacteria 10324
566 Ga0496107_0012337 3300048910 Bacteria 5966
567 Ga0496107_0106512 3300048910 Bacteria 2059
568 Ga0496108_0035205 3300048911 Bacteria 4162
569 Ga0496109_0010877 3300048912 Bacteria 7791
570 Ga0496109_0013659 3300048912 Bacteria 7053
571 Ga0496109_0026058 3300048912 Bacteria 5211
572 Ga0496109_0264400 3300048912 Bacteria 1621
573 Ga0496110_0013061 3300048913 Bacteria 6852
574 Ga0496110_0015697 3300048913 Bacteria 6310
575 Ga0496110_0026321 3300048913 Bacteria 4976
576 Ga0496112_0002145 3300048915 Bacteria 15663
577 Ga0496112_0008161 3300048915 Bacteria 9358
578 Ga0496112_0045754 3300048915 Bacteria 4290
579 Ga0496113_0009075 3300048916 Bacteria 6516
580 Ga0496113_0056657 3300048916 Bacteria 2943
581 Ga0496113_0095054 3300048916 Bacteria 2303
582 Ga0496114_0002180 3300048917 Bacteria 14904
583 Ga0496114_0002905 3300048917 Bacteria 13135
584 Ga0496114_0025594 3300048917 Bacteria 4825
585 Ga0496115_0001038 3300048918 Bacteria 20173
586 Ga0496116_0001809 3300048919 Bacteria 23171
587 Ga0496116_0012660 3300048919 Bacteria 6868
588 Ga0496117_0000910 3300048920 Bacteria 45331
589 Ga0496117_0018333 3300048920 Bacteria 5803
590 Ga0496118_0000091 3300048921 Bacteria 173092
591 Ga0496118_0009440 3300048921 Bacteria 9847
592 Ga0496119_0001044 3300048922 Bacteria 35405
593 Ga0496120_0001555 3300048923 Bacteria 26843
594 Ga0496121_0000105 3300048924 Bacteria 191437
595 Ga0496121_0000168 3300048924 Bacteria 144896
596 Ga0496121_0000429 3300048924 Bacteria 82577
597 Ga0496121_0016537 3300048924 Bacteria 7609
598 Ga0496121_0033641 3300048924 Bacteria 4634
599 Ga0496122_0001814 3300048925 Bacteria 32677
600 Ga0496122_0029994 3300048925 Bacteria 4569
601 Ga0496123_0003740 3300048926 Bacteria 16680
602 Ga0496124_0000375 3300048927 Bacteria 81352
603 Ga0496124_0000414 3300048927 Bacteria 76734
604 Ga0496124_0005478 3300048927 Bacteria 14255
605 Ga0496124_0062935 3300048927 Bacteria 3102
606 Ga0496125_0001376 3300048928 Bacteria 35709
607 Ga0496125_0003787 3300048928 Bacteria 17978
608 Ga0496125_0005261 3300048928 Bacteria 14490
609 Ga0496125_0056100 3300048928 Bacteria 3202
610 Ga0496125_0098343 3300048928 Bacteria 2165
611 Ga0496126_0000066 3300048929 Bacteria 252188
612 Ga0496126_0000443 3300048929 Bacteria 82811
613 Ga0501032_0228635 3300049569 Bacteria 1210
614 Ga0501034_0202814 3300049571 Bacteria 1941
615 Ga0501038_0032224 3300049574 Bacteria 4626
616 Ga0501047_0153998 3300049581 Bacteria 2173
617 Ga0501073_0020655 3300049589 Bacteria 4750
618 Ga0501076_0012864 3300049592 Bacteria 6262
619 Ga0501076_0249211 3300049592 Bacteria 1453
620 Ga0501083_0074086 3300049744 Bacteria 2262
621 Ga0501044_0310278 3300049823 Bacteria 1504
622 nmdc:mga0rr50_9616_c1 3300050513 Bacteria 6090
623 Ga0500610_0000231 3300053079 Bacteria 16928
624 Ga0500643_000030 3300053087 Bacteria 206784
625 Ga0500643_000465 3300053087 Bacteria 29876
626 Ga0500643_007628 3300053087 Bacteria 4336
627 Ga0500651_0019900 3300053093 Bacteria 4176
628 Ga0500556_0000014 3300053104 Bacteria 232989
629 Ga0500592_003087 3300053116 Bacteria 2662
630 Ga0500594_0003951 3300053118 Bacteria 3267
631 Ga0500595_001729 3300053119 Bacteria 11391
632 Ga0500595_004099 3300053119 Bacteria 6607
633 Ga0500608_000280 3300053122 Bacteria 19747
634 Ga0500642_0000001 3300053130 Bacteria 1468402
635 Ga0500642_0000596 3300053130 Bacteria 10818
636 Ga0500642_0013317 3300053130 Bacteria 3018
637 Ga0500658_0008056 3300053134 Bacteria 3894
638 Ga0500559_0062643 3300053136 Bacteria 1661
639 Ga0500564_000953 3300053138 Bacteria 9400
640 Ga0500573_0000271 3300053140 Bacteria 21909
641 Ga0500588_0001660 3300053146 Bacteria 4308
642 Ga0500604_0000027 3300053151 Bacteria 62112
643 Ga0500604_0000984 3300053151 Bacteria 7930
644 Ga0500616_0000730 3300053153 Bacteria 38013
645 Ga0500636_0000462 3300053177 Bacteria 22121
646 Ga0500567_000811 3300053723 Bacteria 11764
647 Ga0500625_000006 3300053729 Bacteria 206258
648 Ga0500645_000002 3300053730 Bacteria 388892
649 Ga0500645_000315 3300053730 Bacteria 34548
650 Ga0466962_0004869 3300061719 Bacteria 6457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0249211 Ga0501076_0249211_93_1058 279
2 3300049569 Ga0501032_0228635 Ga0501032_0228635_176_1138 282
3 3300005327 Ga0070658_10000536 Ga0070658_1000053610 315
4 3300025909 Ga0207705_10000178 Ga0207705_1000017816 315
5 3300053116 Ga0500592_003087 Ga0500592_003087_839_2086 315
6 3300003214 JGI25165J46597_1000023 JGI25165J46597_100002376 318
7 3300025250 Ga0209026_1002932 Ga0209026_10029326 318
8 3300025261 Ga0209233_1000003 Ga0209233_1000003915 318
9 3300005327 Ga0070658_10145987 Ga0070658_101459871 319
10 3300005344 Ga0070661_100000130 Ga0070661_10000013035 319
11 3300013105 Ga0157369_10215604 Ga0157369_102156042 319
12 3300025920 Ga0207649_10000134 Ga0207649_1000013422 319
13 3300025949 Ga0207667_10034843 Ga0207667_100348432 319
14 3300049571 Ga0501034_0202814 Ga0501034_0202814_562_1860 319
15 3300031731 Ga0307405_10151293 Ga0307405_101512932 320
16 3300002077 JGI24744J21845_10001869 JGI24744J21845_100018696 321
17 3300005336 Ga0070680_100121595 Ga0070680_1001215952 321
18 3300005530 Ga0070679_100000021 Ga0070679_10000002139 321
19 3300009093 Ga0105240_10390038 Ga0105240_103900382 321
20 3300013307 Ga0157372_10030188 Ga0157372_100301883 321
21 3300025254 Ga0209148_1000059 Ga0209148_1000059323 321
22 3300025912 Ga0207707_10034592 Ga0207707_100345923 321
23 3300025917 Ga0207660_10003328 Ga0207660_100033282 321
24 3300025921 Ga0207652_10000047 Ga0207652_1000004739 321
25 3300026121 Ga0207683_10019752 Ga0207683_100197526 321
26 3300037312 Ga0395899_0091624 Ga0395899_0091624_37_1278 321
27 3300005344 Ga0070661_100042155 Ga0070661_1000421554 322
28 3300021388 Ga0213875_10007292 Ga0213875_100072924 322
29 3300025909 Ga0207705_10000059 Ga0207705_10000059135 322
30 3300025913 Ga0207695_10051267 Ga0207695_100512674 322
