F474692
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 314 | 650 | 369 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2885427238|2885427557 |
| Length | 462 |
| Sequence | LKMPALSPTMEEGTLAKWLIKEGDTVASGDILAEIETDKATMEFEAVDEGKVLKILVAEGSDGVKVGTPIAMIGEEGEEGGVAGAATAPAQAPAPADTDKEQPSPGQPAAGGSYAPTAAPPAPGGGETPTAPASPAQSGGGDGDTGYRPPPIPKGEPAARANDSARIKASPLARRLAEAQGIDLSTITGSGPGGRIVRADLGDKGGGRPSQVQPAAAPAPALQPQASQVDPGEIPHEAVKLSNMRKTIARRLTESKQQVPHIYLTVDVQLDRLLKLRAELNDGLASRGVKLSVNDMLIKALALALIEVPECNVSFAGDTLIKYSRADISVAVSIPGGLITPIIAGANDKTLSKISTEMGELAGRAKEGKLQPHEYQGGTASLSNMGMFGIKQFEAVINPPQGMIMAIGAGEKRPFVIADSLQIATVMSATGSFDHRAIDGADGARLMQAFRALCERPMGLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 10 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 11 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 12 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 13 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 14 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 15 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 16 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 19 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 20 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 21 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 22 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 23 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 24 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 25 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 26 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 27 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 28 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 29 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 30 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 31 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 299 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 307 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 312 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.87 |
| Metatranscriptomes | 0 |
| Isolates | 4.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 0 |
| Rhizoplane | 5.01 |
| Rhizosphere | 78.02 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 7.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001126 | 3300001904 | Bacteria | 4898 |
| 2 | JGI24741J21665_1000819 | 3300001915 | Bacteria | 9353 |
| 3 | JGI24740J21852_10006234 | 3300001979 | Bacteria | 4962 |
| 4 | JGI24740J21852_10009346 | 3300001979 | Bacteria | 3846 |
| 5 | JGI24739J22299_10004115 | 3300001989 | Bacteria | 5563 |
| 6 | JGI24737J22298_10001056 | 3300001990 | Bacteria | 9731 |
| 7 | JGI24744J21845_10001869 | 3300002077 | Bacteria | 4226 |
| 8 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 9 | JGI25165J46597_1000095 | 3300003214 | Bacteria | 163883 |
| 10 | JGI25153J46596_10000010 | 3300003215 | Bacteria | 337769 |
| 11 | JGI25153J46596_10000031 | 3300003215 | Bacteria | 196926 |
| 12 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 13 | Ga0055542_1000322 | 3300003762 | Bacteria | 51124 |
| 14 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 15 | Ga0055536_1000422 | 3300003781 | Bacteria | 30230 |
| 16 | Ga0055534_1004498 | 3300003784 | Bacteria | 4020 |
| 17 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 18 | Ga0055531_10000449 | 3300003794 | Bacteria | 38308 |
| 19 | Ga0055531_10005592 | 3300003794 | Bacteria | 7320 |
| 20 | Ga0065165_1003177 | 3300005262 | Bacteria | 12034 |
| 21 | Ga0065704_10081931 | 3300005289 | Bacteria | 3681 |
| 22 | Ga0070658_10000536 | 3300005327 | Bacteria | 32936 |
| 23 | Ga0070658_10001914 | 3300005327 | Bacteria | 17560 |
| 24 | Ga0070658_10002770 | 3300005327 | Bacteria | 14576 |
| 25 | Ga0070658_10023150 | 3300005327 | Bacteria | 4987 |
| 26 | Ga0070658_10070918 | 3300005327 | Bacteria | 2853 |
| 27 | Ga0070658_10112917 | 3300005327 | Bacteria | 2252 |
| 28 | Ga0070658_10145987 | 3300005327 | Bacteria | 1978 |
| 29 | Ga0070676_10000031 | 3300005328 | Bacteria | 42113 |
| 30 | Ga0070683_100012146 | 3300005329 | Bacteria | 7474 |
| 31 | Ga0070683_100096732 | 3300005329 | Bacteria | 2777 |
| 32 | Ga0070670_100000344 | 3300005331 | Bacteria | 39044 |
| 33 | Ga0070670_100001938 | 3300005331 | Bacteria | 16935 |
| 34 | Ga0070670_100005554 | 3300005331 | Bacteria | 10638 |
| 35 | Ga0070670_100005597 | 3300005331 | Bacteria | 10598 |
| 36 | Ga0070670_100007510 | 3300005331 | Bacteria | 9256 |
| 37 | Ga0070670_100019126 | 3300005331 | Bacteria | 5873 |
| 38 | Ga0070670_100057317 | 3300005331 | Bacteria | 3345 |
| 39 | Ga0070670_100216764 | 3300005331 | Bacteria | 1665 |
| 40 | Ga0070666_10000160 | 3300005335 | Bacteria | 46166 |
| 41 | Ga0070666_10006279 | 3300005335 | Bacteria | 7308 |
| 42 | Ga0070666_10012951 | 3300005335 | Bacteria | 5278 |
| 43 | Ga0070666_10041785 | 3300005335 | Bacteria | 3065 |
| 44 | Ga0070680_100006780 | 3300005336 | Bacteria | 8725 |
| 45 | Ga0070680_100081701 | 3300005336 | Bacteria | 2666 |
| 46 | Ga0070680_100121595 | 3300005336 | Bacteria | 2180 |
| 47 | Ga0068868_100000403 | 3300005338 | Bacteria | 29340 |
| 48 | Ga0068868_100039288 | 3300005338 | Bacteria | 3677 |
| 49 | Ga0070660_100000700 | 3300005339 | Bacteria | 22233 |
| 50 | Ga0070660_100004814 | 3300005339 | Bacteria | 9338 |
| 51 | Ga0070660_100035146 | 3300005339 | Bacteria | 3792 |
| 52 | Ga0070660_100035906 | 3300005339 | Bacteria | 3752 |
| 53 | Ga0070660_100037408 | 3300005339 | Bacteria | 3679 |
| 54 | Ga0070660_100043991 | 3300005339 | Bacteria | 3413 |
| 55 | Ga0070660_100072829 | 3300005339 | Bacteria | 2685 |
| 56 | Ga0070660_100101908 | 3300005339 | Bacteria | 2275 |
| 57 | Ga0070661_100000130 | 3300005344 | Bacteria | 62986 |
| 58 | Ga0070661_100004468 | 3300005344 | Bacteria | 9646 |
| 59 | Ga0070661_100005092 | 3300005344 | Bacteria | 9069 |
| 60 | Ga0070661_100023171 | 3300005344 | Bacteria | 4449 |
| 61 | Ga0070661_100039939 | 3300005344 | Bacteria | 3420 |
| 62 | Ga0070661_100042155 | 3300005344 | Bacteria | 3331 |
| 63 | Ga0070661_100055001 | 3300005344 | Bacteria | 2915 |
| 64 | Ga0070668_100000028 | 3300005347 | Bacteria | 89707 |
| 65 | Ga0070668_100000049 | 3300005347 | Bacteria | 74953 |
| 66 | Ga0070668_100034913 | 3300005347 | Bacteria | 3833 |
| 67 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 68 | Ga0070669_100000715 | 3300005353 | Bacteria | 24287 |
| 69 | Ga0070669_100028017 | 3300005353 | Bacteria | 4056 |
| 70 | Ga0070675_100002284 | 3300005354 | Bacteria | 14214 |
| 71 | Ga0070675_100090365 | 3300005354 | Bacteria | 2565 |
| 72 | Ga0070671_100000009 | 3300005355 | Bacteria | 206508 |
| 73 | Ga0070671_100000269 | 3300005355 | Bacteria | 35055 |
| 74 | Ga0070671_100002542 | 3300005355 | Bacteria | 14135 |
| 75 | Ga0070671_100003648 | 3300005355 | Bacteria | 12059 |
| 76 | Ga0070671_100007269 | 3300005355 | Bacteria | 8850 |
| 77 | Ga0070671_100073908 | 3300005355 | Bacteria | 2847 |
| 78 | Ga0070674_100057051 | 3300005356 | Bacteria | 2710 |
| 79 | Ga0070673_100000022 | 3300005364 | Bacteria | 92156 |
| 80 | Ga0070659_100013393 | 3300005366 | Bacteria | 6102 |
| 81 | Ga0070659_100030333 | 3300005366 | Bacteria | 4185 |
| 82 | Ga0070659_100032663 | 3300005366 | Bacteria | 4038 |
| 83 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 84 | Ga0070667_100004908 | 3300005367 | Bacteria | 11207 |
| 85 | Ga0070667_100013603 | 3300005367 | Bacteria | 6723 |
| 86 | Ga0070667_100061234 | 3300005367 | Bacteria | 3186 |
| 87 | Ga0070705_100008071 | 3300005440 | Bacteria | 5206 |
| 88 | Ga0070663_100001359 | 3300005455 | Bacteria | 13373 |
| 89 | Ga0070663_100022084 | 3300005455 | Bacteria | 4247 |
| 90 | Ga0070663_100064573 | 3300005455 | Bacteria | 2646 |
| 91 | Ga0070678_100000060 | 3300005456 | Bacteria | 39901 |
| 92 | Ga0070678_100097180 | 3300005456 | Bacteria | 2274 |
| 93 | Ga0070662_100040801 | 3300005457 | Bacteria | 3307 |
| 94 | Ga0070662_100101657 | 3300005457 | Bacteria | 2176 |
| 95 | Ga0070681_10002429 | 3300005458 | Bacteria | 17046 |
| 96 | Ga0068867_100000023 | 3300005459 | Bacteria | 92322 |
| 97 | Ga0068867_100003900 | 3300005459 | Bacteria | 10494 |
| 98 | Ga0068867_100046955 | 3300005459 | Bacteria | 3173 |
| 99 | Ga0070679_100000021 | 3300005530 | Bacteria | 124652 |
| 100 | Ga0070679_100016861 | 3300005530 | Bacteria | 7060 |
| 101 | Ga0070679_100023181 | 3300005530 | Bacteria | 6075 |
| 102 | Ga0068853_100009284 | 3300005539 | Bacteria | 7932 |
| 103 | Ga0068853_100147801 | 3300005539 | Bacteria | 2113 |
| 104 | Ga0070672_100219300 | 3300005543 | Bacteria | 1595 |
| 105 | Ga0070686_100047865 | 3300005544 | Bacteria | 2706 |
| 106 | Ga0070696_100015568 | 3300005546 | Bacteria | 5109 |
| 107 | Ga0070665_100000115 | 3300005548 | Bacteria | 151164 |
| 108 | Ga0070665_100002028 | 3300005548 | Bacteria | 22780 |
| 109 | Ga0070665_100007685 | 3300005548 | Bacteria | 10951 |
| 110 | Ga0070665_100272455 | 3300005548 | Bacteria | 1694 |
| 111 | Ga0068855_100040917 | 3300005563 | Bacteria | 5497 |
| 112 | Ga0068855_100230639 | 3300005563 | Bacteria | 2073 |
| 113 | Ga0070664_100005447 | 3300005564 | Bacteria | 10217 |
| 114 | Ga0070664_100101878 | 3300005564 | Bacteria | 2497 |
| 115 | Ga0068857_100015874 | 3300005577 | Bacteria | 6591 |
| 116 | Ga0068857_100025761 | 3300005577 | Bacteria | 5178 |
| 117 | Ga0068854_100011704 | 3300005578 | Bacteria | 5721 |
| 118 | Ga0068854_100014036 | 3300005578 | Bacteria | 5273 |
| 119 | Ga0068854_100026006 | 3300005578 | Bacteria | 4018 |
| 120 | Ga0068856_100004367 | 3300005614 | Bacteria | 14088 |
| 121 | Ga0068856_100252040 | 3300005614 | Bacteria | 1780 |
| 122 | Ga0068852_100091189 | 3300005616 | Bacteria | 2727 |
| 123 | Ga0068859_100000202 | 3300005617 | Bacteria | 58573 |
| 124 | Ga0068859_100141010 | 3300005617 | Bacteria | 2484 |
| 125 | Ga0068859_100235364 | 3300005617 | Bacteria | 1920 |
| 126 | Ga0068864_100001677 | 3300005618 | Bacteria | 18219 |
| 127 | Ga0068864_100002974 | 3300005618 | Bacteria | 14012 |
| 128 | Ga0068864_100143016 | 3300005618 | Bacteria | 2160 |
| 129 | Ga0068851_10008051 | 3300005834 | Bacteria | 4864 |
| 130 | Ga0068851_10024511 | 3300005834 | Bacteria | 2954 |
| 131 | Ga0068863_100000092 | 3300005841 | Bacteria | 97076 |
| 132 | Ga0068863_100006027 | 3300005841 | Bacteria | 11892 |
| 133 | Ga0068863_100027707 | 3300005841 | Bacteria | 5406 |
| 134 | Ga0068863_100030672 | 3300005841 | Bacteria | 5133 |
| 135 | Ga0068863_100053836 | 3300005841 | Bacteria | 3815 |
| 136 | Ga0068863_100071078 | 3300005841 | Bacteria | 3292 |
| 137 | Ga0068858_100000261 | 3300005842 | Bacteria | 56197 |
| 138 | Ga0068858_100000380 | 3300005842 | Bacteria | 46520 |
| 139 | Ga0068858_100001609 | 3300005842 | Bacteria | 23039 |
| 140 | Ga0068858_100042830 | 3300005842 | Bacteria | 4197 |
| 141 | Ga0068858_100058043 | 3300005842 | Bacteria | 3577 |
| 142 | Ga0068860_100000042 | 3300005843 | Bacteria | 227404 |
| 143 | Ga0068860_100064458 | 3300005843 | Bacteria | 3480 |
| 144 | Ga0068862_100000411 | 3300005844 | Bacteria | 46404 |
| 145 | Ga0068862_100008302 | 3300005844 | Bacteria | 8594 |
| 146 | Ga0068862_100010722 | 3300005844 | Bacteria | 7567 |
| 147 | Ga0081539_10066829 | 3300005985 | Bacteria | 1947 |
| 148 | Ga0075369_10025086 | 3300006186 | Bacteria | 2477 |
| 149 | Ga0075366_10063596 | 3300006195 | Bacteria | 2193 |
| 150 | Ga0068865_100000031 | 3300006881 | Bacteria | 88580 |
| 151 | Ga0097620_100000202 | 3300006931 | Bacteria | 58573 |
| 152 | Ga0097620_100141005 | 3300006931 | Bacteria | 2484 |
| 153 | Ga0097620_100235363 | 3300006931 | Bacteria | 1920 |
| 154 | Ga0075435_100013014 | 3300007076 | Bacteria | 6176 |
| 155 | Ga0105240_10009242 | 3300009093 | Bacteria | 13982 |
| 156 | Ga0105240_10021138 | 3300009093 | Bacteria | 8663 |
| 157 | Ga0105240_10390038 | 3300009093 | Bacteria | 1571 |
| 158 | Ga0105245_10002151 | 3300009098 | Bacteria | 17853 |
| 159 | Ga0105245_10013418 | 3300009098 | Bacteria | 7137 |
| 160 | Ga0105243_10000156 | 3300009148 | Bacteria | 78467 |
| 161 | Ga0105243_10001186 | 3300009148 | Bacteria | 23513 |
| 162 | Ga0105241_10209037 | 3300009174 | Bacteria | 1634 |
| 163 | Ga0105242_10004742 | 3300009176 | Bacteria | 10529 |
| 164 | Ga0105248_10001787 | 3300009177 | Bacteria | 23901 |
| 165 | Ga0105248_10005414 | 3300009177 | Bacteria | 14027 |
| 166 | Ga0105248_10016331 | 3300009177 | Bacteria | 8171 |
| 167 | Ga0105248_10054516 | 3300009177 | Bacteria | 4484 |
| 168 | Ga0105237_10005078 | 3300009545 | Bacteria | 14953 |
| 169 | Ga0105237_10170457 | 3300009545 | Bacteria | 2176 |
| 170 | Ga0105238_10112091 | 3300009551 | Bacteria | 2707 |
| 171 | Ga0105249_10001604 | 3300009553 | Bacteria | 19800 |
| 172 | Ga0105249_10004663 | 3300009553 | Bacteria | 11838 |
| 173 | Ga0105249_10031092 | 3300009553 | Bacteria | 4827 |
| 174 | Ga0105249_10125159 | 3300009553 | Bacteria | 2447 |
| 175 | Ga0105246_10000157 | 3300011119 | Bacteria | 32454 |
| 176 | Ga0157373_10019332 | 3300013100 | Bacteria | 4961 |
| 177 | Ga0157373_10105584 | 3300013100 | Bacteria | 1981 |
| 178 | Ga0157371_10000193 | 3300013102 | Bacteria | 90182 |
| 179 | Ga0157371_10014561 | 3300013102 | Bacteria | 5931 |
| 180 | Ga0157371_10130838 | 3300013102 | Bacteria | 1785 |
| 181 | Ga0157370_10007287 | 3300013104 | Bacteria | 12070 |
| 182 | Ga0157370_10028708 | 3300013104 | Bacteria | 5469 |
| 183 | Ga0157369_10005353 | 3300013105 | Bacteria | 14954 |
| 184 | Ga0157369_10056253 | 3300013105 | Bacteria | 4245 |
| 185 | Ga0157369_10062188 | 3300013105 | Bacteria | 4024 |
| 186 | Ga0157369_10091370 | 3300013105 | Bacteria | 3250 |
| 187 | Ga0157369_10215604 | 3300013105 | Bacteria | 2011 |
| 188 | Ga0157369_10264064 | 3300013105 | Bacteria | 1795 |
| 189 | Ga0157374_10000656 | 3300013296 | Bacteria | 30436 |
| 190 | Ga0157374_10002399 | 3300013296 | Bacteria | 15803 |
| 191 | Ga0157378_10000504 | 3300013297 | Bacteria | 37070 |
| 192 | Ga0163162_10017961 | 3300013306 | Bacteria | 6921 |
| 193 | Ga0163162_10113135 | 3300013306 | Bacteria | 2813 |
| 194 | Ga0163162_10132014 | 3300013306 | Bacteria | 2606 |
| 195 | Ga0157372_10030188 | 3300013307 | Bacteria | 5927 |
| 196 | Ga0157372_10060288 | 3300013307 | Bacteria | 4246 |
| 197 | Ga0157375_10003473 | 3300013308 | Bacteria | 13661 |
| 198 | Ga0157375_10104117 | 3300013308 | Bacteria | 2926 |
| 199 | Ga0157375_10278903 | 3300013308 | Bacteria | 1834 |
| 200 | Ga0163163_10136381 | 3300014325 | Bacteria | 2495 |
| 201 | Ga0157380_10004583 | 3300014326 | Bacteria | 9594 |
| 202 | Ga0157377_10003378 | 3300014745 | Bacteria | 7219 |
| 203 | Ga0157379_10005137 | 3300014968 | Bacteria | 11231 |
| 204 | Ga0157379_10224012 | 3300014968 | Bacteria | 1704 |
| 205 | Ga0157376_10000124 | 3300014969 | Bacteria | 53299 |
| 206 | Ga0213876_10003188 | 3300021384 | Bacteria | 9435 |
| 207 | Ga0213875_10007292 | 3300021388 | Bacteria | 5723 |
| 208 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 209 | Ga0209437_103045 | 3300025233 | Bacteria | 3099 |
| 210 | Ga0209026_1002932 | 3300025250 | Bacteria | 5962 |
| 211 | Ga0209677_107247 | 3300025253 | Bacteria | 2404 |
| 212 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 213 | Ga0209148_1000059 | 3300025254 | Bacteria | 350224 |
| 214 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 215 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 216 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 217 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 218 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 219 | Ga0209676_1000483 | 3300025292 | Bacteria | 65133 |
| 220 | Ga0209025_1010313 | 3300025294 | Bacteria | 6346 |
| 221 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 222 | Ga0209758_1000033 | 3300025297 | Bacteria | 469998 |
| 223 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 224 | Ga0209050_1001210 | 3300025298 | Bacteria | 30282 |
| 225 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 226 | Ga0209257_1000532 | 3300025304 | Bacteria | 66089 |
| 227 | Ga0209257_1015531 | 3300025304 | Bacteria | 3161 |
| 228 | Ga0207697_10019384 | 3300025315 | Bacteria | 2786 |
| 229 | Ga0207697_10033709 | 3300025315 | Bacteria | 2095 |
| 230 | Ga0207656_10002880 | 3300025321 | Bacteria | 5865 |
| 231 | Ga0207656_10004383 | 3300025321 | Bacteria | 4925 |
| 232 | Ga0207696_1014662 | 3300025711 | Bacteria | 2681 |
| 233 | Ga0207682_10002218 | 3300025893 | Bacteria | 8762 |
| 234 | Ga0207680_10001079 | 3300025903 | Bacteria | 12871 |
| 235 | Ga0207680_10004576 | 3300025903 | Bacteria | 6568 |
| 236 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 237 | Ga0207647_10024022 | 3300025904 | Bacteria | 4022 |
| 238 | Ga0207647_10040387 | 3300025904 | Bacteria | 2939 |
| 239 | Ga0207645_10028697 | 3300025907 | Bacteria | 3591 |
| 240 | Ga0207705_10000059 | 3300025909 | Bacteria | 155683 |
| 241 | Ga0207705_10000178 | 3300025909 | Bacteria | 67084 |
| 242 | Ga0207705_10000237 | 3300025909 | Bacteria | 54736 |
| 243 | Ga0207705_10000511 | 3300025909 | Bacteria | 33036 |
| 244 | Ga0207705_10002823 | 3300025909 | Bacteria | 13285 |
| 245 | Ga0207705_10014106 | 3300025909 | Bacteria | 5757 |
| 246 | Ga0207705_10021462 | 3300025909 | Bacteria | 4609 |
| 247 | Ga0207654_10000227 | 3300025911 | Bacteria | 34512 |
| 248 | Ga0207654_10048133 | 3300025911 | Bacteria | 2439 |
| 249 | Ga0207707_10034592 | 3300025912 | Bacteria | 4421 |
| 250 | Ga0207695_10015591 | 3300025913 | Bacteria | 8939 |
| 251 | Ga0207695_10025115 | 3300025913 | Bacteria | 6683 |
| 252 | Ga0207695_10051267 | 3300025913 | Bacteria | 4335 |
| 253 | Ga0207695_10080646 | 3300025913 | Bacteria | 3295 |
| 254 | Ga0207671_10002570 | 3300025914 | Bacteria | 19248 |
| 255 | Ga0207671_10004432 | 3300025914 | Bacteria | 13437 |
| 256 | Ga0207671_10009213 | 3300025914 | Bacteria | 8280 |
| 257 | Ga0207660_10003328 | 3300025917 | Bacteria | 10490 |
| 258 | Ga0207660_10036415 | 3300025917 | Bacteria | 3421 |
| 259 | Ga0207657_10000289 | 3300025919 | Bacteria | 53536 |
| 260 | Ga0207657_10001241 | 3300025919 | Bacteria | 27265 |
| 261 | Ga0207657_10001372 | 3300025919 | Bacteria | 25957 |
| 262 | Ga0207657_10011870 | 3300025919 | Bacteria | 8623 |
| 263 | Ga0207657_10026062 | 3300025919 | Bacteria | 5379 |
| 264 | Ga0207657_10071295 | 3300025919 | Bacteria | 2942 |
| 265 | Ga0207657_10077725 | 3300025919 | Bacteria | 2796 |
| 266 | Ga0207657_10115251 | 3300025919 | Bacteria | 2215 |
| 267 | Ga0207649_10000134 | 3300025920 | Bacteria | 63335 |
| 268 | Ga0207649_10003792 | 3300025920 | Bacteria | 8244 |
| 269 | Ga0207649_10004660 | 3300025920 | Bacteria | 7421 |
| 270 | Ga0207649_10012897 | 3300025920 | Bacteria | 4654 |
| 271 | Ga0207649_10131843 | 3300025920 | Bacteria | 1699 |
| 272 | Ga0207652_10000047 | 3300025921 | Bacteria | 125286 |
| 273 | Ga0207652_10005457 | 3300025921 | Bacteria | 10320 |
| 274 | Ga0207652_10015360 | 3300025921 | Bacteria | 6218 |
| 275 | Ga0207652_10044682 | 3300025921 | Bacteria | 3775 |
| 276 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 277 | Ga0207681_10002989 | 3300025923 | Bacteria | 10627 |
| 278 | Ga0207681_10048215 | 3300025923 | Bacteria | 2874 |
| 279 | Ga0207694_10000683 | 3300025924 | Bacteria | 30452 |
| 280 | Ga0207650_10001881 | 3300025925 | Bacteria | 14819 |
| 281 | Ga0207650_10018173 | 3300025925 | Bacteria | 4931 |
| 282 | Ga0207650_10101789 | 3300025925 | Bacteria | 2212 |
| 283 | Ga0207650_10136167 | 3300025925 | Bacteria | 1927 |
| 284 | Ga0207659_10021352 | 3300025926 | Bacteria | 4296 |
| 285 | Ga0207687_10000798 | 3300025927 | Bacteria | 21269 |
| 286 | Ga0207664_10028396 | 3300025929 | Bacteria | 4251 |
| 287 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 288 | Ga0207644_10000088 | 3300025931 | Bacteria | 65977 |
| 289 | Ga0207644_10000094 | 3300025931 | Bacteria | 64592 |
| 290 | Ga0207644_10003333 | 3300025931 | Bacteria | 10365 |
| 291 | Ga0207644_10048321 | 3300025931 | Bacteria | 3041 |
| 292 | Ga0207644_10074058 | 3300025931 | Bacteria | 2498 |
| 293 | Ga0207690_10001226 | 3300025932 | Bacteria | 16188 |
| 294 | Ga0207690_10031664 | 3300025932 | Bacteria | 3387 |
| 295 | Ga0207690_10068645 | 3300025932 | Bacteria | 2436 |
| 296 | Ga0207706_10001712 | 3300025933 | Bacteria | 21630 |
| 297 | Ga0207706_10053046 | 3300025933 | Bacteria | 3580 |
| 298 | Ga0207686_10001385 | 3300025934 | Bacteria | 13769 |
| 299 | Ga0207709_10000246 | 3300025935 | Bacteria | 66685 |
| 300 | Ga0207709_10000447 | 3300025935 | Bacteria | 38701 |
| 301 | Ga0207669_10000030 | 3300025937 | Bacteria | 88341 |
| 302 | Ga0207669_10000989 | 3300025937 | Bacteria | 12093 |
| 303 | Ga0207669_10039652 | 3300025937 | Bacteria | 2724 |
| 304 | Ga0207669_10057738 | 3300025937 | Bacteria | 2364 |
| 305 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 306 | Ga0207691_10023274 | 3300025940 | Bacteria | 5832 |
| 307 | Ga0207691_10062142 | 3300025940 | Bacteria | 3391 |
| 308 | Ga0207691_10085922 | 3300025940 | Bacteria | 2823 |
| 309 | Ga0207691_10287244 | 3300025940 | Bacteria | 1415 |
| 310 | Ga0207711_10000946 | 3300025941 | Bacteria | 27905 |
| 311 | Ga0207711_10001082 | 3300025941 | Bacteria | 26041 |
| 312 | Ga0207711_10006078 | 3300025941 | Bacteria | 10202 |
| 313 | Ga0207689_10000701 | 3300025942 | Bacteria | 32104 |
| 314 | Ga0207689_10025288 | 3300025942 | Bacteria | 4975 |
| 315 | Ga0207661_10015224 | 3300025944 | Bacteria | 5656 |
| 316 | Ga0207661_10128219 | 3300025944 | Bacteria | 2169 |
| 317 | Ga0207679_10028352 | 3300025945 | Bacteria | 3884 |
| 318 | Ga0207679_10062649 | 3300025945 | Bacteria | 2772 |
| 319 | Ga0207679_10153505 | 3300025945 | Bacteria | 1877 |
| 320 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 321 | Ga0207667_10006208 | 3300025949 | Bacteria | 14505 |
| 322 | Ga0207667_10027810 | 3300025949 | Bacteria | 6150 |
| 323 | Ga0207667_10034843 | 3300025949 | Bacteria | 5403 |
| 324 | Ga0207667_10064884 | 3300025949 | Bacteria | 3810 |
| 325 | Ga0207667_10161261 | 3300025949 | Bacteria | 2306 |