31 3300025913 Ga0207695_10080646 Ga0207695_100806463 322
32 3300025920 Ga0207649_10004660 Ga0207649_100046608 322
33 3300031852 Ga0307410_10065496 Ga0307410_100654962 322
34 3300032005 Ga0307411_10198859 Ga0307411_101988591 322
35 3300037853 Ga0436364_1473539 Ga0436364_1473539_4029_5378 322
36 3300053136 Ga0500559_0062643 Ga0500559_0062643_366_1643 322
37 3300005328 Ga0070676_10000031 Ga0070676_1000003143 323
38 3300005339 Ga0070660_100000700 Ga0070660_10000070016 323
39 3300005578 Ga0068854_100011704 Ga0068854_1000117047 323
40 3300009093 Ga0105240_10021138 Ga0105240_100211387 323
41 3300013105 Ga0157369_10056253 Ga0157369_100562536 323
42 3300013297 Ga0157378_10000504 Ga0157378_100005044 323
43 3300025913 Ga0207695_10015591 Ga0207695_100155917 323
44 3300025919 Ga0207657_10001372 Ga0207657_1000137212 323
45 3300025981 Ga0207640_10002626 Ga0207640_100026267 323
46 3300031548 Ga0307408_100023154 Ga0307408_1000231545 323
47 3300032005 Ga0307411_10009704 Ga0307411_100097041 323
48 3300037312 Ga0395899_0000406 Ga0395899_0000406_16638_17921 323
49 3300005338 Ga0068868_100000403 Ga0068868_10000040329 324
50 3300005344 Ga0070661_100055001 Ga0070661_1000550013 324
51 3300005364 Ga0070673_100000022 Ga0070673_10000002270 324
52 3300005459 Ga0068867_100000023 Ga0068867_10000002328 324
53 3300006881 Ga0068865_100000031 Ga0068865_10000003170 324
54 3300009098 Ga0105245_10013418 Ga0105245_100134185 324
55 3300009148 Ga0105243_10000156 Ga0105243_1000015631 324
56 3300009176 Ga0105242_10004742 Ga0105242_1000474216 324
57 3300009553 Ga0105249_10031092 Ga0105249_100310926 324
58 3300013296 Ga0157374_10000656 Ga0157374_1000065616 324
59 3300013308 Ga0157375_10003473 Ga0157375_1000347312 324
60 3300014745 Ga0157377_10003378 Ga0157377_100033787 324
61 3300014969 Ga0157376_10000124 Ga0157376_100001244 324
62 3300025934 Ga0207686_10001385 Ga0207686_100013855 324
63 3300025935 Ga0207709_10000447 Ga0207709_1000044732 324
64 3300025938 Ga0207704_10000008 Ga0207704_10000008154 324
65 3300025940 Ga0207691_10023274 Ga0207691_100232744 324
66 3300025942 Ga0207689_10000701 Ga0207689_100007013 324
67 3300025960 Ga0207651_10000008 Ga0207651_1000000870 324
68 3300025961 Ga0207712_10033435 Ga0207712_100334356 324
69 3300026023 Ga0207677_10000091 Ga0207677_1000009151 324
70 3300026089 Ga0207648_10000009 Ga0207648_1000000970 324
71 3300031824 Ga0307413_10034949 Ga0307413_100349493 324
72 3300061719 Ga0466962_0004869 Ga0466962_0004869_1326_2609 324
73 3300005331 Ga0070670_100005554 Ga0070670_1000055543 325
74 3300005331 Ga0070670_100216764 Ga0070670_1002167642 325
75 3300005355 Ga0070671_100002542 Ga0070671_1000025429 325
76 3300005985 Ga0081539_10066829 Ga0081539_100668292 325
77 3300013296 Ga0157374_10002399 Ga0157374_100023997 325
78 3300025925 Ga0207650_10018173 Ga0207650_100181734 325
79 3300025925 Ga0207650_10136167 Ga0207650_101361672 325
80 3300025931 Ga0207644_10003333 Ga0207644_100033339 325
81 3300026078 Ga0207702_10213199 Ga0207702_102131992 325
82 3300031731 Ga0307405_10021699 Ga0307405_100216993 325
83 3300031901 Ga0307406_10022142 Ga0307406_100221423 325
84 3300032002 Ga0307416_100016486 Ga0307416_1000164865 325
85 3300044656 Ga0466969_0002077 Ga0466969_0002077_7867_9153 325
86 3300044684 Ga0466966_0000003 Ga0466966_0000003_18718_20040 325
87 3300044684 Ga0466966_0029684 Ga0466966_0029684_1141_2427 325
88 3300044693 Ga0466961_0064150 Ga0466961_0064150_989_2275 325
89 3300044719 Ga0466971_0036363 Ga0466971_0036363_291_1577 325
90 3300044765 Ga0466970_0022735 Ga0466970_0022735_527_1813 325
91 3300044842 Ga0466957_0000273 Ga0466957_0000273_20007_21293 325
92 3300045836 Ga0466958_0013352 Ga0466958_0013352_2758_4044 325
93 3300005331 Ga0070670_100007510 Ga0070670_1000075109 326
94 3300005354 Ga0070675_100002284 Ga0070675_10000228412 326
95 3300005356 Ga0070674_100057051 Ga0070674_1000570513 326
96 3300009177 Ga0105248_10016331 Ga0105248_100163312 326
97 3300013308 Ga0157375_10278903 Ga0157375_102789033 326
98 3300025893 Ga0207682_10002218 Ga0207682_100022189 326
99 3300025925 Ga0207650_10101789 Ga0207650_101017894 326
100 3300025926 Ga0207659_10021352 Ga0207659_100213525 326
101 3300025933 Ga0207706_10053046 Ga0207706_100530465 326
102 3300025937 Ga0207669_10039652 Ga0207669_100396523 326
103 3300025941 Ga0207711_10006078 Ga0207711_100060781 326
104 3300026121 Ga0207683_10143593 Ga0207683_101435933 326
105 3300031903 Ga0307407_10053599 Ga0307407_100535992 326
106 3300032004 Ga0307414_10006350 Ga0307414_100063506 326
107 3300032005 Ga0307411_10084853 Ga0307411_100848532 326
108 3300032126 Ga0307415_100007272 Ga0307415_1000072727 326
109 3300032126 Ga0307415_100216765 Ga0307415_1002167652 326
110 3300038443 Ga0395901_0089589 Ga0395901_0089589_197_1513 326
111 3300046558 Ga0495633_0001942 Ga0495633_0001942_8098_9381 326
112 3300048917 Ga0496114_0002180 Ga0496114_0002180_9612_10901 326
113 3300003784 Ga0055534_1004498 Ga0055534_10044983 327
114 3300003791 Ga0055530_10000013 Ga0055530_1000001355 327
115 3300003794 Ga0055531_10005592 Ga0055531_100055928 327
116 3300005331 Ga0070670_100057317 Ga0070670_1000573173 327
117 3300005455 Ga0070663_100001359 Ga0070663_1000013597 327
118 3300005546 Ga0070696_100015568 Ga0070696_1000155686 327
119 3300005548 Ga0070665_100002028 Ga0070665_10000202818 327
120 3300005842 Ga0068858_100001609 Ga0068858_10000160915 327
121 3300009174 Ga0105241_10209037 Ga0105241_102090372 327
122 3300013105 Ga0157369_10005353 Ga0157369_1000535319 327
123 3300025291 Ga0209675_1000025 Ga0209675_10000258 327
124 3300025292 Ga0209676_1000221 Ga0209676_100022154 327
125 3300025294 Ga0209025_1010313 Ga0209025_10103135 327
126 3300025298 Ga0209050_1000042 Ga0209050_1000042333 327
127 3300025304 Ga0209257_1000135 Ga0209257_100013554 327
128 3300025932 Ga0207690_10068645 Ga0207690_100686454 327
129 3300026035 Ga0207703_10000847 Ga0207703_1000084716 327