| 326 | Ga0207667_10178536 | 3300025949 | Bacteria | 2181 |
| 327 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 328 | Ga0207712_10008250 | 3300025961 | Bacteria | 6584 |
| 329 | Ga0207712_10033435 | 3300025961 | Bacteria | 3476 |
| 330 | Ga0207668_10000076 | 3300025972 | Bacteria | 75056 |
| 331 | Ga0207668_10000731 | 3300025972 | Bacteria | 20103 |
| 332 | Ga0207668_10189232 | 3300025972 | Bacteria | 1630 |
| 333 | Ga0207640_10002626 | 3300025981 | Bacteria | 9629 |
| 334 | Ga0207640_10006133 | 3300025981 | Bacteria | 6575 |
| 335 | Ga0207640_10022315 | 3300025981 | Bacteria | 3786 |
| 336 | Ga0207640_10081303 | 3300025981 | Bacteria | 2215 |
| 337 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 338 | Ga0207658_10001246 | 3300025986 | Bacteria | 20116 |
| 339 | Ga0207658_10008943 | 3300025986 | Bacteria | 6793 |
| 340 | Ga0207658_10009111 | 3300025986 | Bacteria | 6733 |
| 341 | Ga0207677_10000091 | 3300026023 | Bacteria | 74163 |
| 342 | Ga0207677_10010628 | 3300026023 | Bacteria | 5214 |
| 343 | Ga0207703_10000253 | 3300026035 | Bacteria | 60255 |
| 344 | Ga0207703_10000847 | 3300026035 | Bacteria | 30021 |
| 345 | Ga0207703_10000896 | 3300026035 | Bacteria | 29159 |
| 346 | Ga0207703_10001312 | 3300026035 | Bacteria | 23010 |
| 347 | Ga0207703_10022154 | 3300026035 | Bacteria | 4980 |
| 348 | Ga0207639_10012330 | 3300026041 | Bacteria | 5952 |
| 349 | Ga0207639_10027739 | 3300026041 | Bacteria | 4128 |
| 350 | Ga0207639_10061676 | 3300026041 | Bacteria | 2897 |
| 351 | Ga0207639_10266005 | 3300026041 | Bacteria | 1502 |
| 352 | Ga0207678_10001389 | 3300026067 | Bacteria | 22281 |
| 353 | Ga0207678_10002781 | 3300026067 | Bacteria | 15861 |
| 354 | Ga0207678_10079085 | 3300026067 | Bacteria | 2816 |
| 355 | Ga0207702_10011067 | 3300026078 | Bacteria | 7531 |
| 356 | Ga0207702_10034470 | 3300026078 | Bacteria | 4232 |
| 357 | Ga0207702_10115054 | 3300026078 | Bacteria | 2398 |
| 358 | Ga0207702_10150367 | 3300026078 | Bacteria | 2117 |
| 359 | Ga0207702_10213199 | 3300026078 | Bacteria | 1796 |
| 360 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 361 | Ga0207641_10001025 | 3300026088 | Bacteria | 28336 |
| 362 | Ga0207641_10004732 | 3300026088 | Bacteria | 11737 |
| 363 | Ga0207641_10006197 | 3300026088 | Bacteria | 10119 |
| 364 | Ga0207641_10007148 | 3300026088 | Bacteria | 9321 |
| 365 | Ga0207641_10032708 | 3300026088 | Bacteria | 4319 |
| 366 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 367 | Ga0207648_10016823 | 3300026089 | Bacteria | 6668 |
| 368 | Ga0207648_10032807 | 3300026089 | Bacteria | 4582 |
| 369 | Ga0207676_10001115 | 3300026095 | Bacteria | 20336 |
| 370 | Ga0207676_10012257 | 3300026095 | Bacteria | 6136 |
| 371 | Ga0207676_10068907 | 3300026095 | Bacteria | 2831 |
| 372 | Ga0207674_10003055 | 3300026116 | Bacteria | 20711 |
| 373 | Ga0207674_10012450 | 3300026116 | Bacteria | 9506 |
| 374 | Ga0207674_10023243 | 3300026116 | Bacteria | 6641 |
| 375 | Ga0207674_10024567 | 3300026116 | Bacteria | 6435 |
| 376 | Ga0207674_10060765 | 3300026116 | Bacteria | 3821 |
| 377 | Ga0207675_100006088 | 3300026118 | Bacteria | 11475 |
| 378 | Ga0207675_100031426 | 3300026118 | Bacteria | 4946 |
| 379 | Ga0207683_10000075 | 3300026121 | Bacteria | 77829 |
| 380 | Ga0207683_10014781 | 3300026121 | Bacteria | 6644 |
| 381 | Ga0207683_10019752 | 3300026121 | Bacteria | 5755 |
| 382 | Ga0207683_10127463 | 3300026121 | Bacteria | 2288 |
| 383 | Ga0207683_10143593 | 3300026121 | Bacteria | 2151 |
| 384 | Ga0207683_10177557 | 3300026121 | Bacteria | 1930 |
| 385 | Ga0207683_10303379 | 3300026121 | Bacteria | 1461 |
| 386 | Ga0207698_10008427 | 3300026142 | Bacteria | 6521 |
| 387 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 388 | Ga0268266_10005032 | 3300028379 | Bacteria | 12478 |
| 389 | Ga0268266_10030749 | 3300028379 | Bacteria | 4561 |
| 390 | Ga0268266_10037453 | 3300028379 | Bacteria | 4132 |
| 391 | Ga0268265_10000392 | 3300028380 | Bacteria | 46740 |
| 392 | Ga0268265_10000582 | 3300028380 | Bacteria | 36910 |
| 393 | Ga0268265_10028903 | 3300028380 | Bacteria | 3974 |
| 394 | Ga0268265_10070971 | 3300028380 | Bacteria | 2710 |
| 395 | Ga0268265_10103527 | 3300028380 | Bacteria | 2305 |
| 396 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 397 | Ga0268264_10000310 | 3300028381 | Bacteria | 78142 |
| 398 | Ga0268264_10004774 | 3300028381 | Bacteria | 11499 |
| 399 | Ga0307517_10074308 | 3300028786 | Bacteria | 2999 |
| 400 | Ga0307515_10259608 | 3300028794 | Bacteria | 1476 |
| 401 | Ga0265320_10082223 | 3300031240 | Bacteria | 1502 |
| 402 | Ga0307513_10008420 | 3300031456 | Bacteria | 13207 |
| 403 | Ga0307513_10043231 | 3300031456 | Bacteria | 4952 |
| 404 | Ga0307408_100006783 | 3300031548 | Bacteria | 7590 |
| 405 | Ga0307408_100011783 | 3300031548 | Bacteria | 5783 |
| 406 | Ga0307408_100023154 | 3300031548 | Bacteria | 4228 |
| 407 | Ga0307408_100046549 | 3300031548 | Bacteria | 3103 |
| 408 | Ga0307508_10000317 | 3300031616 | Bacteria | 58176 |
| 409 | Ga0307405_10021699 | 3300031731 | Bacteria | 3615 |
| 410 | Ga0307405_10118278 | 3300031731 | Bacteria | 1808 |
| 411 | Ga0307405_10151293 | 3300031731 | Bacteria | 1632 |
| 412 | Ga0307413_10010952 | 3300031824 | Bacteria | 4430 |
| 413 | Ga0307413_10034949 | 3300031824 | Bacteria | 2878 |
| 414 | Ga0307413_10120854 | 3300031824 | Bacteria | 1774 |
| 415 | Ga0307410_10003471 | 3300031852 | Bacteria | 7910 |
| 416 | Ga0307410_10055511 | 3300031852 | Bacteria | 2689 |
| 417 | Ga0307410_10065496 | 3300031852 | Bacteria | 2499 |
| 418 | Ga0307410_10075957 | 3300031852 | Bacteria | 2344 |
| 419 | Ga0307410_10089542 | 3300031852 | Bacteria | 2181 |
| 420 | Ga0307410_10124425 | 3300031852 | Bacteria | 1885 |
| 421 | Ga0307406_10022142 | 3300031901 | Bacteria | 3768 |
| 422 | Ga0307406_10088807 | 3300031901 | Bacteria | 2075 |
| 423 | Ga0307406_10124168 | 3300031901 | Bacteria | 1800 |
| 424 | Ga0307407_10053599 | 3300031903 | Bacteria | 2321 |
| 425 | Ga0307407_10079225 | 3300031903 | Bacteria | 1981 |
| 426 | Ga0307412_10000557 | 3300031911 | Bacteria | 22165 |
| 427 | Ga0307412_10001749 | 3300031911 | Bacteria | 12005 |
| 428 | Ga0307412_10005086 | 3300031911 | Bacteria | 7355 |
| 429 | Ga0307412_10027029 | 3300031911 | Bacteria | 3573 |
| 430 | Ga0307412_10083568 | 3300031911 | Bacteria | 2214 |
| 431 | Ga0307412_10093027 | 3300031911 | Bacteria | 2114 |
| 432 | Ga0307412_10123685 | 3300031911 | Bacteria | 1867 |
| 433 | Ga0307409_100010084 | 3300031995 | Bacteria | 5847 |
| 434 | Ga0307409_100028665 | 3300031995 | Bacteria | 3971 |
| 435 | Ga0307409_100037418 | 3300031995 | Bacteria | 3578 |
| 436 | Ga0307409_100052098 | 3300031995 | Bacteria | 3136 |
| 437 | Ga0307409_100139807 | 3300031995 | Bacteria | 2084 |
| 438 | Ga0307409_100183054 | 3300031995 | Bacteria | 1857 |
| 439 | Ga0307416_100016486 | 3300032002 | Bacteria | 5139 |
| 440 | Ga0307416_100087366 | 3300032002 | Bacteria | 2661 |
| 441 | Ga0307416_100251629 | 3300032002 | Bacteria | 1720 |
| 442 | Ga0307414_10000288 | 3300032004 | Bacteria | 29634 |
| 443 | Ga0307414_10006350 | 3300032004 | Bacteria | 6585 |
| 444 | Ga0307414_10015729 | 3300032004 | Bacteria | 4576 |
| 445 | Ga0307414_10018174 | 3300032004 | Bacteria | 4320 |
| 446 | Ga0307414_10070228 | 3300032004 | Bacteria | 2521 |
| 447 | Ga0307414_10081531 | 3300032004 | Bacteria | 2369 |
| 448 | Ga0307414_10085284 | 3300032004 | Bacteria | 2326 |
| 449 | Ga0307414_10170380 | 3300032004 | Bacteria | 1740 |
| 450 | Ga0307411_10005369 | 3300032005 | Bacteria | 6285 |
| 451 | Ga0307411_10005662 | 3300032005 | Bacteria | 6165 |
| 452 | Ga0307411_10008930 | 3300032005 | Bacteria | 5231 |
| 453 | Ga0307411_10009704 | 3300032005 | Bacteria | 5082 |
| 454 | Ga0307411_10043799 | 3300032005 | Bacteria | 2865 |
| 455 | Ga0307411_10059278 | 3300032005 | Bacteria | 2537 |
| 456 | Ga0307411_10084853 | 3300032005 | Bacteria | 2192 |
| 457 | Ga0307411_10198859 | 3300032005 | Bacteria | 1537 |
| 458 | Ga0307415_100007272 | 3300032126 | Bacteria | 6047 |
| 459 | Ga0307415_100018321 | 3300032126 | Bacteria | 4225 |
| 460 | Ga0307415_100216765 | 3300032126 | Bacteria | 1531 |
| 461 | Ga0316583_10003553 | 3300032133 | Bacteria | 5502 |
| 462 | Ga0307510_10005954 | 3300033180 | Bacteria | 14551 |
| 463 | Ga0316584_0129385 | 3300036712 | Bacteria | 1886 |
| 464 | Ga0395899_0000406 | 3300037312 | Bacteria | 50248 |
| 465 | Ga0395899_0065327 | 3300037312 | Bacteria | 2674 |
| 466 | Ga0395899_0091624 | 3300037312 | Bacteria | 2202 |
| 467 | Ga0395899_0188444 | 3300037312 | Bacteria | 1444 |
| 468 | Ga0395900_0004543 | 3300037418 | Bacteria | 14685 |
| 469 | Ga0395900_0009343 | 3300037418 | Bacteria | 10053 |
| 470 | Ga0395900_0009895 | 3300037418 | Bacteria | 9765 |
| 471 | Ga0395900_0012195 | 3300037418 | Bacteria | 8786 |
| 472 | Ga0395900_0033345 | 3300037418 | Bacteria | 5299 |
| 473 | Ga0395900_0055176 | 3300037418 | Bacteria | 4091 |
| 474 | Ga0395898_0001585 | 3300037466 | Bacteria | 31078 |
| 475 | Ga0395898_0023344 | 3300037466 | Bacteria | 6251 |
| 476 | Ga0395898_0047627 | 3300037466 | Bacteria | 4206 |
| 477 | Ga0395905_0000089 | 3300037471 | Bacteria | 152196 |
| 478 | Ga0395905_0000412 | 3300037471 | Bacteria | 60157 |
| 479 | Ga0395905_0002105 | 3300037471 | Bacteria | 22623 |
| 480 | Ga0395905_0014350 | 3300037471 | Bacteria | 7570 |
| 481 | Ga0395905_0020721 | 3300037471 | Bacteria | 6225 |
| 482 | Ga0395905_0025055 | 3300037471 | Bacteria | 5626 |
| 483 | Ga0395905_0053079 | 3300037471 | Bacteria | 3795 |
| 484 | Ga0395905_0083023 | 3300037471 | Bacteria | 3002 |
| 485 | Ga0395905_0101480 | 3300037471 | Bacteria | 2701 |
| 486 | Ga0436364_1247405 | 3300037853 | Bacteria | 1652 |
| 487 | Ga0436364_1473539 | 3300037853 | Bacteria | 7661 |
| 488 | Ga0395901_0005879 | 3300038443 | Bacteria | 12416 |
| 489 | Ga0395901_0089589 | 3300038443 | Bacteria | 3219 |
| 490 | Ga0436365_1311515 | 3300039437 | Bacteria | 11736 |
| 491 | Ga0436365_1658932 | 3300039437 | Bacteria | 3238 |
| 492 | Ga0436363_1537430 | 3300039450 | Bacteria | 2076 |
| 493 | Ga0439461_0000051 | 3300041410 | Bacteria | 14159 |
| 494 | Ga0439465_0001873 | 3300041413 | Bacteria | 6876 |
| 495 | Ga0439431_0000131 | 3300041997 | Bacteria | 13310 |
| 496 | Ga0439432_016384 | 3300042006 | Bacteria | 2495 |
| 497 | Ga0439452_021228 | 3300042010 | Bacteria | 1695 |
| 498 | Ga0439462_0002208 | 3300042015 | Bacteria | 4491 |
| 499 | Ga0450905_003187 | 3300042142 | Bacteria | 2151 |
| 500 | Ga0439434_0002140 | 3300042435 | Bacteria | 5719 |
| 501 | Ga0466969_0002077 | 3300044656 | Bacteria | 10693 |
| 502 | Ga0466966_0000003 | 3300044684 | Bacteria | 233677 |
| 503 | Ga0466966_0029684 | 3300044684 | Bacteria | 3555 |
| 504 | Ga0466961_0009726 | 3300044693 | Bacteria | 6120 |
| 505 | Ga0466961_0064150 | 3300044693 | Bacteria | 2334 |
| 506 | Ga0466971_0036363 | 3300044719 | Bacteria | 2208 |
| 507 | Ga0466970_0022735 | 3300044765 | Bacteria | 3271 |
| 508 | Ga0466957_0000273 | 3300044842 | Bacteria | 25062 |
| 509 | Ga0466959_0005743 | 3300045049 | Bacteria | 8536 |
| 510 | Ga0466959_0038923 | 3300045049 | Bacteria | 3513 |
| 511 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 512 | Ga0466958_0013352 | 3300045836 | Bacteria | 4674 |
| 513 | Ga0466958_0074798 | 3300045836 | Bacteria | 2077 |
| 514 | Ga0495638_0000128 | 3300046460 | Bacteria | 123567 |
| 515 | Ga0495650_0000259 | 3300046471 | Bacteria | 102151 |
| 516 | Ga0495585_0005032 | 3300046492 | Bacteria | 8431 |
| 517 | Ga0495596_0000053 | 3300046500 | Bacteria | 84061 |
| 518 | Ga0495596_0006657 | 3300046500 | Bacteria | 5290 |
| 519 | Ga0495583_0001674 | 3300046506 | Bacteria | 21461 |
| 520 | Ga0495583_0026464 | 3300046506 | Bacteria | 2875 |
| 521 | Ga0495606_0000029 | 3300046507 | Bacteria | 250473 |
| 522 | Ga0495616_0000140 | 3300046513 | Bacteria | 63080 |
| 523 | Ga0495643_0002012 | 3300046522 | Bacteria | 16962 |
| 524 | Ga0495643_0002280 | 3300046522 | Bacteria | 15503 |
| 525 | Ga0495643_0023318 | 3300046522 | Bacteria | 3519 |
| 526 | Ga0495648_0001484 | 3300046524 | Bacteria | 22938 |
| 527 | Ga0495648_0099235 | 3300046524 | Bacteria | 1611 |
| 528 | Ga0495663_0003305 | 3300046525 | Bacteria | 4670 |
| 529 | Ga0495598_0000495 | 3300046537 | Bacteria | 7257 |
| 530 | Ga0495609_0016952 | 3300046538 | Bacteria | 3389 |
| 531 | Ga0495621_0000055 | 3300046539 | Bacteria | 21830 |
| 532 | Ga0495621_0042758 | 3300046539 | Bacteria | 1596 |
| 533 | Ga0495597_0024651 | 3300046542 | Bacteria | 2775 |
| 534 | Ga0495633_0001942 | 3300046558 | Bacteria | 15031 |
| 535 | Ga0495633_0003568 | 3300046558 | Bacteria | 10287 |
| 536 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 537 | Ga0495625_0000092 | 3300046660 | Bacteria | 146172 |
| 538 | Ga0495625_0033599 | 3300046660 | Bacteria | 3791 |
| 539 | Ga0495625_0072697 | 3300046660 | Bacteria | 2411 |
| 540 | Ga0495659_0030286 | 3300046664 | Bacteria | 1883 |
| 541 | Ga0495669_0000039 | 3300046684 | Bacteria | 92973 |
| 542 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 543 | Ga0495670_0000771 | 3300046691 | Bacteria | 15356 |
| 544 | Ga0495671_0023659 | 3300046692 | Bacteria | 3208 |
| 545 | Ga0495649_0032522 | 3300046694 | Bacteria | 2872 |
| 546 | Ga0495600_0008265 | 3300046809 | Bacteria | 6388 |
| 547 | Ga0495683_0008020 | 3300047323 | Bacteria | 5670 |
| 548 | Ga0495683_0028132 | 3300047323 | Bacteria | 2874 |
| 549 | Ga0495687_000471 | 3300047443 | Bacteria | 48815 |
| 550 | Ga0495687_001946 | 3300047443 | Bacteria | 17689 |
| 551 | Ga0495677_0004870 | 3300047445 | Bacteria | 5119 |
| 552 | Ga0495677_0007290 | 3300047445 | Bacteria | 4137 |
| 553 | Ga0495686_0000486 | 3300047472 | Bacteria | 58640 |
| 554 | Ga0496101_0010489 | 3300048904 | Bacteria | 6120 |
| 555 | Ga0496101_0020877 | 3300048904 | Bacteria | 4492 |
| 556 | Ga0496102_0000961 | 3300048905 | Bacteria | 27087 |
| 557 | Ga0496102_0013728 | 3300048905 | Bacteria | 7024 |
| 558 | Ga0496102_0101584 | 3300048905 | Bacteria | 2672 |
| 559 | Ga0496103_0000038 | 3300048906 | Bacteria | 178822 |
| 560 | Ga0496103_0000145 | 3300048906 | Bacteria | 74388 |
| 561 | Ga0496104_0000123 | 3300048907 | Bacteria | 71754 |
| 562 | Ga0496104_0014613 | 3300048907 | Bacteria | 7092 |
| 563 | Ga0496105_0000165 | 3300048908 | Bacteria | 43988 |
| 564 | Ga0496105_0000218 | 3300048908 | Bacteria | 38487 |
| 565 | Ga0496106_0004503 | 3300048909 | Bacteria | 10324 |
| 566 | Ga0496107_0012337 | 3300048910 | Bacteria | 5966 |
| 567 | Ga0496107_0106512 | 3300048910 | Bacteria | 2059 |
| 568 | Ga0496108_0035205 | 3300048911 | Bacteria | 4162 |
| 569 | Ga0496109_0010877 | 3300048912 | Bacteria | 7791 |
| 570 | Ga0496109_0013659 | 3300048912 | Bacteria | 7053 |
| 571 | Ga0496109_0026058 | 3300048912 | Bacteria | 5211 |
| 572 | Ga0496109_0264400 | 3300048912 | Bacteria | 1621 |
| 573 | Ga0496110_0013061 | 3300048913 | Bacteria | 6852 |
| 574 | Ga0496110_0015697 | 3300048913 | Bacteria | 6310 |
| 575 | Ga0496110_0026321 | 3300048913 | Bacteria | 4976 |
| 576 | Ga0496112_0002145 | 3300048915 | Bacteria | 15663 |
| 577 | Ga0496112_0008161 | 3300048915 | Bacteria | 9358 |
| 578 | Ga0496112_0045754 | 3300048915 | Bacteria | 4290 |
| 579 | Ga0496113_0009075 | 3300048916 | Bacteria | 6516 |
| 580 | Ga0496113_0056657 | 3300048916 | Bacteria | 2943 |
| 581 | Ga0496113_0095054 | 3300048916 | Bacteria | 2303 |
| 582 | Ga0496114_0002180 | 3300048917 | Bacteria | 14904 |
| 583 | Ga0496114_0002905 | 3300048917 | Bacteria | 13135 |
| 584 | Ga0496114_0025594 | 3300048917 | Bacteria | 4825 |
| 585 | Ga0496115_0001038 | 3300048918 | Bacteria | 20173 |
| 586 | Ga0496116_0001809 | 3300048919 | Bacteria | 23171 |
| 587 | Ga0496116_0012660 | 3300048919 | Bacteria | 6868 |
| 588 | Ga0496117_0000910 | 3300048920 | Bacteria | 45331 |
| 589 | Ga0496117_0018333 | 3300048920 | Bacteria | 5803 |
| 590 | Ga0496118_0000091 | 3300048921 | Bacteria | 173092 |
| 591 | Ga0496118_0009440 | 3300048921 | Bacteria | 9847 |
| 592 | Ga0496119_0001044 | 3300048922 | Bacteria | 35405 |
| 593 | Ga0496120_0001555 | 3300048923 | Bacteria | 26843 |
| 594 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 595 | Ga0496121_0000168 | 3300048924 | Bacteria | 144896 |
| 596 | Ga0496121_0000429 | 3300048924 | Bacteria | 82577 |
| 597 | Ga0496121_0016537 | 3300048924 | Bacteria | 7609 |
| 598 | Ga0496121_0033641 | 3300048924 | Bacteria | 4634 |
| 599 | Ga0496122_0001814 | 3300048925 | Bacteria | 32677 |
| 600 | Ga0496122_0029994 | 3300048925 | Bacteria | 4569 |
| 601 | Ga0496123_0003740 | 3300048926 | Bacteria | 16680 |
| 602 | Ga0496124_0000375 | 3300048927 | Bacteria | 81352 |
| 603 | Ga0496124_0000414 | 3300048927 | Bacteria | 76734 |
| 604 | Ga0496124_0005478 | 3300048927 | Bacteria | 14255 |
| 605 | Ga0496124_0062935 | 3300048927 | Bacteria | 3102 |
| 606 | Ga0496125_0001376 | 3300048928 | Bacteria | 35709 |
| 607 | Ga0496125_0003787 | 3300048928 | Bacteria | 17978 |
| 608 | Ga0496125_0005261 | 3300048928 | Bacteria | 14490 |
| 609 | Ga0496125_0056100 | 3300048928 | Bacteria | 3202 |
| 610 | Ga0496125_0098343 | 3300048928 | Bacteria | 2165 |
| 611 | Ga0496126_0000066 | 3300048929 | Bacteria | 252188 |
| 612 | Ga0496126_0000443 | 3300048929 | Bacteria | 82811 |
| 613 | Ga0501032_0228635 | 3300049569 | Bacteria | 1210 |
| 614 | Ga0501034_0202814 | 3300049571 | Bacteria | 1941 |
| 615 | Ga0501038_0032224 | 3300049574 | Bacteria | 4626 |
| 616 | Ga0501047_0153998 | 3300049581 | Bacteria | 2173 |
| 617 | Ga0501073_0020655 | 3300049589 | Bacteria | 4750 |
| 618 | Ga0501076_0012864 | 3300049592 | Bacteria | 6262 |
| 619 | Ga0501076_0249211 | 3300049592 | Bacteria | 1453 |
| 620 | Ga0501083_0074086 | 3300049744 | Bacteria | 2262 |
| 621 | Ga0501044_0310278 | 3300049823 | Bacteria | 1504 |
| 622 | nmdc:mga0rr50_9616_c1 | 3300050513 | Bacteria | 6090 |
| 623 | Ga0500610_0000231 | 3300053079 | Bacteria | 16928 |
| 624 | Ga0500643_000030 | 3300053087 | Bacteria | 206784 |
| 625 | Ga0500643_000465 | 3300053087 | Bacteria | 29876 |
| 626 | Ga0500643_007628 | 3300053087 | Bacteria | 4336 |
| 627 | Ga0500651_0019900 | 3300053093 | Bacteria | 4176 |
| 628 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 629 | Ga0500592_003087 | 3300053116 | Bacteria | 2662 |
| 630 | Ga0500594_0003951 | 3300053118 | Bacteria | 3267 |
| 631 | Ga0500595_001729 | 3300053119 | Bacteria | 11391 |
| 632 | Ga0500595_004099 | 3300053119 | Bacteria | 6607 |
| 633 | Ga0500608_000280 | 3300053122 | Bacteria | 19747 |
| 634 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 635 | Ga0500642_0000596 | 3300053130 | Bacteria | 10818 |
| 636 | Ga0500642_0013317 | 3300053130 | Bacteria | 3018 |
| 637 | Ga0500658_0008056 | 3300053134 | Bacteria | 3894 |
| 638 | Ga0500559_0062643 | 3300053136 | Bacteria | 1661 |
| 639 | Ga0500564_000953 | 3300053138 | Bacteria | 9400 |
| 640 | Ga0500573_0000271 | 3300053140 | Bacteria | 21909 |
| 641 | Ga0500588_0001660 | 3300053146 | Bacteria | 4308 |
| 642 | Ga0500604_0000027 | 3300053151 | Bacteria | 62112 |
| 643 | Ga0500604_0000984 | 3300053151 | Bacteria | 7930 |
| 644 | Ga0500616_0000730 | 3300053153 | Bacteria | 38013 |
| 645 | Ga0500636_0000462 | 3300053177 | Bacteria | 22121 |
| 646 | Ga0500567_000811 | 3300053723 | Bacteria | 11764 |
| 647 | Ga0500625_000006 | 3300053729 | Bacteria | 206258 |
| 648 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 649 | Ga0500645_000315 | 3300053730 | Bacteria | 34548 |
| 650 | Ga0466962_0004869 | 3300061719 | Bacteria | 6457 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0249211 | Ga0501076_0249211_93_1058 | 279 |
| 2 | 3300049569 | Ga0501032_0228635 | Ga0501032_0228635_176_1138 | 282 |
| 3 | 3300005327 | Ga0070658_10000536 | Ga0070658_1000053610 | 315 |
| 4 | 3300025909 | Ga0207705_10000178 | Ga0207705_1000017816 | 315 |
| 5 | 3300053116 | Ga0500592_003087 | Ga0500592_003087_839_2086 | 315 |
| 6 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_100002376 | 318 |
| 7 | 3300025250 | Ga0209026_1002932 | Ga0209026_10029326 | 318 |
| 8 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003915 | 318 |
| 9 | 3300005327 | Ga0070658_10145987 | Ga0070658_101459871 | 319 |
| 10 | 3300005344 | Ga0070661_100000130 | Ga0070661_10000013035 | 319 |
| 11 | 3300013105 | Ga0157369_10215604 | Ga0157369_102156042 | 319 |
| 12 | 3300025920 | Ga0207649_10000134 | Ga0207649_1000013422 | 319 |
| 13 | 3300025949 | Ga0207667_10034843 | Ga0207667_100348432 | 319 |
| 14 | 3300049571 | Ga0501034_0202814 | Ga0501034_0202814_562_1860 | 319 |
| 15 | 3300031731 | Ga0307405_10151293 | Ga0307405_101512932 | 320 |
| 16 | 3300002077 | JGI24744J21845_10001869 | JGI24744J21845_100018696 | 321 |
| 17 | 3300005336 | Ga0070680_100121595 | Ga0070680_1001215952 | 321 |
| 18 | 3300005530 | Ga0070679_100000021 | Ga0070679_10000002139 | 321 |
| 19 | 3300009093 | Ga0105240_10390038 | Ga0105240_103900382 | 321 |
| 20 | 3300013307 | Ga0157372_10030188 | Ga0157372_100301883 | 321 |
| 21 | 3300025254 | Ga0209148_1000059 | Ga0209148_1000059323 | 321 |
| 22 | 3300025912 | Ga0207707_10034592 | Ga0207707_100345923 | 321 |
| 23 | 3300025917 | Ga0207660_10003328 | Ga0207660_100033282 | 321 |
| 24 | 3300025921 | Ga0207652_10000047 | Ga0207652_1000004739 | 321 |
| 25 | 3300026121 | Ga0207683_10019752 | Ga0207683_100197526 | 321 |
| 26 | 3300037312 | Ga0395899_0091624 | Ga0395899_0091624_37_1278 | 321 |
| 27 | 3300005344 | Ga0070661_100042155 | Ga0070661_1000421554 | 322 |
| 28 | 3300021388 | Ga0213875_10007292 | Ga0213875_100072924 | 322 |
| 29 | 3300025909 | Ga0207705_10000059 | Ga0207705_10000059135 | 322 |
| 30 | 3300025913 | Ga0207695_10051267 | Ga0207695_100512674 | 322 |
| 31 | 3300025913 | Ga0207695_10080646 | Ga0207695_100806463 | 322 |
| 32 | 3300025920 | Ga0207649_10004660 | Ga0207649_100046608 | 322 |
| 33 | 3300031852 | Ga0307410_10065496 | Ga0307410_100654962 | 322 |
| 34 | 3300032005 | Ga0307411_10198859 | Ga0307411_101988591 | 322 |