130 3300026067 Ga0207678_10002781 Ga0207678_1000278117 327
131 3300026067 Ga0207678_10079085 Ga0207678_100790851 327
132 3300028379 Ga0268266_10005032 Ga0268266_100050327 327
133 3300031903 Ga0307407_10079225 Ga0307407_100792251 327
134 3300037471 Ga0395905_0020721 Ga0395905_0020721_1052_2335 327
135 3300041410 Ga0439461_0000051 Ga0439461_0000051_1457_2761 327
136 3300041413 Ga0439465_0001873 Ga0439465_0001873_3383_4687 327
137 3300041997 Ga0439431_0000131 Ga0439431_0000131_2923_4227 327
138 3300042006 Ga0439432_016384 Ga0439432_016384_589_1893 327
139 3300042010 Ga0439452_021228 Ga0439452_021228_70_1374 327
140 3300042015 Ga0439462_0002208 Ga0439462_0002208_595_1899 327
141 3300042435 Ga0439434_0002140 Ga0439434_0002140_3792_5096 327
142 3300048911 Ga0496108_0035205 Ga0496108_0035205_1450_2736 327
143 3300048912 Ga0496109_0013659 Ga0496109_0013659_1591_2877 327
144 3300048913 Ga0496110_0015697 Ga0496110_0015697_2186_3472 327
145 3300048916 Ga0496113_0056657 Ga0496113_0056657_1178_2464 327
146 3300048928 Ga0496125_0098343 Ga0496125_0098343_581_1867 327
147 3300053130 Ga0500642_0000596 Ga0500642_0000596_1605_2894 327
148 3300053151 Ga0500604_0000027 Ga0500604_0000027_25702_26994 327
149 3300053153 Ga0500616_0000730 Ga0500616_0000730_11648_12958 327
150 3300005339 Ga0070660_100072829 Ga0070660_1000728293 328
151 3300005339 Ga0070660_100101908 Ga0070660_1001019082 328
152 3300005366 Ga0070659_100030333 Ga0070659_1000303334 328
153 3300005366 Ga0070659_100032663 Ga0070659_1000326635 328
154 3300005618 Ga0068864_100143016 Ga0068864_1001430163 328
155 3300009177 Ga0105248_10001787 Ga0105248_1000178712 328
156 3300021384 Ga0213876_10003188 Ga0213876_1000318811 328
157 3300025919 Ga0207657_10077725 Ga0207657_100777253 328
158 3300025931 Ga0207644_10048321 Ga0207644_100483213 328
159 3300025932 Ga0207690_10031664 Ga0207690_100316645 328
160 3300025940 Ga0207691_10085922 Ga0207691_100859223 328
161 3300025941 Ga0207711_10001082 Ga0207711_1000108222 328
162 3300026095 Ga0207676_10068907 Ga0207676_100689072 328
163 3300031731 Ga0307405_10118278 Ga0307405_101182783 328
164 3300031995 Ga0307409_100010084 Ga0307409_1000100845 328
165 3300032126 Ga0307415_100018321 Ga0307415_1000183216 328
166 3300039437 Ga0436365_1311515 Ga0436365_1311515_672_1973 328
167 3300042142 Ga0450905_003187 Ga0450905_003187_80_1396 328
168 3300045049 Ga0466959_0005743 Ga0466959_0005743_2705_4081 328
169 3300048904 Ga0496101_0010489 Ga0496101_0010489_553_1869 328
170 3300048909 Ga0496106_0004503 Ga0496106_0004503_3596_4912 328
171 3300048910 Ga0496107_0012337 Ga0496107_0012337_4350_5666 328
172 3300048912 Ga0496109_0010877 Ga0496109_0010877_2293_3609 328
173 3300048913 Ga0496110_0026321 Ga0496110_0026321_3100_4416 328
174 3300048915 Ga0496112_0002145 Ga0496112_0002145_430_1746 328
175 3300005327 Ga0070658_10002770 Ga0070658_100027709 329
176 3300005355 Ga0070671_100007269 Ga0070671_1000072695 329
177 3300005548 Ga0070665_100272455 Ga0070665_1002724551 329
178 3300005617 Ga0068859_100000202 Ga0068859_10000020223 329
179 3300005841 Ga0068863_100053836 Ga0068863_1000538361 329
180 3300005843 Ga0068860_100064458 Ga0068860_1000644583 329
181 3300006931 Ga0097620_100000202 Ga0097620_10000020237 329
182 3300013102 Ga0157371_10130838 Ga0157371_101308382 329
183 3300025711 Ga0207696_1014662 Ga0207696_10146623 329
184 3300025909 Ga0207705_10002823 Ga0207705_100028239 329
185 3300025949 Ga0207667_10178536 Ga0207667_101785361 329
186 3300025972 Ga0207668_10000731 Ga0207668_1000073118 329
187 3300025986 Ga0207658_10001246 Ga0207658_100012466 329
188 3300026035 Ga0207703_10022154 Ga0207703_100221544 329
189 3300028379 Ga0268266_10037453 Ga0268266_100374531 329
190 3300028381 Ga0268264_10000310 Ga0268264_1000031044 329
191 3300032005 Ga0307411_10059278 Ga0307411_100592782 329
192 3300037312 Ga0395899_0065327 Ga0395899_0065327_1088_2386 329
193 3300037418 Ga0395900_0009343 Ga0395900_0009343_7213_8511 329
194 3300037466 Ga0395898_0023344 Ga0395898_0023344_2497_3777 329
195 3300037471 Ga0395905_0000412 Ga0395905_0000412_51307_52605 329
196 3300037471 Ga0395905_0083023 Ga0395905_0083023_520_1815 329
197 3300038443 Ga0395901_0005879 Ga0395901_0005879_2872_4170 329
198 3300048921 Ga0496118_0009440 Ga0496118_0009440_5697_7181 329
199 3300048927 Ga0496124_0062935 Ga0496124_0062935_1495_2979 329
200 3300053119 Ga0500595_004099 Ga0500595_004099_5337_6593 329
201 3300009551 Ga0105238_10112091 Ga0105238_101120912 330
202 3300025945 Ga0207679_10028352 Ga0207679_100283524 330
203 3300031616 Ga0307508_10000317 Ga0307508_1000031735 330
204 3300031901 Ga0307406_10088807 Ga0307406_100888072 330
205 3300031911 Ga0307412_10123685 Ga0307412_101236852 330
206 3300032002 Ga0307416_100251629 Ga0307416_1002516292 330
207 3300037471 Ga0395905_0101480 Ga0395905_0101480_134_1459 330
208 3300046525 Ga0495663_0003305 Ga0495663_0003305_1342_2634 330
209 3300001979 JGI24740J21852_10009346 JGI24740J21852_100093465 331
210 3300001989 JGI24739J22299_10004115 JGI24739J22299_100041156 331
211 3300005327 Ga0070658_10070918 Ga0070658_100709182 331
212 3300005336 Ga0070680_100081701 Ga0070680_1000817013 331
213 3300005339 Ga0070660_100035906 Ga0070660_1000359064 331
214 3300005344 Ga0070661_100023171 Ga0070661_1000231715 331
215 3300025919 Ga0207657_10071295 Ga0207657_100712954 331
216 3300025920 Ga0207649_10131843 Ga0207649_101318432 331
217 3300025921 Ga0207652_10015360 Ga0207652_100153606 331
218 3300025937 Ga0207669_10057738 Ga0207669_100577384 331
219 3300025944 Ga0207661_10128219 Ga0207661_101282192 331
220 3300031911 Ga0307412_10093027 Ga0307412_100930271 331
221 3300037312 Ga0395899_0188444 Ga0395899_0188444_97_1425 331
222 3300037471 Ga0395905_0014350 Ga0395905_0014350_2171_3523 331
223 3300045836 Ga0466958_0074798 Ga0466958_0074798_204_1580 331
224 3300048924 Ga0496121_0000105 Ga0496121_0000105_72499_73830 331