| 35 | 3300037853 | Ga0436364_1473539 | Ga0436364_1473539_4029_5378 | 322 |
| 36 | 3300053136 | Ga0500559_0062643 | Ga0500559_0062643_366_1643 | 322 |
| 37 | 3300005328 | Ga0070676_10000031 | Ga0070676_1000003143 | 323 |
| 38 | 3300005339 | Ga0070660_100000700 | Ga0070660_10000070016 | 323 |
| 39 | 3300005578 | Ga0068854_100011704 | Ga0068854_1000117047 | 323 |
| 40 | 3300009093 | Ga0105240_10021138 | Ga0105240_100211387 | 323 |
| 41 | 3300013105 | Ga0157369_10056253 | Ga0157369_100562536 | 323 |
| 42 | 3300013297 | Ga0157378_10000504 | Ga0157378_100005044 | 323 |
| 43 | 3300025913 | Ga0207695_10015591 | Ga0207695_100155917 | 323 |
| 44 | 3300025919 | Ga0207657_10001372 | Ga0207657_1000137212 | 323 |
| 45 | 3300025981 | Ga0207640_10002626 | Ga0207640_100026267 | 323 |
| 46 | 3300031548 | Ga0307408_100023154 | Ga0307408_1000231545 | 323 |
| 47 | 3300032005 | Ga0307411_10009704 | Ga0307411_100097041 | 323 |
| 48 | 3300037312 | Ga0395899_0000406 | Ga0395899_0000406_16638_17921 | 323 |
| 49 | 3300005338 | Ga0068868_100000403 | Ga0068868_10000040329 | 324 |
| 50 | 3300005344 | Ga0070661_100055001 | Ga0070661_1000550013 | 324 |
| 51 | 3300005364 | Ga0070673_100000022 | Ga0070673_10000002270 | 324 |
| 52 | 3300005459 | Ga0068867_100000023 | Ga0068867_10000002328 | 324 |
| 53 | 3300006881 | Ga0068865_100000031 | Ga0068865_10000003170 | 324 |
| 54 | 3300009098 | Ga0105245_10013418 | Ga0105245_100134185 | 324 |
| 55 | 3300009148 | Ga0105243_10000156 | Ga0105243_1000015631 | 324 |
| 56 | 3300009176 | Ga0105242_10004742 | Ga0105242_1000474216 | 324 |
| 57 | 3300009553 | Ga0105249_10031092 | Ga0105249_100310926 | 324 |
| 58 | 3300013296 | Ga0157374_10000656 | Ga0157374_1000065616 | 324 |
| 59 | 3300013308 | Ga0157375_10003473 | Ga0157375_1000347312 | 324 |
| 60 | 3300014745 | Ga0157377_10003378 | Ga0157377_100033787 | 324 |
| 61 | 3300014969 | Ga0157376_10000124 | Ga0157376_100001244 | 324 |
| 62 | 3300025934 | Ga0207686_10001385 | Ga0207686_100013855 | 324 |
| 63 | 3300025935 | Ga0207709_10000447 | Ga0207709_1000044732 | 324 |
| 64 | 3300025938 | Ga0207704_10000008 | Ga0207704_10000008154 | 324 |
| 65 | 3300025940 | Ga0207691_10023274 | Ga0207691_100232744 | 324 |
| 66 | 3300025942 | Ga0207689_10000701 | Ga0207689_100007013 | 324 |
| 67 | 3300025960 | Ga0207651_10000008 | Ga0207651_1000000870 | 324 |
| 68 | 3300025961 | Ga0207712_10033435 | Ga0207712_100334356 | 324 |
| 69 | 3300026023 | Ga0207677_10000091 | Ga0207677_1000009151 | 324 |
| 70 | 3300026089 | Ga0207648_10000009 | Ga0207648_1000000970 | 324 |
| 71 | 3300031824 | Ga0307413_10034949 | Ga0307413_100349493 | 324 |
| 72 | 3300061719 | Ga0466962_0004869 | Ga0466962_0004869_1326_2609 | 324 |
| 73 | 3300005331 | Ga0070670_100005554 | Ga0070670_1000055543 | 325 |
| 74 | 3300005331 | Ga0070670_100216764 | Ga0070670_1002167642 | 325 |
| 75 | 3300005355 | Ga0070671_100002542 | Ga0070671_1000025429 | 325 |
| 76 | 3300005985 | Ga0081539_10066829 | Ga0081539_100668292 | 325 |
| 77 | 3300013296 | Ga0157374_10002399 | Ga0157374_100023997 | 325 |
| 78 | 3300025925 | Ga0207650_10018173 | Ga0207650_100181734 | 325 |
| 79 | 3300025925 | Ga0207650_10136167 | Ga0207650_101361672 | 325 |
| 80 | 3300025931 | Ga0207644_10003333 | Ga0207644_100033339 | 325 |
| 81 | 3300026078 | Ga0207702_10213199 | Ga0207702_102131992 | 325 |
| 82 | 3300031731 | Ga0307405_10021699 | Ga0307405_100216993 | 325 |
| 83 | 3300031901 | Ga0307406_10022142 | Ga0307406_100221423 | 325 |
| 84 | 3300032002 | Ga0307416_100016486 | Ga0307416_1000164865 | 325 |
| 85 | 3300044656 | Ga0466969_0002077 | Ga0466969_0002077_7867_9153 | 325 |
| 86 | 3300044684 | Ga0466966_0000003 | Ga0466966_0000003_18718_20040 | 325 |
| 87 | 3300044684 | Ga0466966_0029684 | Ga0466966_0029684_1141_2427 | 325 |
| 88 | 3300044693 | Ga0466961_0064150 | Ga0466961_0064150_989_2275 | 325 |
| 89 | 3300044719 | Ga0466971_0036363 | Ga0466971_0036363_291_1577 | 325 |
| 90 | 3300044765 | Ga0466970_0022735 | Ga0466970_0022735_527_1813 | 325 |
| 91 | 3300044842 | Ga0466957_0000273 | Ga0466957_0000273_20007_21293 | 325 |
| 92 | 3300045836 | Ga0466958_0013352 | Ga0466958_0013352_2758_4044 | 325 |
| 93 | 3300005331 | Ga0070670_100007510 | Ga0070670_1000075109 | 326 |
| 94 | 3300005354 | Ga0070675_100002284 | Ga0070675_10000228412 | 326 |
| 95 | 3300005356 | Ga0070674_100057051 | Ga0070674_1000570513 | 326 |
| 96 | 3300009177 | Ga0105248_10016331 | Ga0105248_100163312 | 326 |
| 97 | 3300013308 | Ga0157375_10278903 | Ga0157375_102789033 | 326 |
| 98 | 3300025893 | Ga0207682_10002218 | Ga0207682_100022189 | 326 |
| 99 | 3300025925 | Ga0207650_10101789 | Ga0207650_101017894 | 326 |
| 100 | 3300025926 | Ga0207659_10021352 | Ga0207659_100213525 | 326 |
| 101 | 3300025933 | Ga0207706_10053046 | Ga0207706_100530465 | 326 |
| 102 | 3300025937 | Ga0207669_10039652 | Ga0207669_100396523 | 326 |
| 103 | 3300025941 | Ga0207711_10006078 | Ga0207711_100060781 | 326 |
| 104 | 3300026121 | Ga0207683_10143593 | Ga0207683_101435933 | 326 |
| 105 | 3300031903 | Ga0307407_10053599 | Ga0307407_100535992 | 326 |
| 106 | 3300032004 | Ga0307414_10006350 | Ga0307414_100063506 | 326 |
| 107 | 3300032005 | Ga0307411_10084853 | Ga0307411_100848532 | 326 |
| 108 | 3300032126 | Ga0307415_100007272 | Ga0307415_1000072727 | 326 |
| 109 | 3300032126 | Ga0307415_100216765 | Ga0307415_1002167652 | 326 |
| 110 | 3300038443 | Ga0395901_0089589 | Ga0395901_0089589_197_1513 | 326 |
| 111 | 3300046558 | Ga0495633_0001942 | Ga0495633_0001942_8098_9381 | 326 |
| 112 | 3300048917 | Ga0496114_0002180 | Ga0496114_0002180_9612_10901 | 326 |
| 113 | 3300003784 | Ga0055534_1004498 | Ga0055534_10044983 | 327 |
| 114 | 3300003791 | Ga0055530_10000013 | Ga0055530_1000001355 | 327 |
| 115 | 3300003794 | Ga0055531_10005592 | Ga0055531_100055928 | 327 |
| 116 | 3300005331 | Ga0070670_100057317 | Ga0070670_1000573173 | 327 |
| 117 | 3300005455 | Ga0070663_100001359 | Ga0070663_1000013597 | 327 |
| 118 | 3300005546 | Ga0070696_100015568 | Ga0070696_1000155686 | 327 |
| 119 | 3300005548 | Ga0070665_100002028 | Ga0070665_10000202818 | 327 |
| 120 | 3300005842 | Ga0068858_100001609 | Ga0068858_10000160915 | 327 |
| 121 | 3300009174 | Ga0105241_10209037 | Ga0105241_102090372 | 327 |
| 122 | 3300013105 | Ga0157369_10005353 | Ga0157369_1000535319 | 327 |
| 123 | 3300025291 | Ga0209675_1000025 | Ga0209675_10000258 | 327 |
| 124 | 3300025292 | Ga0209676_1000221 | Ga0209676_100022154 | 327 |
| 125 | 3300025294 | Ga0209025_1010313 | Ga0209025_10103135 | 327 |
| 126 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042333 | 327 |
| 127 | 3300025304 | Ga0209257_1000135 | Ga0209257_100013554 | 327 |
| 128 | 3300025932 | Ga0207690_10068645 | Ga0207690_100686454 | 327 |
| 129 | 3300026035 | Ga0207703_10000847 | Ga0207703_1000084716 | 327 |
| 130 | 3300026067 | Ga0207678_10002781 | Ga0207678_1000278117 | 327 |
| 131 | 3300026067 | Ga0207678_10079085 | Ga0207678_100790851 | 327 |
| 132 | 3300028379 | Ga0268266_10005032 | Ga0268266_100050327 | 327 |
| 133 | 3300031903 | Ga0307407_10079225 | Ga0307407_100792251 | 327 |
| 134 | 3300037471 | Ga0395905_0020721 | Ga0395905_0020721_1052_2335 | 327 |
| 135 | 3300041410 | Ga0439461_0000051 | Ga0439461_0000051_1457_2761 | 327 |
| 136 | 3300041413 | Ga0439465_0001873 | Ga0439465_0001873_3383_4687 | 327 |
| 137 | 3300041997 | Ga0439431_0000131 | Ga0439431_0000131_2923_4227 | 327 |
| 138 | 3300042006 | Ga0439432_016384 | Ga0439432_016384_589_1893 | 327 |
| 139 | 3300042010 | Ga0439452_021228 | Ga0439452_021228_70_1374 | 327 |
| 140 | 3300042015 | Ga0439462_0002208 | Ga0439462_0002208_595_1899 | 327 |
| 141 | 3300042435 | Ga0439434_0002140 | Ga0439434_0002140_3792_5096 | 327 |
| 142 | 3300048911 | Ga0496108_0035205 | Ga0496108_0035205_1450_2736 | 327 |
| 143 | 3300048912 | Ga0496109_0013659 | Ga0496109_0013659_1591_2877 | 327 |
| 144 | 3300048913 | Ga0496110_0015697 | Ga0496110_0015697_2186_3472 | 327 |
| 145 | 3300048916 | Ga0496113_0056657 | Ga0496113_0056657_1178_2464 | 327 |
| 146 | 3300048928 | Ga0496125_0098343 | Ga0496125_0098343_581_1867 | 327 |
| 147 | 3300053130 | Ga0500642_0000596 | Ga0500642_0000596_1605_2894 | 327 |
| 148 | 3300053151 | Ga0500604_0000027 | Ga0500604_0000027_25702_26994 | 327 |
| 149 | 3300053153 | Ga0500616_0000730 | Ga0500616_0000730_11648_12958 | 327 |
| 150 | 3300005339 | Ga0070660_100072829 | Ga0070660_1000728293 | 328 |
| 151 | 3300005339 | Ga0070660_100101908 | Ga0070660_1001019082 | 328 |
| 152 | 3300005366 | Ga0070659_100030333 | Ga0070659_1000303334 | 328 |
| 153 | 3300005366 | Ga0070659_100032663 | Ga0070659_1000326635 | 328 |
| 154 | 3300005618 | Ga0068864_100143016 | Ga0068864_1001430163 | 328 |
| 155 | 3300009177 | Ga0105248_10001787 | Ga0105248_1000178712 | 328 |
| 156 | 3300021384 | Ga0213876_10003188 | Ga0213876_1000318811 | 328 |
| 157 | 3300025919 | Ga0207657_10077725 | Ga0207657_100777253 | 328 |
| 158 | 3300025931 | Ga0207644_10048321 | Ga0207644_100483213 | 328 |
| 159 | 3300025932 | Ga0207690_10031664 | Ga0207690_100316645 | 328 |
| 160 | 3300025940 | Ga0207691_10085922 | Ga0207691_100859223 | 328 |
| 161 | 3300025941 | Ga0207711_10001082 | Ga0207711_1000108222 | 328 |
| 162 | 3300026095 | Ga0207676_10068907 | Ga0207676_100689072 | 328 |
| 163 | 3300031731 | Ga0307405_10118278 | Ga0307405_101182783 | 328 |
| 164 | 3300031995 | Ga0307409_100010084 | Ga0307409_1000100845 | 328 |
| 165 | 3300032126 | Ga0307415_100018321 | Ga0307415_1000183216 | 328 |
| 166 | 3300039437 | Ga0436365_1311515 | Ga0436365_1311515_672_1973 | 328 |
| 167 | 3300042142 | Ga0450905_003187 | Ga0450905_003187_80_1396 | 328 |
| 168 | 3300045049 | Ga0466959_0005743 | Ga0466959_0005743_2705_4081 | 328 |
| 169 | 3300048904 | Ga0496101_0010489 | Ga0496101_0010489_553_1869 | 328 |
| 170 | 3300048909 | Ga0496106_0004503 | Ga0496106_0004503_3596_4912 | 328 |
| 171 | 3300048910 | Ga0496107_0012337 | Ga0496107_0012337_4350_5666 | 328 |
| 172 | 3300048912 | Ga0496109_0010877 | Ga0496109_0010877_2293_3609 | 328 |
| 173 | 3300048913 | Ga0496110_0026321 | Ga0496110_0026321_3100_4416 | 328 |
| 174 | 3300048915 | Ga0496112_0002145 | Ga0496112_0002145_430_1746 | 328 |
| 175 | 3300005327 | Ga0070658_10002770 | Ga0070658_100027709 | 329 |
| 176 | 3300005355 | Ga0070671_100007269 | Ga0070671_1000072695 | 329 |
| 177 | 3300005548 | Ga0070665_100272455 | Ga0070665_1002724551 | 329 |
| 178 | 3300005617 | Ga0068859_100000202 | Ga0068859_10000020223 | 329 |
| 179 | 3300005841 | Ga0068863_100053836 | Ga0068863_1000538361 | 329 |
| 180 | 3300005843 | Ga0068860_100064458 | Ga0068860_1000644583 | 329 |
| 181 | 3300006931 | Ga0097620_100000202 | Ga0097620_10000020237 | 329 |
| 182 | 3300013102 | Ga0157371_10130838 | Ga0157371_101308382 | 329 |
| 183 | 3300025711 | Ga0207696_1014662 | Ga0207696_10146623 | 329 |
| 184 | 3300025909 | Ga0207705_10002823 | Ga0207705_100028239 | 329 |
| 185 | 3300025949 | Ga0207667_10178536 | Ga0207667_101785361 | 329 |
| 186 | 3300025972 | Ga0207668_10000731 | Ga0207668_1000073118 | 329 |
| 187 | 3300025986 | Ga0207658_10001246 | Ga0207658_100012466 | 329 |
| 188 | 3300026035 | Ga0207703_10022154 | Ga0207703_100221544 | 329 |
| 189 | 3300028379 | Ga0268266_10037453 | Ga0268266_100374531 | 329 |
| 190 | 3300028381 | Ga0268264_10000310 | Ga0268264_1000031044 | 329 |
| 191 | 3300032005 | Ga0307411_10059278 | Ga0307411_100592782 | 329 |
| 192 | 3300037312 | Ga0395899_0065327 | Ga0395899_0065327_1088_2386 | 329 |
| 193 | 3300037418 | Ga0395900_0009343 | Ga0395900_0009343_7213_8511 | 329 |
| 194 | 3300037466 | Ga0395898_0023344 | Ga0395898_0023344_2497_3777 | 329 |
| 195 | 3300037471 | Ga0395905_0000412 | Ga0395905_0000412_51307_52605 | 329 |
| 196 | 3300037471 | Ga0395905_0083023 | Ga0395905_0083023_520_1815 | 329 |
| 197 | 3300038443 | Ga0395901_0005879 | Ga0395901_0005879_2872_4170 | 329 |
| 198 | 3300048921 | Ga0496118_0009440 | Ga0496118_0009440_5697_7181 | 329 |
| 199 | 3300048927 | Ga0496124_0062935 | Ga0496124_0062935_1495_2979 | 329 |
| 200 | 3300053119 | Ga0500595_004099 | Ga0500595_004099_5337_6593 | 329 |
| 201 | 3300009551 | Ga0105238_10112091 | Ga0105238_101120912 | 330 |
| 202 | 3300025945 | Ga0207679_10028352 | Ga0207679_100283524 | 330 |
| 203 | 3300031616 | Ga0307508_10000317 | Ga0307508_1000031735 | 330 |
| 204 | 3300031901 | Ga0307406_10088807 | Ga0307406_100888072 | 330 |
| 205 | 3300031911 | Ga0307412_10123685 | Ga0307412_101236852 | 330 |
| 206 | 3300032002 | Ga0307416_100251629 | Ga0307416_1002516292 | 330 |
| 207 | 3300037471 | Ga0395905_0101480 | Ga0395905_0101480_134_1459 | 330 |
| 208 | 3300046525 | Ga0495663_0003305 | Ga0495663_0003305_1342_2634 | 330 |
| 209 | 3300001979 | JGI24740J21852_10009346 | JGI24740J21852_100093465 | 331 |
| 210 | 3300001989 | JGI24739J22299_10004115 | JGI24739J22299_100041156 | 331 |
| 211 | 3300005327 | Ga0070658_10070918 | Ga0070658_100709182 | 331 |
| 212 | 3300005336 | Ga0070680_100081701 | Ga0070680_1000817013 | 331 |
| 213 | 3300005339 | Ga0070660_100035906 | Ga0070660_1000359064 | 331 |
| 214 | 3300005344 | Ga0070661_100023171 | Ga0070661_1000231715 | 331 |
| 215 | 3300025919 | Ga0207657_10071295 | Ga0207657_100712954 | 331 |
| 216 | 3300025920 | Ga0207649_10131843 | Ga0207649_101318432 | 331 |
| 217 | 3300025921 | Ga0207652_10015360 | Ga0207652_100153606 | 331 |
| 218 | 3300025937 | Ga0207669_10057738 | Ga0207669_100577384 | 331 |
| 219 | 3300025944 | Ga0207661_10128219 | Ga0207661_101282192 | 331 |
| 220 | 3300031911 | Ga0307412_10093027 | Ga0307412_100930271 | 331 |
| 221 | 3300037312 | Ga0395899_0188444 | Ga0395899_0188444_97_1425 | 331 |
| 222 | 3300037471 | Ga0395905_0014350 | Ga0395905_0014350_2171_3523 | 331 |
| 223 | 3300045836 | Ga0466958_0074798 | Ga0466958_0074798_204_1580 | 331 |
| 224 | 3300048924 | Ga0496121_0000105 | Ga0496121_0000105_72499_73830 | 331 |
| 225 | 3300048927 | Ga0496124_0005478 | Ga0496124_0005478_12015_13310 | 331 |
| 226 | 3300005578 | Ga0068854_100014036 | Ga0068854_1000140363 | 332 |
| 227 | 3300025981 | Ga0207640_10022315 | Ga0207640_100223153 | 332 |
| 228 | 3300031548 | Ga0307408_100046549 | Ga0307408_1000465494 | 332 |
| 229 | 3300031995 | Ga0307409_100037418 | Ga0307409_1000374183 | 332 |
| 230 | 3300031995 | Ga0307409_100052098 | Ga0307409_1000520984 | 332 |
| 231 | 3300032005 | Ga0307411_10005369 | Ga0307411_100053695 | 332 |
| 232 | 3300032005 | Ga0307411_10043799 | Ga0307411_100437994 | 332 |
| 233 | 3300044693 | Ga0466961_0009726 | Ga0466961_0009726_3891_5180 | 332 |
| 234 | 3300045049 | Ga0466959_0038923 | Ga0466959_0038923_1678_2967 | 332 |
| 235 | 3300005455 | Ga0070663_100064573 | Ga0070663_1000645733 | 333 |
| 236 | 3300005614 | Ga0068856_100004367 | Ga0068856_1000043676 | 333 |
| 237 | 3300013104 | Ga0157370_10028708 | Ga0157370_100287085 | 333 |
| 238 | 3300025972 | Ga0207668_10189232 | Ga0207668_101892321 | 333 |
| 239 | 3300026078 | Ga0207702_10034470 | Ga0207702_100344705 | 333 |
| 240 | 3300031852 | Ga0307410_10003471 | Ga0307410_100034717 | 333 |
| 241 | 3300031901 | Ga0307406_10124168 | Ga0307406_101241682 | 333 |
| 242 | 3300031911 | Ga0307412_10083568 | Ga0307412_100835683 | 333 |
| 243 | 3300031995 | Ga0307409_100139807 | Ga0307409_1001398072 | 333 |
| 244 | 3300032005 | Ga0307411_10008930 | Ga0307411_100089303 | 333 |
| 245 | 3300037466 | Ga0395898_0047627 | Ga0395898_0047627_2831_4111 | 333 |
| 246 | 3300037471 | Ga0395905_0053079 | Ga0395905_0053079_642_1949 | 333 |
| 247 | 3300046513 | Ga0495616_0000140 | Ga0495616_0000140_16049_17410 | 333 |
| 248 | 3300048924 | Ga0496121_0033641 | Ga0496121_0033641_1750_3027 | 333 |
| 249 | 3300053151 | Ga0500604_0000984 | Ga0500604_0000984_6440_7819 | 333 |
| 250 | 3300003214 | JGI25165J46597_1000095 | JGI25165J46597_1000095117 | 334 |
| 251 | 3300005331 | Ga0070670_100019126 | Ga0070670_1000191262 | 334 |
| 252 | 3300005355 | Ga0070671_100073908 | Ga0070671_1000739082 | 334 |
| 253 | 3300005563 | Ga0068855_100040917 | Ga0068855_1000409174 | 334 |
| 254 | 3300005577 | Ga0068857_100015874 | Ga0068857_1000158745 | 334 |
| 255 | 3300014326 | Ga0157380_10004583 | Ga0157380_1000458310 | 334 |
| 256 | 3300025233 | Ga0209437_103045 | Ga0209437_1030452 | 334 |
| 257 | 3300025261 | Ga0209233_1000052 | Ga0209233_100005241 | 334 |
| 258 | 3300025315 | Ga0207697_10033709 | Ga0207697_100337092 | 334 |
| 259 | 3300025907 | Ga0207645_10028697 | Ga0207645_100286973 | 334 |
| 260 | 3300025945 | Ga0207679_10153505 | Ga0207679_101535052 | 334 |
| 261 | 3300026116 | Ga0207674_10023243 | Ga0207674_100232435 | 334 |
| 262 | 3300026116 | Ga0207674_10060765 | Ga0207674_100607653 | 334 |
| 263 | 3300026121 | Ga0207683_10014781 | Ga0207683_100147812 | 334 |
| 264 | 3300031852 | Ga0307410_10075957 | Ga0307410_100759573 | 334 |
| 265 | 3300031911 | Ga0307412_10001749 | Ga0307412_100017494 | 334 |
| 266 | 3300039437 | Ga0436365_1658932 | Ga0436365_1658932_1138_2412 | 334 |
| 267 | 3300047323 | Ga0495683_0008020 | Ga0495683_0008020_918_2207 | 334 |
| 268 | 3300048927 | Ga0496124_0000414 | Ga0496124_0000414_37905_39206 | 334 |
| 269 | 3300005347 | Ga0070668_100034913 | Ga0070668_1000349131 | 335 |
| 270 | 3300005563 | Ga0068855_100230639 | Ga0068855_1002306392 | 335 |
| 271 | 3300025914 | Ga0207671_10004432 | Ga0207671_1000443210 | 335 |
| 272 | 3300025919 | Ga0207657_10115251 | Ga0207657_101152512 | 335 |
| 273 | 3300025942 | Ga0207689_10025288 | Ga0207689_100252884 | 335 |
| 274 | 3300025949 | Ga0207667_10161261 | Ga0207667_101612612 | 335 |
| 275 | 3300026078 | Ga0207702_10115054 | Ga0207702_101150541 | 335 |
| 276 | 3300026121 | Ga0207683_10177557 | Ga0207683_101775573 | 335 |
| 277 | 3300028380 | Ga0268265_10103527 | Ga0268265_101035272 | 335 |
| 278 | 3300031824 | Ga0307413_10010952 | Ga0307413_100109524 | 335 |
| 279 | 3300031852 | Ga0307410_10055511 | Ga0307410_100555114 | 335 |
| 280 | 3300032004 | Ga0307414_10018174 | Ga0307414_100181744 | 335 |
| 281 | 3300032004 | Ga0307414_10081531 | Ga0307414_100815314 | 335 |
| 282 | 3300046537 | Ga0495598_0000495 | Ga0495598_0000495_1038_2354 | 335 |
| 283 | 3300046539 | Ga0495621_0000055 | Ga0495621_0000055_4777_6093 | 335 |
| 284 | 3300046691 | Ga0495670_0000771 | Ga0495670_0000771_8499_9815 | 335 |
| 285 | 3300049589 | Ga0501073_0020655 | Ga0501073_0020655_1741_3117 | 335 |
| 286 | 3300049744 | Ga0501083_0074086 | Ga0501083_0074086_804_2168 | 335 |
| 287 | 3300005329 | Ga0070683_100096732 | Ga0070683_1000967321 | 336 |
| 288 | 3300005577 | Ga0068857_100025761 | Ga0068857_1000257613 | 336 |
| 289 | 3300005841 | Ga0068863_100006027 | Ga0068863_1000060276 | 336 |
| 290 | 3300025904 | Ga0207647_10024022 | Ga0207647_100240225 | 336 |
| 291 | 3300025945 | Ga0207679_10062649 | Ga0207679_100626493 | 336 |
| 292 | 3300026088 | Ga0207641_10032708 | Ga0207641_100327081 | 336 |
| 293 | 3300026116 | Ga0207674_10003055 | Ga0207674_1000305512 | 336 |
| 294 | 3300031824 | Ga0307413_10120854 | Ga0307413_101208541 | 336 |
| 295 | 3300031995 | Ga0307409_100183054 | Ga0307409_1001830542 | 336 |
| 296 | 3300032004 | Ga0307414_10070228 | Ga0307414_100702284 | 336 |
| 297 | 3300037418 | Ga0395900_0055176 | Ga0395900_0055176_1136_2428 | 336 |
| 298 | 3300037471 | Ga0395905_0025055 | Ga0395905_0025055_1452_2789 | 336 |
| 299 | 3300037853 | Ga0436364_1247405 | Ga0436364_1247405_193_1530 | 336 |
| 300 | 3300046506 | Ga0495583_0026464 | Ga0495583_0026464_686_1975 | 336 |
| 301 | 3300047445 | Ga0495677_0004870 | Ga0495677_0004870_635_1918 | 336 |
| 302 | 3300048905 | Ga0496102_0000961 | Ga0496102_0000961_8585_9886 | 336 |
| 303 | 3300048906 | Ga0496103_0000145 | Ga0496103_0000145_2705_4006 | 336 |
| 304 | 3300048907 | Ga0496104_0014613 | Ga0496104_0014613_4743_6044 | 336 |
| 305 | 3300048908 | Ga0496105_0000218 | Ga0496105_0000218_27686_28987 | 336 |
| 306 | 3300048917 | Ga0496114_0002905 | Ga0496114_0002905_5360_6661 | 336 |
| 307 | 3300048918 | Ga0496115_0001038 | Ga0496115_0001038_5091_6392 | 336 |
| 308 | 3300048919 | Ga0496116_0001809 | Ga0496116_0001809_13634_14935 | 336 |
| 309 | 3300048920 | Ga0496117_0000910 | Ga0496117_0000910_9620_10921 | 336 |
| 310 | 3300048921 | Ga0496118_0000091 | Ga0496118_0000091_162255_163556 | 336 |
| 311 | 3300048924 | Ga0496121_0000429 | Ga0496121_0000429_80174_81475 | 336 |
| 312 | 3300048927 | Ga0496124_0000375 | Ga0496124_0000375_70412_71713 | 336 |
| 313 | 3300048929 | Ga0496126_0000443 | Ga0496126_0000443_70354_71655 | 336 |
| 314 | 3300005335 | Ga0070666_10006279 | Ga0070666_100062795 | 337 |
| 315 | 3300005338 | Ga0068868_100039288 | Ga0068868_1000392884 | 337 |
| 316 | 3300005339 | Ga0070660_100043991 | Ga0070660_1000439913 | 337 |
| 317 | 3300005367 | Ga0070667_100004908 | Ga0070667_1000049085 | 337 |
| 318 | 3300005842 | Ga0068858_100042830 | Ga0068858_1000428305 | 337 |
| 319 | 3300009177 | Ga0105248_10054516 | Ga0105248_100545164 | 337 |
| 320 | 3300025903 | Ga0207680_10001079 | Ga0207680_1000107912 | 337 |
| 321 | 3300025919 | Ga0207657_10026062 | Ga0207657_100260626 | 337 |
| 322 | 3300025931 | Ga0207644_10074058 | Ga0207644_100740583 | 337 |
| 323 | 3300025940 | Ga0207691_10062142 | Ga0207691_100621422 | 337 |
| 324 | 3300025941 | Ga0207711_10000946 | Ga0207711_1000094620 | 337 |
| 325 | 3300025986 | Ga0207658_10008943 | Ga0207658_100089435 | 337 |
| 326 | 3300026023 | Ga0207677_10010628 | Ga0207677_100106284 | 337 |
| 327 | 3300026035 | Ga0207703_10000896 | Ga0207703_1000089628 | 337 |
| 328 | 3300026121 | Ga0207683_10303379 | Ga0207683_103033791 | 337 |
| 329 | 3300037418 | Ga0395900_0033345 | Ga0395900_0033345_2744_4069 | 337 |
| 330 | 3300046522 | Ga0495643_0002280 | Ga0495643_0002280_1291_2586 | 337 |
| 331 | 3300046664 | Ga0495659_0030286 | Ga0495659_0030286_564_1862 | 337 |
| 332 | 3300047445 | Ga0495677_0007290 | Ga0495677_0007290_97_1392 | 337 |
| 333 | 3300053134 | Ga0500658_0008056 | Ga0500658_0008056_1680_3059 | 337 |
| 334 | 3300005457 | Ga0070662_100101657 | Ga0070662_1001016573 | 338 |
| 335 | 3300005614 | Ga0068856_100252040 | Ga0068856_1002520402 | 338 |
| 336 | 3300005841 | Ga0068863_100027707 | Ga0068863_1000277073 | 338 |