225 3300048927 Ga0496124_0005478 Ga0496124_0005478_12015_13310 331
226 3300005578 Ga0068854_100014036 Ga0068854_1000140363 332
227 3300025981 Ga0207640_10022315 Ga0207640_100223153 332
228 3300031548 Ga0307408_100046549 Ga0307408_1000465494 332
229 3300031995 Ga0307409_100037418 Ga0307409_1000374183 332
230 3300031995 Ga0307409_100052098 Ga0307409_1000520984 332
231 3300032005 Ga0307411_10005369 Ga0307411_100053695 332
232 3300032005 Ga0307411_10043799 Ga0307411_100437994 332
233 3300044693 Ga0466961_0009726 Ga0466961_0009726_3891_5180 332
234 3300045049 Ga0466959_0038923 Ga0466959_0038923_1678_2967 332
235 3300005455 Ga0070663_100064573 Ga0070663_1000645733 333
236 3300005614 Ga0068856_100004367 Ga0068856_1000043676 333
237 3300013104 Ga0157370_10028708 Ga0157370_100287085 333
238 3300025972 Ga0207668_10189232 Ga0207668_101892321 333
239 3300026078 Ga0207702_10034470 Ga0207702_100344705 333
240 3300031852 Ga0307410_10003471 Ga0307410_100034717 333
241 3300031901 Ga0307406_10124168 Ga0307406_101241682 333
242 3300031911 Ga0307412_10083568 Ga0307412_100835683 333
243 3300031995 Ga0307409_100139807 Ga0307409_1001398072 333
244 3300032005 Ga0307411_10008930 Ga0307411_100089303 333
245 3300037466 Ga0395898_0047627 Ga0395898_0047627_2831_4111 333
246 3300037471 Ga0395905_0053079 Ga0395905_0053079_642_1949 333
247 3300046513 Ga0495616_0000140 Ga0495616_0000140_16049_17410 333
248 3300048924 Ga0496121_0033641 Ga0496121_0033641_1750_3027 333
249 3300053151 Ga0500604_0000984 Ga0500604_0000984_6440_7819 333
250 3300003214 JGI25165J46597_1000095 JGI25165J46597_1000095117 334
251 3300005331 Ga0070670_100019126 Ga0070670_1000191262 334
252 3300005355 Ga0070671_100073908 Ga0070671_1000739082 334
253 3300005563 Ga0068855_100040917 Ga0068855_1000409174 334
254 3300005577 Ga0068857_100015874 Ga0068857_1000158745 334
255 3300014326 Ga0157380_10004583 Ga0157380_1000458310 334
256 3300025233 Ga0209437_103045 Ga0209437_1030452 334
257 3300025261 Ga0209233_1000052 Ga0209233_100005241 334
258 3300025315 Ga0207697_10033709 Ga0207697_100337092 334
259 3300025907 Ga0207645_10028697 Ga0207645_100286973 334
260 3300025945 Ga0207679_10153505 Ga0207679_101535052 334
261 3300026116 Ga0207674_10023243 Ga0207674_100232435 334
262 3300026116 Ga0207674_10060765 Ga0207674_100607653 334
263 3300026121 Ga0207683_10014781 Ga0207683_100147812 334
264 3300031852 Ga0307410_10075957 Ga0307410_100759573 334
265 3300031911 Ga0307412_10001749 Ga0307412_100017494 334
266 3300039437 Ga0436365_1658932 Ga0436365_1658932_1138_2412 334
267 3300047323 Ga0495683_0008020 Ga0495683_0008020_918_2207 334
268 3300048927 Ga0496124_0000414 Ga0496124_0000414_37905_39206 334
269 3300005347 Ga0070668_100034913 Ga0070668_1000349131 335
270 3300005563 Ga0068855_100230639 Ga0068855_1002306392 335
271 3300025914 Ga0207671_10004432 Ga0207671_1000443210 335
272 3300025919 Ga0207657_10115251 Ga0207657_101152512 335
273 3300025942 Ga0207689_10025288 Ga0207689_100252884 335
274 3300025949 Ga0207667_10161261 Ga0207667_101612612 335
275 3300026078 Ga0207702_10115054 Ga0207702_101150541 335
276 3300026121 Ga0207683_10177557 Ga0207683_101775573 335
277 3300028380 Ga0268265_10103527 Ga0268265_101035272 335
278 3300031824 Ga0307413_10010952 Ga0307413_100109524 335
279 3300031852 Ga0307410_10055511 Ga0307410_100555114 335
280 3300032004 Ga0307414_10018174 Ga0307414_100181744 335
281 3300032004 Ga0307414_10081531 Ga0307414_100815314 335
282 3300046537 Ga0495598_0000495 Ga0495598_0000495_1038_2354 335
283 3300046539 Ga0495621_0000055 Ga0495621_0000055_4777_6093 335
284 3300046691 Ga0495670_0000771 Ga0495670_0000771_8499_9815 335
285 3300049589 Ga0501073_0020655 Ga0501073_0020655_1741_3117 335
286 3300049744 Ga0501083_0074086 Ga0501083_0074086_804_2168 335
287 3300005329 Ga0070683_100096732 Ga0070683_1000967321 336
288 3300005577 Ga0068857_100025761 Ga0068857_1000257613 336
289 3300005841 Ga0068863_100006027 Ga0068863_1000060276 336
290 3300025904 Ga0207647_10024022 Ga0207647_100240225 336
291 3300025945 Ga0207679_10062649 Ga0207679_100626493 336
292 3300026088 Ga0207641_10032708 Ga0207641_100327081 336
293 3300026116 Ga0207674_10003055 Ga0207674_1000305512 336
294 3300031824 Ga0307413_10120854 Ga0307413_101208541 336
295 3300031995 Ga0307409_100183054 Ga0307409_1001830542 336
296 3300032004 Ga0307414_10070228 Ga0307414_100702284 336
297 3300037418 Ga0395900_0055176 Ga0395900_0055176_1136_2428 336
298 3300037471 Ga0395905_0025055 Ga0395905_0025055_1452_2789 336
299 3300037853 Ga0436364_1247405 Ga0436364_1247405_193_1530 336
300 3300046506 Ga0495583_0026464 Ga0495583_0026464_686_1975 336
301 3300047445 Ga0495677_0004870 Ga0495677_0004870_635_1918 336
302 3300048905 Ga0496102_0000961 Ga0496102_0000961_8585_9886 336
303 3300048906 Ga0496103_0000145 Ga0496103_0000145_2705_4006 336
304 3300048907 Ga0496104_0014613 Ga0496104_0014613_4743_6044 336
305 3300048908 Ga0496105_0000218 Ga0496105_0000218_27686_28987 336
306 3300048917 Ga0496114_0002905 Ga0496114_0002905_5360_6661 336
307 3300048918 Ga0496115_0001038 Ga0496115_0001038_5091_6392 336
308 3300048919 Ga0496116_0001809 Ga0496116_0001809_13634_14935 336
309 3300048920 Ga0496117_0000910 Ga0496117_0000910_9620_10921 336
310 3300048921 Ga0496118_0000091 Ga0496118_0000091_162255_163556 336
311 3300048924 Ga0496121_0000429 Ga0496121_0000429_80174_81475 336
312 3300048927 Ga0496124_0000375 Ga0496124_0000375_70412_71713 336
313 3300048929 Ga0496126_0000443 Ga0496126_0000443_70354_71655 336
314 3300005335 Ga0070666_10006279 Ga0070666_100062795 337
315 3300005338 Ga0068868_100039288 Ga0068868_1000392884 337
316 3300005339 Ga0070660_100043991 Ga0070660_1000439913 337
317 3300005367 Ga0070667_100004908 Ga0070667_1000049085 337
318 3300005842 Ga0068858_100042830 Ga0068858_1000428305 337
319 3300009177 Ga0105248_10054516 Ga0105248_100545164 337
320 3300025903 Ga0207680_10001079 Ga0207680_1000107912 337