| 337 | 3300005842 | Ga0068858_100000380 | Ga0068858_10000038039 | 338 |
| 338 | 3300006186 | Ga0075369_10025086 | Ga0075369_100250862 | 338 |
| 339 | 3300009177 | Ga0105248_10005414 | Ga0105248_100054142 | 338 |
| 340 | 3300009553 | Ga0105249_10125159 | Ga0105249_101251592 | 338 |
| 341 | 3300013105 | Ga0157369_10091370 | Ga0157369_100913706 | 338 |
| 342 | 3300013306 | Ga0163162_10017961 | Ga0163162_100179613 | 338 |
| 343 | 3300013306 | Ga0163162_10113135 | Ga0163162_101131353 | 338 |
| 344 | 3300013306 | Ga0163162_10132014 | Ga0163162_101320143 | 338 |
| 345 | 3300025304 | Ga0209257_1015531 | Ga0209257_10155314 | 338 |
| 346 | 3300026035 | Ga0207703_10001312 | Ga0207703_1000131213 | 338 |
| 347 | 3300026041 | Ga0207639_10061676 | Ga0207639_100616764 | 338 |
| 348 | 3300026078 | Ga0207702_10150367 | Ga0207702_101503672 | 338 |
| 349 | 3300026088 | Ga0207641_10006197 | Ga0207641_100061974 | 338 |
| 350 | 3300036712 | Ga0316584_0129385 | Ga0316584_0129385_203_1483 | 338 |
| 351 | 3300037418 | Ga0395900_0004543 | Ga0395900_0004543_7225_8541 | 338 |
| 352 | 3300037418 | Ga0395900_0009895 | Ga0395900_0009895_2771_4120 | 338 |
| 353 | 3300037466 | Ga0395898_0001585 | Ga0395898_0001585_17715_19031 | 338 |
| 354 | 3300037471 | Ga0395905_0000089 | Ga0395905_0000089_12052_13368 | 338 |
| 355 | 3300037471 | Ga0395905_0002105 | Ga0395905_0002105_5360_6709 | 338 |
| 356 | 3300039450 | Ga0436363_1537430 | Ga0436363_1537430_113_1426 | 338 |
| 357 | 3300046460 | Ga0495638_0000128 | Ga0495638_0000128_116455_117744 | 338 |
| 358 | 3300046524 | Ga0495648_0001484 | Ga0495648_0001484_9337_10626 | 338 |
| 359 | 3300046691 | Ga0495670_0000015 | Ga0495670_0000015_55716_57014 | 338 |
| 360 | 3300047443 | Ga0495687_000471 | Ga0495687_000471_40741_42024 | 338 |
| 361 | 3300048912 | Ga0496109_0264400 | Ga0496109_0264400_107_1579 | 338 |
| 362 | 3300048916 | Ga0496113_0095054 | Ga0496113_0095054_70_1359 | 338 |
| 363 | 3300048925 | Ga0496122_0029994 | Ga0496122_0029994_1200_2489 | 338 |
| 364 | 3300048928 | Ga0496125_0005261 | Ga0496125_0005261_1448_2737 | 338 |
| 365 | 3300005262 | Ga0065165_1003177 | Ga0065165_10031777 | 339 |
| 366 | 3300005289 | Ga0065704_10081931 | Ga0065704_100819312 | 339 |
| 367 | 3300005353 | Ga0070669_100000715 | Ga0070669_1000007158 | 339 |
| 368 | 3300005367 | Ga0070667_100013603 | Ga0070667_1000136034 | 339 |
| 369 | 3300005617 | Ga0068859_100235364 | Ga0068859_1002353642 | 339 |
| 370 | 3300005841 | Ga0068863_100000092 | Ga0068863_10000009273 | 339 |
| 371 | 3300005844 | Ga0068862_100008302 | Ga0068862_1000083023 | 339 |
| 372 | 3300005844 | Ga0068862_100010722 | Ga0068862_1000107227 | 339 |
| 373 | 3300006195 | Ga0075366_10063596 | Ga0075366_100635961 | 339 |
| 374 | 3300006931 | Ga0097620_100235363 | Ga0097620_1002353632 | 339 |
| 375 | 3300009553 | Ga0105249_10004663 | Ga0105249_100046632 | 339 |
| 376 | 3300014968 | Ga0157379_10224012 | Ga0157379_102240121 | 339 |
| 377 | 3300025904 | Ga0207647_10040387 | Ga0207647_100403873 | 339 |
| 378 | 3300025923 | Ga0207681_10002989 | Ga0207681_1000298913 | 339 |
| 379 | 3300025937 | Ga0207669_10000989 | Ga0207669_100009896 | 339 |
| 380 | 3300025961 | Ga0207712_10008250 | Ga0207712_100082502 | 339 |
| 381 | 3300025986 | Ga0207658_10009111 | Ga0207658_100091113 | 339 |
| 382 | 3300026088 | Ga0207641_10000004 | Ga0207641_10000004417 | 339 |
| 383 | 3300028380 | Ga0268265_10028903 | Ga0268265_100289032 | 339 |
| 384 | 3300028380 | Ga0268265_10070971 | Ga0268265_100709713 | 339 |
| 385 | 3300028786 | Ga0307517_10074308 | Ga0307517_100743083 | 339 |
| 386 | 3300046616 | Ga0495668_0000016 | Ga0495668_0000016_153921_155210 | 339 |
| 387 | 3300046694 | Ga0495649_0032522 | Ga0495649_0032522_293_1582 | 339 |
| 388 | 3300048904 | Ga0496101_0020877 | Ga0496101_0020877_2305_3783 | 339 |
| 389 | 3300048905 | Ga0496102_0013728 | Ga0496102_0013728_4843_6321 | 339 |
| 390 | 3300048906 | Ga0496103_0000038 | Ga0496103_0000038_56176_57654 | 339 |
| 391 | 3300048907 | Ga0496104_0000123 | Ga0496104_0000123_47845_49323 | 339 |
| 392 | 3300048908 | Ga0496105_0000165 | Ga0496105_0000165_30178_31656 | 339 |
| 393 | 3300048910 | Ga0496107_0106512 | Ga0496107_0106512_437_1915 | 339 |
| 394 | 3300048915 | Ga0496112_0008161 | Ga0496112_0008161_1431_2909 | 339 |
| 395 | 3300048916 | Ga0496113_0009075 | Ga0496113_0009075_158_1636 | 339 |
| 396 | 3300048919 | Ga0496116_0012660 | Ga0496116_0012660_2721_4067 | 339 |
| 397 | 3300048920 | Ga0496117_0018333 | Ga0496117_0018333_881_2227 | 339 |
| 398 | 3300048922 | Ga0496119_0001044 | Ga0496119_0001044_5170_6648 | 339 |
| 399 | 3300048923 | Ga0496120_0001555 | Ga0496120_0001555_9437_10915 | 339 |
| 400 | 3300048924 | Ga0496121_0000168 | Ga0496121_0000168_141393_142670 | 339 |
| 401 | 3300048924 | Ga0496121_0016537 | Ga0496121_0016537_382_1860 | 339 |
| 402 | 3300048925 | Ga0496122_0001814 | Ga0496122_0001814_19861_21339 | 339 |
| 403 | 3300048926 | Ga0496123_0003740 | Ga0496123_0003740_3394_4872 | 339 |
| 404 | 3300048928 | Ga0496125_0001376 | Ga0496125_0001376_22432_23910 | 339 |
| 405 | 3300048929 | Ga0496126_0000066 | Ga0496126_0000066_163537_165015 | 339 |
| 406 | 3300003762 | Ga0055542_1000322 | Ga0055542_100032242 | 340 |
| 407 | 3300003763 | Ga0055529_1000014 | Ga0055529_1000014284 | 340 |
| 408 | 3300005331 | Ga0070670_100005597 | Ga0070670_10000559714 | 340 |
| 409 | 3300005335 | Ga0070666_10041785 | Ga0070666_100417853 | 340 |
| 410 | 3300005355 | Ga0070671_100000009 | Ga0070671_10000000937 | 340 |
| 411 | 3300005543 | Ga0070672_100219300 | Ga0070672_1002193001 | 340 |
| 412 | 3300005618 | Ga0068864_100002974 | Ga0068864_1000029749 | 340 |
| 413 | 3300014325 | Ga0163163_10136381 | Ga0163163_101363812 | 340 |
| 414 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011289 | 340 |
| 415 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006905 | 340 |
| 416 | 3300025931 | Ga0207644_10000006 | Ga0207644_1000000637 | 340 |
| 417 | 3300025940 | Ga0207691_10287244 | Ga0207691_102872441 | 340 |
| 418 | 3300026088 | Ga0207641_10007148 | Ga0207641_100071481 | 340 |
| 419 | 3300026095 | Ga0207676_10001115 | Ga0207676_100011155 | 340 |
| 420 | 3300026118 | Ga0207675_100006088 | Ga0207675_1000060882 | 340 |
| 421 | 3300031240 | Ga0265320_10082223 | Ga0265320_100822232 | 340 |
| 422 | 3300031456 | Ga0307513_10008420 | Ga0307513_100084206 | 340 |
| 423 | 3300031852 | Ga0307410_10089542 | Ga0307410_100895423 | 340 |
| 424 | 3300032004 | Ga0307414_10170380 | Ga0307414_101703803 | 340 |
| 425 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_23008_24402 | 340 |
| 426 | 3300046471 | Ga0495650_0000259 | Ga0495650_0000259_91478_92761 | 340 |
| 427 | 3300046492 | Ga0495585_0005032 | Ga0495585_0005032_2141_3430 | 340 |
| 428 | 3300046522 | Ga0495643_0002012 | Ga0495643_0002012_7866_9155 | 340 |
| 429 | 3300046660 | Ga0495625_0000092 | Ga0495625_0000092_8312_9601 | 340 |
| 430 | 3300053140 | Ga0500573_0000271 | Ga0500573_0000271_11601_12893 | 340 |
| 431 | 3300001915 | JGI24741J21665_1000819 | JGI24741J21665_100081911 | 341 |
| 432 | 3300001979 | JGI24740J21852_10006234 | JGI24740J21852_100062344 | 341 |
| 433 | 3300001990 | JGI24737J22298_10001056 | JGI24737J22298_1000105612 | 341 |
| 434 | 3300005327 | Ga0070658_10001914 | Ga0070658_100019149 | 341 |
| 435 | 3300005327 | Ga0070658_10112917 | Ga0070658_101129172 | 341 |
| 436 | 3300005339 | Ga0070660_100004814 | Ga0070660_1000048145 | 341 |
| 437 | 3300005339 | Ga0070660_100037408 | Ga0070660_1000374084 | 341 |
| 438 | 3300005344 | Ga0070661_100004468 | Ga0070661_1000044682 | 341 |
| 439 | 3300005354 | Ga0070675_100090365 | Ga0070675_1000903654 | 341 |
| 440 | 3300005455 | Ga0070663_100022084 | Ga0070663_1000220842 | 341 |
| 441 | 3300005456 | Ga0070678_100000060 | Ga0070678_10000006035 | 341 |
| 442 | 3300005530 | Ga0070679_100016861 | Ga0070679_1000168611 | 341 |
| 443 | 3300005548 | Ga0070665_100000115 | Ga0070665_100000115156 | 341 |
| 444 | 3300005564 | Ga0070664_100101878 | Ga0070664_1001018782 | 341 |
| 445 | 3300005834 | Ga0068851_10008051 | Ga0068851_100080512 | 341 |
| 446 | 3300013102 | Ga0157371_10000193 | Ga0157371_1000019387 | 341 |
| 447 | 3300013105 | Ga0157369_10264064 | Ga0157369_102640642 | 341 |
| 448 | 3300025321 | Ga0207656_10002880 | Ga0207656_100028804 | 341 |
| 449 | 3300025909 | Ga0207705_10000237 | Ga0207705_1000023711 | 341 |
| 450 | 3300025909 | Ga0207705_10000511 | Ga0207705_1000051136 | 341 |
| 451 | 3300025911 | Ga0207654_10000227 | Ga0207654_100002275 | 341 |
| 452 | 3300025913 | Ga0207695_10025115 | Ga0207695_100251154 | 341 |
| 453 | 3300025914 | Ga0207671_10009213 | Ga0207671_100092136 | 341 |
| 454 | 3300025919 | Ga0207657_10001241 | Ga0207657_100012419 | 341 |
| 455 | 3300025919 | Ga0207657_10011870 | Ga0207657_1001187012 | 341 |
| 456 | 3300025920 | Ga0207649_10003792 | Ga0207649_100037929 | 341 |
| 457 | 3300025921 | Ga0207652_10005457 | Ga0207652_100054573 | 341 |
| 458 | 3300025924 | Ga0207694_10000683 | Ga0207694_1000068317 | 341 |
| 459 | 3300025932 | Ga0207690_10001226 | Ga0207690_1000122614 | 341 |
| 460 | 3300025937 | Ga0207669_10000030 | Ga0207669_1000003087 | 341 |
| 461 | 3300026067 | Ga0207678_10001389 | Ga0207678_100013899 | 341 |
| 462 | 3300026078 | Ga0207702_10011067 | Ga0207702_100110675 | 341 |
| 463 | 3300026116 | Ga0207674_10012450 | Ga0207674_100124504 | 341 |
| 464 | 3300026121 | Ga0207683_10000075 | Ga0207683_1000007512 | 341 |
| 465 | 3300026142 | Ga0207698_10008427 | Ga0207698_100084274 | 341 |
| 466 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015601 | 341 |
| 467 | 3300028794 | Ga0307515_10259608 | Ga0307515_102596082 | 341 |
| 468 | 3300031911 | Ga0307412_10000557 | Ga0307412_1000055718 | 341 |
| 469 | 3300032004 | Ga0307414_10000288 | Ga0307414_1000028816 | 341 |
| 470 | 3300046500 | Ga0495596_0006657 | Ga0495596_0006657_3025_4320 | 341 |
| 471 | 3300046522 | Ga0495643_0023318 | Ga0495643_0023318_1343_2695 | 341 |
| 472 | 3300047323 | Ga0495683_0028132 | Ga0495683_0028132_1352_2647 | 341 |
| 473 | 3300047443 | Ga0495687_001946 | Ga0495687_001946_9925_11208 | 341 |
| 474 | 3300047472 | Ga0495686_0000486 | Ga0495686_0000486_44074_45390 | 341 |
| 475 | 3300048928 | Ga0496125_0056100 | Ga0496125_0056100_1006_2313 | 341 |
| 476 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_703590_704879 | 341 |
| 477 | 3300053177 | Ga0500636_0000462 | Ga0500636_0000462_18743_20032 | 341 |
| 478 | 3300003759 | Ga0055525_1000012 | Ga0055525_1000012165 | 342 |
| 479 | 3300005331 | Ga0070670_100000344 | Ga0070670_10000034416 | 342 |
| 480 | 3300005335 | Ga0070666_10000160 | Ga0070666_1000016045 | 342 |
| 481 | 3300005353 | Ga0070669_100000013 | Ga0070669_100000013186 | 342 |
| 482 | 3300005367 | Ga0070667_100061234 | Ga0070667_1000612341 | 342 |
| 483 | 3300005440 | Ga0070705_100008071 | Ga0070705_1000080713 | 342 |
| 484 | 3300005459 | Ga0068867_100046955 | Ga0068867_1000469553 | 342 |
| 485 | 3300005539 | Ga0068853_100147801 | Ga0068853_1001478012 | 342 |