321 3300025919 Ga0207657_10026062 Ga0207657_100260626 337
322 3300025931 Ga0207644_10074058 Ga0207644_100740583 337
323 3300025940 Ga0207691_10062142 Ga0207691_100621422 337
324 3300025941 Ga0207711_10000946 Ga0207711_1000094620 337
325 3300025986 Ga0207658_10008943 Ga0207658_100089435 337
326 3300026023 Ga0207677_10010628 Ga0207677_100106284 337
327 3300026035 Ga0207703_10000896 Ga0207703_1000089628 337
328 3300026121 Ga0207683_10303379 Ga0207683_103033791 337
329 3300037418 Ga0395900_0033345 Ga0395900_0033345_2744_4069 337
330 3300046522 Ga0495643_0002280 Ga0495643_0002280_1291_2586 337
331 3300046664 Ga0495659_0030286 Ga0495659_0030286_564_1862 337
332 3300047445 Ga0495677_0007290 Ga0495677_0007290_97_1392 337
333 3300053134 Ga0500658_0008056 Ga0500658_0008056_1680_3059 337
334 3300005457 Ga0070662_100101657 Ga0070662_1001016573 338
335 3300005614 Ga0068856_100252040 Ga0068856_1002520402 338
336 3300005841 Ga0068863_100027707 Ga0068863_1000277073 338
337 3300005842 Ga0068858_100000380 Ga0068858_10000038039 338
338 3300006186 Ga0075369_10025086 Ga0075369_100250862 338
339 3300009177 Ga0105248_10005414 Ga0105248_100054142 338
340 3300009553 Ga0105249_10125159 Ga0105249_101251592 338
341 3300013105 Ga0157369_10091370 Ga0157369_100913706 338
342 3300013306 Ga0163162_10017961 Ga0163162_100179613 338
343 3300013306 Ga0163162_10113135 Ga0163162_101131353 338
344 3300013306 Ga0163162_10132014 Ga0163162_101320143 338
345 3300025304 Ga0209257_1015531 Ga0209257_10155314 338
346 3300026035 Ga0207703_10001312 Ga0207703_1000131213 338
347 3300026041 Ga0207639_10061676 Ga0207639_100616764 338
348 3300026078 Ga0207702_10150367 Ga0207702_101503672 338
349 3300026088 Ga0207641_10006197 Ga0207641_100061974 338
350 3300036712 Ga0316584_0129385 Ga0316584_0129385_203_1483 338
351 3300037418 Ga0395900_0004543 Ga0395900_0004543_7225_8541 338
352 3300037418 Ga0395900_0009895 Ga0395900_0009895_2771_4120 338
353 3300037466 Ga0395898_0001585 Ga0395898_0001585_17715_19031 338
354 3300037471 Ga0395905_0000089 Ga0395905_0000089_12052_13368 338
355 3300037471 Ga0395905_0002105 Ga0395905_0002105_5360_6709 338
356 3300039450 Ga0436363_1537430 Ga0436363_1537430_113_1426 338
357 3300046460 Ga0495638_0000128 Ga0495638_0000128_116455_117744 338
358 3300046524 Ga0495648_0001484 Ga0495648_0001484_9337_10626 338
359 3300046691 Ga0495670_0000015 Ga0495670_0000015_55716_57014 338
360 3300047443 Ga0495687_000471 Ga0495687_000471_40741_42024 338
361 3300048912 Ga0496109_0264400 Ga0496109_0264400_107_1579 338
362 3300048916 Ga0496113_0095054 Ga0496113_0095054_70_1359 338
363 3300048925 Ga0496122_0029994 Ga0496122_0029994_1200_2489 338
364 3300048928 Ga0496125_0005261 Ga0496125_0005261_1448_2737 338
365 3300005262 Ga0065165_1003177 Ga0065165_10031777 339
366 3300005289 Ga0065704_10081931 Ga0065704_100819312 339
367 3300005353 Ga0070669_100000715 Ga0070669_1000007158 339
368 3300005367 Ga0070667_100013603 Ga0070667_1000136034 339
369 3300005617 Ga0068859_100235364 Ga0068859_1002353642 339
370 3300005841 Ga0068863_100000092 Ga0068863_10000009273 339
371 3300005844 Ga0068862_100008302 Ga0068862_1000083023 339
372 3300005844 Ga0068862_100010722 Ga0068862_1000107227 339
373 3300006195 Ga0075366_10063596 Ga0075366_100635961 339
374 3300006931 Ga0097620_100235363 Ga0097620_1002353632 339
375 3300009553 Ga0105249_10004663 Ga0105249_100046632 339
376 3300014968 Ga0157379_10224012 Ga0157379_102240121 339
377 3300025904 Ga0207647_10040387 Ga0207647_100403873 339
378 3300025923 Ga0207681_10002989 Ga0207681_1000298913 339
379 3300025937 Ga0207669_10000989 Ga0207669_100009896 339
380 3300025961 Ga0207712_10008250 Ga0207712_100082502 339
381 3300025986 Ga0207658_10009111 Ga0207658_100091113 339
382 3300026088 Ga0207641_10000004 Ga0207641_10000004417 339
383 3300028380 Ga0268265_10028903 Ga0268265_100289032 339
384 3300028380 Ga0268265_10070971 Ga0268265_100709713 339
385 3300028786 Ga0307517_10074308 Ga0307517_100743083 339
386 3300046616 Ga0495668_0000016 Ga0495668_0000016_153921_155210 339
387 3300046694 Ga0495649_0032522 Ga0495649_0032522_293_1582 339
388 3300048904 Ga0496101_0020877 Ga0496101_0020877_2305_3783 339
389 3300048905 Ga0496102_0013728 Ga0496102_0013728_4843_6321 339
390 3300048906 Ga0496103_0000038 Ga0496103_0000038_56176_57654 339
391 3300048907 Ga0496104_0000123 Ga0496104_0000123_47845_49323 339
392 3300048908 Ga0496105_0000165 Ga0496105_0000165_30178_31656 339
393 3300048910 Ga0496107_0106512 Ga0496107_0106512_437_1915 339
394 3300048915 Ga0496112_0008161 Ga0496112_0008161_1431_2909 339
395 3300048916 Ga0496113_0009075 Ga0496113_0009075_158_1636 339
396 3300048919 Ga0496116_0012660 Ga0496116_0012660_2721_4067 339
397 3300048920 Ga0496117_0018333 Ga0496117_0018333_881_2227 339
398 3300048922 Ga0496119_0001044 Ga0496119_0001044_5170_6648 339
399 3300048923 Ga0496120_0001555 Ga0496120_0001555_9437_10915 339
400 3300048924 Ga0496121_0000168 Ga0496121_0000168_141393_142670 339
401 3300048924 Ga0496121_0016537 Ga0496121_0016537_382_1860 339
402 3300048925 Ga0496122_0001814 Ga0496122_0001814_19861_21339 339
403 3300048926 Ga0496123_0003740 Ga0496123_0003740_3394_4872 339
404 3300048928 Ga0496125_0001376 Ga0496125_0001376_22432_23910 339
405 3300048929 Ga0496126_0000066 Ga0496126_0000066_163537_165015 339
406 3300003762 Ga0055542_1000322 Ga0055542_100032242 340
407 3300003763 Ga0055529_1000014 Ga0055529_1000014284 340
408 3300005331 Ga0070670_100005597 Ga0070670_10000559714 340
409 3300005335 Ga0070666_10041785 Ga0070666_100417853 340
410 3300005355 Ga0070671_100000009 Ga0070671_10000000937 340
411 3300005543 Ga0070672_100219300 Ga0070672_1002193001 340
412 3300005618 Ga0068864_100002974 Ga0068864_1000029749 340
413 3300014325 Ga0163163_10136381 Ga0163163_101363812 340
414 3300025254 Ga0209148_1000011 Ga0209148_1000011289 340
415 3300025272 Ga0209455_1000006 Ga0209455_1000006905 340
416 3300025931 Ga0207644_10000006 Ga0207644_1000000637 340
417 3300025940 Ga0207691_10287244 Ga0207691_102872441 340
418 3300026088 Ga0207641_10007148 Ga0207641_100071481 340
419 3300026095 Ga0207676_10001115 Ga0207676_100011155 340
420 3300026118 Ga0207675_100006088 Ga0207675_1000060882 340
421 3300031240 Ga0265320_10082223 Ga0265320_100822232 340
422 3300031456 Ga0307513_10008420 Ga0307513_100084206 340
423 3300031852 Ga0307410_10089542 Ga0307410_100895423 340
424 3300032004 Ga0307414_10170380 Ga0307414_101703803 340
425 3300045051 Ga0451576_0000007 Ga0451576_0000007_23008_24402 340
426 3300046471 Ga0495650_0000259 Ga0495650_0000259_91478_92761 340
427 3300046492 Ga0495585_0005032 Ga0495585_0005032_2141_3430 340
428 3300046522 Ga0495643_0002012 Ga0495643_0002012_7866_9155 340
429 3300046660 Ga0495625_0000092 Ga0495625_0000092_8312_9601 340
430 3300053140 Ga0500573_0000271 Ga0500573_0000271_11601_12893 340
431 3300001915 JGI24741J21665_1000819 JGI24741J21665_100081911 341
432 3300001979 JGI24740J21852_10006234 JGI24740J21852_100062344 341
433 3300001990 JGI24737J22298_10001056 JGI24737J22298_1000105612 341
434 3300005327 Ga0070658_10001914 Ga0070658_100019149 341
435 3300005327 Ga0070658_10112917 Ga0070658_101129172 341
436 3300005339 Ga0070660_100004814 Ga0070660_1000048145 341
437 3300005339 Ga0070660_100037408 Ga0070660_1000374084 341
438 3300005344 Ga0070661_100004468 Ga0070661_1000044682 341
439 3300005354 Ga0070675_100090365 Ga0070675_1000903654 341
440 3300005455 Ga0070663_100022084 Ga0070663_1000220842 341
441 3300005456 Ga0070678_100000060 Ga0070678_10000006035 341
442 3300005530 Ga0070679_100016861 Ga0070679_1000168611 341
443 3300005548 Ga0070665_100000115 Ga0070665_100000115156 341
444 3300005564 Ga0070664_100101878 Ga0070664_1001018782 341
445 3300005834 Ga0068851_10008051 Ga0068851_100080512 341
446 3300013102 Ga0157371_10000193 Ga0157371_1000019387 341
447 3300013105 Ga0157369_10264064 Ga0157369_102640642 341
448 3300025321 Ga0207656_10002880 Ga0207656_100028804 341
449 3300025909 Ga0207705_10000237 Ga0207705_1000023711 341
450 3300025909 Ga0207705_10000511 Ga0207705_1000051136 341
451 3300025911 Ga0207654_10000227 Ga0207654_100002275 341
452 3300025913 Ga0207695_10025115 Ga0207695_100251154 341
453 3300025914 Ga0207671_10009213 Ga0207671_100092136 341
454 3300025919 Ga0207657_10001241 Ga0207657_100012419 341
455 3300025919 Ga0207657_10011870 Ga0207657_1001187012 341
456 3300025920 Ga0207649_10003792 Ga0207649_100037929 341
457 3300025921 Ga0207652_10005457 Ga0207652_100054573 341
458 3300025924 Ga0207694_10000683 Ga0207694_1000068317 341
459 3300025932 Ga0207690_10001226 Ga0207690_1000122614 341
460 3300025937 Ga0207669_10000030 Ga0207669_1000003087 341
461 3300026067 Ga0207678_10001389 Ga0207678_100013899 341
462 3300026078 Ga0207702_10011067 Ga0207702_100110675 341
463 3300026116 Ga0207674_10012450 Ga0207674_100124504 341
464 3300026121 Ga0207683_10000075 Ga0207683_1000007512 341
465 3300026142 Ga0207698_10008427 Ga0207698_100084274 341
466 3300028379 Ga0268266_10000015 Ga0268266_10000015601 341
467 3300028794 Ga0307515_10259608 Ga0307515_102596082 341
468 3300031911 Ga0307412_10000557 Ga0307412_1000055718 341
469 3300032004 Ga0307414_10000288 Ga0307414_1000028816 341
470 3300046500 Ga0495596_0006657 Ga0495596_0006657_3025_4320 341
471 3300046522 Ga0495643_0023318 Ga0495643_0023318_1343_2695 341
472 3300047323 Ga0495683_0028132 Ga0495683_0028132_1352_2647 341
473 3300047443 Ga0495687_001946 Ga0495687_001946_9925_11208 341
474 3300047472 Ga0495686_0000486 Ga0495686_0000486_44074_45390 341
475 3300048928 Ga0496125_0056100 Ga0496125_0056100_1006_2313 341
476 3300053130 Ga0500642_0000001 Ga0500642_0000001_703590_704879 341
477 3300053177 Ga0500636_0000462 Ga0500636_0000462_18743_20032 341
478 3300003759 Ga0055525_1000012 Ga0055525_1000012165 342
479 3300005331 Ga0070670_100000344 Ga0070670_10000034416 342
480 3300005335 Ga0070666_10000160 Ga0070666_1000016045 342
481 3300005353 Ga0070669_100000013 Ga0070669_100000013186 342
482 3300005367 Ga0070667_100061234 Ga0070667_1000612341 342
483 3300005440 Ga0070705_100008071 Ga0070705_1000080713 342
484 3300005459 Ga0068867_100046955 Ga0068867_1000469553 342
485 3300005539 Ga0068853_100147801 Ga0068853_1001478012 342
486 3300005544 Ga0070686_100047865 Ga0070686_1000478652 342
487 3300005548 Ga0070665_100007685 Ga0070665_1000076857 342
488 3300005842 Ga0068858_100058043 Ga0068858_1000580432 342
489 3300009148 Ga0105243_10001186 Ga0105243_1000118613 342
490 3300009545 Ga0105237_10170457 Ga0105237_101704572 342
491 3300009553 Ga0105249_10001604 Ga0105249_100016048 342
492 3300014968 Ga0157379_10005137 Ga0157379_100051375 342
493 3300025230 Ga0209563_100030 Ga0209563_100030283 342
494 3300025253 Ga0209677_107247 Ga0209677_1072472 342
495 3300025315 Ga0207697_10019384 Ga0207697_100193842 342
496 3300025903 Ga0207680_10004576 Ga0207680_100045762 342
497 3300025923 Ga0207681_10000008 Ga0207681_1000000847 342
498 3300025935 Ga0207709_10000246 Ga0207709_1000024652 342
499 3300025949 Ga0207667_10000002 Ga0207667_10000002170 342
500 3300025981 Ga0207640_10006133 Ga0207640_100061336 342
501 3300026041 Ga0207639_10012330 Ga0207639_100123306 342
502 3300026089 Ga0207648_10016823 Ga0207648_100168237 342
503 3300028379 Ga0268266_10030749 Ga0268266_100307492 342
504 3300028380 Ga0268265_10000392 Ga0268265_1000039237 342
505 3300046506 Ga0495583_0001674 Ga0495583_0001674_12721_14016 342
506 3300046539 Ga0495621_0042758 Ga0495621_0042758_116_1378 342
507 3300046558 Ga0495633_0003568 Ga0495633_0003568_14_1309 342
508 3300046809 Ga0495600_0008265 Ga0495600_0008265_4863_6164 342
509 3300053104 Ga0500556_0000014 Ga0500556_0000014_77324_78613 342
510 3300053118 Ga0500594_0003951 Ga0500594_0003951_967_2277 342
511 3300053122 Ga0500608_000280 Ga0500608_000280_10613_11929 342
512 3300053130 Ga0500642_0013317 Ga0500642_0013317_666_1982 342
513 3300053138 Ga0500564_000953 Ga0500564_000953_3760_5070 342
514 3300053723 Ga0500567_000811 Ga0500567_000811_4034_5350 342
515 3300053729 Ga0500625_000006 Ga0500625_000006_154391_155701 342
516 3300003215 JGI25153J46596_10000010 JGI25153J46596_10000010194 343
517 3300003215 JGI25153J46596_10000031 JGI25153J46596_10000031176 343
518 3300005347 Ga0070668_100000028 Ga0070668_10000002839 343
519 3300005355 Ga0070671_100003648 Ga0070671_1000036487 343
520 3300009098 Ga0105245_10002151 Ga0105245_1000215114 343
521 3300025297 Ga0209758_1000001 Ga0209758_1000001609 343
522 3300025297 Ga0209758_1000033 Ga0209758_1000033335 343
523 3300025927 Ga0207687_10000798 Ga0207687_1000079819 343
524 3300025931 Ga0207644_10000094 Ga0207644_1000009429 343
525 3300025972 Ga0207668_10000076 Ga0207668_1000007611 343
526 3300028381 Ga0268264_10004774 Ga0268264_100047747 343
527 3300046507 Ga0495606_0000029 Ga0495606_0000029_241314_242603 343
528 3300046684 Ga0495669_0000039 Ga0495669_0000039_84315_85622 343
529 3300053079 Ga0500610_0000231 Ga0500610_0000231_4167_5474 343
530 3300053730 Ga0500645_000002 Ga0500645_000002_191015_192322 343
531 3300005459 Ga0068867_100003900 Ga0068867_1000039003 344
532 3300005616 Ga0068852_100091189 Ga0068852_1000911893 344
533 3300025909 Ga0207705_10014106 Ga0207705_100141064 344
534 3300025929 Ga0207664_10028396 Ga0207664_100283962 344
535 3300026089 Ga0207648_10032807 Ga0207648_100328074 344
536 3300031456 Ga0307513_10043231 Ga0307513_100432313 344
537 3300046660 Ga0495625_0072697 Ga0495625_0072697_619_1908 344
538 3300053119 Ga0500595_001729 Ga0500595_001729_4645_5859 344
539 3300053146 Ga0500588_0001660 Ga0500588_0001660_1092_2303 344
540 3300053730 Ga0500645_000315 Ga0500645_000315_3115_4395 344
541 iso_pu_bacteria 2852653556 2852655352 344
542 iso_pu_bacteria 2919138771 2919139912 344
543 3300046500 Ga0495596_0000053 Ga0495596_0000053_29830_31173 345
544 3300046524 Ga0495648_0099235 Ga0495648_0099235_207_1481 345
545 3300046538 Ga0495609_0016952 Ga0495609_0016952_354_1697 345
546 3300046660 Ga0495625_0033599 Ga0495625_0033599_405_1748 345
547 3300049574 Ga0501038_0032224 Ga0501038_0032224_1986_3314 345
548 3300049581 Ga0501047_0153998 Ga0501047_0153998_637_1905 345
549 3300049823 Ga0501044_0310278 Ga0501044_0310278_13_1281 345
550 3300053087 Ga0500643_000465 Ga0500643_000465_6986_8302 345
551 3300046542 Ga0495597_0024651 Ga0495597_0024651_1278_2594 346
552 3300046692 Ga0495671_0023659 Ga0495671_0023659_1863_3155 346
553 3300053093 Ga0500651_0019900 Ga0500651_0019900_1035_2351 346
554 3300003781 Ga0055536_1000422 Ga0055536_100042218 347
555 3300003794 Ga0055531_10000449 Ga0055531_1000044923 347
556 3300005331 Ga0070670_100001938 Ga0070670_1000019387 347
557 3300005335 Ga0070666_10012951 Ga0070666_100129513 347
558 3300005456 Ga0070678_100097180 Ga0070678_1000971802 347
559 3300005457 Ga0070662_100040801 Ga0070662_1000408011 347
560 3300005617 Ga0068859_100141010 Ga0068859_1001410103 347
561 3300005842 Ga0068858_100000261 Ga0068858_10000026121 347
562 3300006931 Ga0097620_100141005 Ga0097620_1001410053 347
563 3300011119 Ga0105246_10000157 Ga0105246_1000015712 347
564 3300013100 Ga0157373_10105584 Ga0157373_101055842 347
565 3300025292 Ga0209676_1000483 Ga0209676_100048318 347
566 3300025298 Ga0209050_1001210 Ga0209050_100121018 347
567 3300025304 Ga0209257_1000532 Ga0209257_100053228 347
568 3300025925 Ga0207650_10001881 Ga0207650_100018817 347
569 3300025949 Ga0207667_10006208 Ga0207667_1000620811 347
570 3300026035 Ga0207703_10000253 Ga0207703_1000025325 347
571 3300026121 Ga0207683_10127463 Ga0207683_101274632 347
572 3300049592 Ga0501076_0012864 Ga0501076_0012864_4841_6160 347
573 3300053087 Ga0500643_007628 Ga0500643_007628_981_2282 347
574 iso_pu_bacteria 2738541275 2738711740 347
575 iso_pu_bacteria 2738541301 2738850165 347
576 iso_pu_bacteria 2738541304 2738865894 347
577 iso_pu_bacteria 2738543022 2739298412 347
578 iso_pu_bacteria 2738543033 2739360090 347
579 iso_pu_bacteria 2775507255 2778124221 347
580 iso_pu_bacteria 2928959182 2928959698 347
581 3300005347 Ga0070668_100000049 Ga0070668_10000004965 348
582 3300005353 Ga0070669_100028017 Ga0070669_1000280173 348
583 3300005355 Ga0070671_100000269 Ga0070671_10000026919 348
584 3300005367 Ga0070667_100000009 Ga0070667_10000000911 348
585 3300005841 Ga0068863_100030672 Ga0068863_1000306723 348
586 3300005843 Ga0068860_100000042 Ga0068860_100000042201 348
587 3300005844 Ga0068862_100000411 Ga0068862_10000041133 348
588 3300013308 Ga0157375_10104117 Ga0157375_101041172 348
589 3300025923 Ga0207681_10048215 Ga0207681_100482152 348
590 3300025931 Ga0207644_10000088 Ga0207644_1000008849 348
591 3300025986 Ga0207658_10000002 Ga0207658_100000028 348
592 3300026041 Ga0207639_10266005 Ga0207639_102660051 348
593 3300026088 Ga0207641_10004732 Ga0207641_100047327 348
594 3300028380 Ga0268265_10000582 Ga0268265_1000058212 348
595 3300028381 Ga0268264_10000001 Ga0268264_10000001333 348
596 3300031548 Ga0307408_100006783 Ga0307408_1000067837 348
597 3300031548 Ga0307408_100011783 Ga0307408_1000117833 348
598 3300031852 Ga0307410_10124425 Ga0307410_101244252 348
599 3300031911 Ga0307412_10005086 Ga0307412_100050866 348
600 3300031911 Ga0307412_10027029 Ga0307412_100270295 348
601 3300031995 Ga0307409_100028665 Ga0307409_1000286654 348
602 3300032002 Ga0307416_100087366 Ga0307416_1000873663 348
603 3300032004 Ga0307414_10085284 Ga0307414_100852842 348
604 3300032005 Ga0307411_10005662 Ga0307411_100056626 348
605 iso_pu_bacteria 2885427238 2885427557 348
606 iso_pu_bacteria 2928100450 2928101607 348
607 3300005618 Ga0068864_100001677 Ga0068864_1000016775 349
608 3300005841 Ga0068863_100071078 Ga0068863_1000710782 349
609 3300007076 Ga0075435_100013014 Ga0075435_1000130146 349
610 3300026088 Ga0207641_10001025 Ga0207641_100010259 349
611 3300026095 Ga0207676_10012257 Ga0207676_100122575 349
612 3300032004 Ga0307414_10015729 Ga0307414_100157294 349
613 3300033180 Ga0307510_10005954 Ga0307510_100059547 349
614 3300048905 Ga0496102_0101584 Ga0496102_0101584_143_1537 349
615 3300048912 Ga0496109_0026058 Ga0496109_0026058_916_2310 349
616 3300048913 Ga0496110_0013061 Ga0496110_0013061_1032_2426 349
617 3300048915 Ga0496112_0045754 Ga0496112_0045754_1934_3328 349
618 3300048917 Ga0496114_0025594 Ga0496114_0025594_773_2167 349
619 3300050513 nmdc:mga0rr50_9616_c1 nmdc:mga0rr50_9616_c1_3832_5331 349
620 iso_pu_bacteria 2599185354 2600201473 349
621 iso_pu_bacteria 2599185359 2600228219 349
622 iso_pu_bacteria 2808606401 2809064667 349
623 iso_pu_bacteria 2818991466 2819716264 349
624 iso_pu_bacteria 2830075706 2830077289 349
625 iso_pu_bacteria 2879163058 2879163976 349
626 iso_pu_bacteria 2896184354 2896184842 349
627 iso_pu_bacteria 2896429255 2896431140 349
628 iso_pu_bacteria 2928968154 2928970484 349
629 3300005327 Ga0070658_10023150 Ga0070658_100231504 350
630 3300005329 Ga0070683_100012146 Ga0070683_1000121465 350
631 3300005336 Ga0070680_100006780 Ga0070680_10000678011 350
632 3300005339 Ga0070660_100035146 Ga0070660_1000351463 350
633 3300005344 Ga0070661_100005092 Ga0070661_10000509211 350
634 3300005344 Ga0070661_100039939 Ga0070661_1000399394 350
635 3300005366 Ga0070659_100013393 Ga0070659_1000133934 350
636 3300005458 Ga0070681_10002429 Ga0070681_1000242917 350
637 3300005530 Ga0070679_100023181 Ga0070679_1000231816 350
638 3300005539 Ga0068853_100009284 Ga0068853_1000092842 350
639 3300005564 Ga0070664_100005447 Ga0070664_1000054475 350
640 3300005578 Ga0068854_100026006 Ga0068854_1000260061 350
641 3300013100 Ga0157373_10019332 Ga0157373_100193323 350
642 3300013102 Ga0157371_10014561 Ga0157371_100145616 350
643 3300013104 Ga0157370_10007287 Ga0157370_100072876 350
644 3300013105 Ga0157369_10062188 Ga0157369_100621882 350
645 3300013307 Ga0157372_10060288 Ga0157372_100602883 350
646 3300025909 Ga0207705_10021462 Ga0207705_100214625 350
647 3300025911 Ga0207654_10048133 Ga0207654_100481332 350
648 3300025917 Ga0207660_10036415 Ga0207660_100364154 350
649 3300025919 Ga0207657_10000289 Ga0207657_100002898 350
650 3300025920 Ga0207649_10012897 Ga0207649_100128974 350
651 3300025921 Ga0207652_10044682 Ga0207652_100446824 350
652 3300025933 Ga0207706_10001712 Ga0207706_100017126 350
653 3300025944 Ga0207661_10015224 Ga0207661_100152244 350
654 3300025949 Ga0207667_10064884 Ga0207667_100648843 350
655 3300025981 Ga0207640_10081303 Ga0207640_100813031 350
656 3300026041 Ga0207639_10027739 Ga0207639_100277394 350
657 3300026118 Ga0207675_100031426 Ga0207675_1000314263 350
658 iso_pu_bacteria 2510917021 2511126951 350
659 iso_pu_bacteria 2739367664 2739649952 350
660 iso_pu_bacteria 2739367865 2740028425 350
661 iso_pu_bacteria 2751185897 2753763459 350
662 iso_pu_bacteria 2848297114 2848299877 350
663 iso_pu_bacteria 2928526807 2928528933 350
664 iso_pu_bacteria 2946787523 2946787760 350
665 iso_pu_bacteria 3000865235 3000866064 350
666 3300009545 Ga0105237_10005078 Ga0105237_1000507810 351
667 3300025914 Ga0207671_10002570 Ga0207671_1000257014 351
668 3300032133 Ga0316583_10003553 Ga0316583_100035534 351
669 3300053087 Ga0500643_000030 Ga0500643_000030_84620_85921 351
670 3300037418 Ga0395900_0012195 Ga0395900_0012195_1835_3205 352
671 3300009093 Ga0105240_10009242 Ga0105240_1000924215 354
672 3300048928 Ga0496125_0003787 Ga0496125_0003787_5165_6412 354
673 3300001904 JGI24736J21556_1001126 JGI24736J21556_10011266 356
674 3300005834 Ga0068851_10024511 Ga0068851_100245112 356
675 3300025321 Ga0207656_10004383 Ga0207656_100043833 356
676 3300025904 Ga0207647_10000038 Ga0207647_1000003844 356
677 3300025949 Ga0207667_10027810 Ga0207667_100278102 356
678 3300026116 Ga0207674_10024567 Ga0207674_100245674 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

233

462

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

1

73

0.98

PF02817

E3_binding

e3 binding domain

167

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgj-assembly1.cif.gz_A c. thermophilum pyruvate dehydrogenase complex core 0.935 154 356
7bgj-assembly1.cif.gz_A c. thermophilum pyruvate dehydrogenase complex core 0.9092 154 356
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.9068 17 61
4qoy-assembly2.cif.gz_F novel binding motif and new flexibility revealed by structural analysis of a pyruvate dehydrogenase-dihydrolipoyl acetyltransferase sub-complex from the escherichia coli pyruvate dehydrogenase multi-enzyme complex 0.8998 79 113
1w85-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 0.8991 78 114
ID Description Score Start End Superfamily
af_Q54KE6_633_699_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.914 17 62 2.40.50.100
4qoyF00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.8998 79 113 4.10.320.10
af_Q8II35_15_156_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8882 13 59 2.40.50.100
1w88J00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.8869 78 114 4.10.320.10
af_Q58628_489_566_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8841 17 64 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A225X675-F1-model_v4 deleted 0.9704 164 355
AF-A0A3S4H414-F1-model_v4 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) 0.9578 158 356 GO:0004742
GO:0006086
GO:0045254
AF-A0A7C5DAU7-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9569 189 356 GO:0006086
GO:0016746
GO:0045254
AF-A0A2F0AGV1-F1-model_v4 Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase 0.9552 188 356 GO:0006086
GO:0016746
GO:0045254
AF-A0A6A0HCY1-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9537 216 298 GO:0004742
GO:0006086
GO:0045254

Feature Viewer

pLDDT pTM Quality
79.94 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map