| 486 | 3300005544 | Ga0070686_100047865 | Ga0070686_1000478652 | 342 |
| 487 | 3300005548 | Ga0070665_100007685 | Ga0070665_1000076857 | 342 |
| 488 | 3300005842 | Ga0068858_100058043 | Ga0068858_1000580432 | 342 |
| 489 | 3300009148 | Ga0105243_10001186 | Ga0105243_1000118613 | 342 |
| 490 | 3300009545 | Ga0105237_10170457 | Ga0105237_101704572 | 342 |
| 491 | 3300009553 | Ga0105249_10001604 | Ga0105249_100016048 | 342 |
| 492 | 3300014968 | Ga0157379_10005137 | Ga0157379_100051375 | 342 |
| 493 | 3300025230 | Ga0209563_100030 | Ga0209563_100030283 | 342 |
| 494 | 3300025253 | Ga0209677_107247 | Ga0209677_1072472 | 342 |
| 495 | 3300025315 | Ga0207697_10019384 | Ga0207697_100193842 | 342 |
| 496 | 3300025903 | Ga0207680_10004576 | Ga0207680_100045762 | 342 |
| 497 | 3300025923 | Ga0207681_10000008 | Ga0207681_1000000847 | 342 |
| 498 | 3300025935 | Ga0207709_10000246 | Ga0207709_1000024652 | 342 |
| 499 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002170 | 342 |
| 500 | 3300025981 | Ga0207640_10006133 | Ga0207640_100061336 | 342 |
| 501 | 3300026041 | Ga0207639_10012330 | Ga0207639_100123306 | 342 |
| 502 | 3300026089 | Ga0207648_10016823 | Ga0207648_100168237 | 342 |
| 503 | 3300028379 | Ga0268266_10030749 | Ga0268266_100307492 | 342 |
| 504 | 3300028380 | Ga0268265_10000392 | Ga0268265_1000039237 | 342 |
| 505 | 3300046506 | Ga0495583_0001674 | Ga0495583_0001674_12721_14016 | 342 |
| 506 | 3300046539 | Ga0495621_0042758 | Ga0495621_0042758_116_1378 | 342 |
| 507 | 3300046558 | Ga0495633_0003568 | Ga0495633_0003568_14_1309 | 342 |
| 508 | 3300046809 | Ga0495600_0008265 | Ga0495600_0008265_4863_6164 | 342 |
| 509 | 3300053104 | Ga0500556_0000014 | Ga0500556_0000014_77324_78613 | 342 |
| 510 | 3300053118 | Ga0500594_0003951 | Ga0500594_0003951_967_2277 | 342 |
| 511 | 3300053122 | Ga0500608_000280 | Ga0500608_000280_10613_11929 | 342 |
| 512 | 3300053130 | Ga0500642_0013317 | Ga0500642_0013317_666_1982 | 342 |
| 513 | 3300053138 | Ga0500564_000953 | Ga0500564_000953_3760_5070 | 342 |
| 514 | 3300053723 | Ga0500567_000811 | Ga0500567_000811_4034_5350 | 342 |
| 515 | 3300053729 | Ga0500625_000006 | Ga0500625_000006_154391_155701 | 342 |
| 516 | 3300003215 | JGI25153J46596_10000010 | JGI25153J46596_10000010194 | 343 |
| 517 | 3300003215 | JGI25153J46596_10000031 | JGI25153J46596_10000031176 | 343 |
| 518 | 3300005347 | Ga0070668_100000028 | Ga0070668_10000002839 | 343 |
| 519 | 3300005355 | Ga0070671_100003648 | Ga0070671_1000036487 | 343 |
| 520 | 3300009098 | Ga0105245_10002151 | Ga0105245_1000215114 | 343 |
| 521 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001609 | 343 |
| 522 | 3300025297 | Ga0209758_1000033 | Ga0209758_1000033335 | 343 |
| 523 | 3300025927 | Ga0207687_10000798 | Ga0207687_1000079819 | 343 |
| 524 | 3300025931 | Ga0207644_10000094 | Ga0207644_1000009429 | 343 |
| 525 | 3300025972 | Ga0207668_10000076 | Ga0207668_1000007611 | 343 |
| 526 | 3300028381 | Ga0268264_10004774 | Ga0268264_100047747 | 343 |
| 527 | 3300046507 | Ga0495606_0000029 | Ga0495606_0000029_241314_242603 | 343 |
| 528 | 3300046684 | Ga0495669_0000039 | Ga0495669_0000039_84315_85622 | 343 |
| 529 | 3300053079 | Ga0500610_0000231 | Ga0500610_0000231_4167_5474 | 343 |
| 530 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_191015_192322 | 343 |
| 531 | 3300005459 | Ga0068867_100003900 | Ga0068867_1000039003 | 344 |
| 532 | 3300005616 | Ga0068852_100091189 | Ga0068852_1000911893 | 344 |
| 533 | 3300025909 | Ga0207705_10014106 | Ga0207705_100141064 | 344 |
| 534 | 3300025929 | Ga0207664_10028396 | Ga0207664_100283962 | 344 |
| 535 | 3300026089 | Ga0207648_10032807 | Ga0207648_100328074 | 344 |
| 536 | 3300031456 | Ga0307513_10043231 | Ga0307513_100432313 | 344 |
| 537 | 3300046660 | Ga0495625_0072697 | Ga0495625_0072697_619_1908 | 344 |
| 538 | 3300053119 | Ga0500595_001729 | Ga0500595_001729_4645_5859 | 344 |
| 539 | 3300053146 | Ga0500588_0001660 | Ga0500588_0001660_1092_2303 | 344 |
| 540 | 3300053730 | Ga0500645_000315 | Ga0500645_000315_3115_4395 | 344 |
| 541 | iso_pu_bacteria | 2852653556 | 2852655352 | 344 |
| 542 | iso_pu_bacteria | 2919138771 | 2919139912 | 344 |
| 543 | 3300046500 | Ga0495596_0000053 | Ga0495596_0000053_29830_31173 | 345 |
| 544 | 3300046524 | Ga0495648_0099235 | Ga0495648_0099235_207_1481 | 345 |
| 545 | 3300046538 | Ga0495609_0016952 | Ga0495609_0016952_354_1697 | 345 |
| 546 | 3300046660 | Ga0495625_0033599 | Ga0495625_0033599_405_1748 | 345 |
| 547 | 3300049574 | Ga0501038_0032224 | Ga0501038_0032224_1986_3314 | 345 |
| 548 | 3300049581 | Ga0501047_0153998 | Ga0501047_0153998_637_1905 | 345 |
| 549 | 3300049823 | Ga0501044_0310278 | Ga0501044_0310278_13_1281 | 345 |
| 550 | 3300053087 | Ga0500643_000465 | Ga0500643_000465_6986_8302 | 345 |
| 551 | 3300046542 | Ga0495597_0024651 | Ga0495597_0024651_1278_2594 | 346 |
| 552 | 3300046692 | Ga0495671_0023659 | Ga0495671_0023659_1863_3155 | 346 |
| 553 | 3300053093 | Ga0500651_0019900 | Ga0500651_0019900_1035_2351 | 346 |
| 554 | 3300003781 | Ga0055536_1000422 | Ga0055536_100042218 | 347 |
| 555 | 3300003794 | Ga0055531_10000449 | Ga0055531_1000044923 | 347 |
| 556 | 3300005331 | Ga0070670_100001938 | Ga0070670_1000019387 | 347 |
| 557 | 3300005335 | Ga0070666_10012951 | Ga0070666_100129513 | 347 |
| 558 | 3300005456 | Ga0070678_100097180 | Ga0070678_1000971802 | 347 |
| 559 | 3300005457 | Ga0070662_100040801 | Ga0070662_1000408011 | 347 |
| 560 | 3300005617 | Ga0068859_100141010 | Ga0068859_1001410103 | 347 |
| 561 | 3300005842 | Ga0068858_100000261 | Ga0068858_10000026121 | 347 |
| 562 | 3300006931 | Ga0097620_100141005 | Ga0097620_1001410053 | 347 |
| 563 | 3300011119 | Ga0105246_10000157 | Ga0105246_1000015712 | 347 |
| 564 | 3300013100 | Ga0157373_10105584 | Ga0157373_101055842 | 347 |
| 565 | 3300025292 | Ga0209676_1000483 | Ga0209676_100048318 | 347 |
| 566 | 3300025298 | Ga0209050_1001210 | Ga0209050_100121018 | 347 |
| 567 | 3300025304 | Ga0209257_1000532 | Ga0209257_100053228 | 347 |
| 568 | 3300025925 | Ga0207650_10001881 | Ga0207650_100018817 | 347 |
| 569 | 3300025949 | Ga0207667_10006208 | Ga0207667_1000620811 | 347 |
| 570 | 3300026035 | Ga0207703_10000253 | Ga0207703_1000025325 | 347 |
| 571 | 3300026121 | Ga0207683_10127463 | Ga0207683_101274632 | 347 |
| 572 | 3300049592 | Ga0501076_0012864 | Ga0501076_0012864_4841_6160 | 347 |
| 573 | 3300053087 | Ga0500643_007628 | Ga0500643_007628_981_2282 | 347 |
| 574 | iso_pu_bacteria | 2738541275 | 2738711740 | 347 |
| 575 | iso_pu_bacteria | 2738541301 | 2738850165 | 347 |
| 576 | iso_pu_bacteria | 2738541304 | 2738865894 | 347 |
| 577 | iso_pu_bacteria | 2738543022 | 2739298412 | 347 |
| 578 | iso_pu_bacteria | 2738543033 | 2739360090 | 347 |
| 579 | iso_pu_bacteria | 2775507255 | 2778124221 | 347 |
| 580 | iso_pu_bacteria | 2928959182 | 2928959698 | 347 |
| 581 | 3300005347 | Ga0070668_100000049 | Ga0070668_10000004965 | 348 |
| 582 | 3300005353 | Ga0070669_100028017 | Ga0070669_1000280173 | 348 |
| 583 | 3300005355 | Ga0070671_100000269 | Ga0070671_10000026919 | 348 |
| 584 | 3300005367 | Ga0070667_100000009 | Ga0070667_10000000911 | 348 |
| 585 | 3300005841 | Ga0068863_100030672 | Ga0068863_1000306723 | 348 |
| 586 | 3300005843 | Ga0068860_100000042 | Ga0068860_100000042201 | 348 |
| 587 | 3300005844 | Ga0068862_100000411 | Ga0068862_10000041133 | 348 |
| 588 | 3300013308 | Ga0157375_10104117 | Ga0157375_101041172 | 348 |
| 589 | 3300025923 | Ga0207681_10048215 | Ga0207681_100482152 | 348 |
| 590 | 3300025931 | Ga0207644_10000088 | Ga0207644_1000008849 | 348 |
| 591 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000028 | 348 |
| 592 | 3300026041 | Ga0207639_10266005 | Ga0207639_102660051 | 348 |
| 593 | 3300026088 | Ga0207641_10004732 | Ga0207641_100047327 | 348 |
| 594 | 3300028380 | Ga0268265_10000582 | Ga0268265_1000058212 | 348 |
| 595 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001333 | 348 |
| 596 | 3300031548 | Ga0307408_100006783 | Ga0307408_1000067837 | 348 |
| 597 | 3300031548 | Ga0307408_100011783 | Ga0307408_1000117833 | 348 |
| 598 | 3300031852 | Ga0307410_10124425 | Ga0307410_101244252 | 348 |
| 599 | 3300031911 | Ga0307412_10005086 | Ga0307412_100050866 | 348 |
| 600 | 3300031911 | Ga0307412_10027029 | Ga0307412_100270295 | 348 |
| 601 | 3300031995 | Ga0307409_100028665 | Ga0307409_1000286654 | 348 |
| 602 | 3300032002 | Ga0307416_100087366 | Ga0307416_1000873663 | 348 |
| 603 | 3300032004 | Ga0307414_10085284 | Ga0307414_100852842 | 348 |
| 604 | 3300032005 | Ga0307411_10005662 | Ga0307411_100056626 | 348 |
| 605 | iso_pu_bacteria | 2885427238 | 2885427557 | 348 |
| 606 | iso_pu_bacteria | 2928100450 | 2928101607 | 348 |
| 607 | 3300005618 | Ga0068864_100001677 | Ga0068864_1000016775 | 349 |
| 608 | 3300005841 | Ga0068863_100071078 | Ga0068863_1000710782 | 349 |
| 609 | 3300007076 | Ga0075435_100013014 | Ga0075435_1000130146 | 349 |
| 610 | 3300026088 | Ga0207641_10001025 | Ga0207641_100010259 | 349 |
| 611 | 3300026095 | Ga0207676_10012257 | Ga0207676_100122575 | 349 |
| 612 | 3300032004 | Ga0307414_10015729 | Ga0307414_100157294 | 349 |
| 613 | 3300033180 | Ga0307510_10005954 | Ga0307510_100059547 | 349 |
| 614 | 3300048905 | Ga0496102_0101584 | Ga0496102_0101584_143_1537 | 349 |
| 615 | 3300048912 | Ga0496109_0026058 | Ga0496109_0026058_916_2310 | 349 |
| 616 | 3300048913 | Ga0496110_0013061 | Ga0496110_0013061_1032_2426 | 349 |
| 617 | 3300048915 | Ga0496112_0045754 | Ga0496112_0045754_1934_3328 | 349 |
| 618 | 3300048917 | Ga0496114_0025594 | Ga0496114_0025594_773_2167 | 349 |
| 619 | 3300050513 | nmdc:mga0rr50_9616_c1 | nmdc:mga0rr50_9616_c1_3832_5331 | 349 |
| 620 | iso_pu_bacteria | 2599185354 | 2600201473 | 349 |
| 621 | iso_pu_bacteria | 2599185359 | 2600228219 | 349 |
| 622 | iso_pu_bacteria | 2808606401 | 2809064667 | 349 |
| 623 | iso_pu_bacteria | 2818991466 | 2819716264 | 349 |
| 624 | iso_pu_bacteria | 2830075706 | 2830077289 | 349 |
| 625 | iso_pu_bacteria | 2879163058 | 2879163976 | 349 |
| 626 | iso_pu_bacteria | 2896184354 | 2896184842 | 349 |
| 627 | iso_pu_bacteria | 2896429255 | 2896431140 | 349 |
| 628 | iso_pu_bacteria | 2928968154 | 2928970484 | 349 |
| 629 | 3300005327 | Ga0070658_10023150 | Ga0070658_100231504 | 350 |
| 630 | 3300005329 | Ga0070683_100012146 | Ga0070683_1000121465 | 350 |
| 631 | 3300005336 | Ga0070680_100006780 | Ga0070680_10000678011 | 350 |
| 632 | 3300005339 | Ga0070660_100035146 | Ga0070660_1000351463 | 350 |
| 633 | 3300005344 | Ga0070661_100005092 | Ga0070661_10000509211 | 350 |
| 634 | 3300005344 | Ga0070661_100039939 | Ga0070661_1000399394 | 350 |
| 635 | 3300005366 | Ga0070659_100013393 | Ga0070659_1000133934 | 350 |
| 636 | 3300005458 | Ga0070681_10002429 | Ga0070681_1000242917 | 350 |
| 637 | 3300005530 | Ga0070679_100023181 | Ga0070679_1000231816 | 350 |
| 638 | 3300005539 | Ga0068853_100009284 | Ga0068853_1000092842 | 350 |
| 639 | 3300005564 | Ga0070664_100005447 | Ga0070664_1000054475 | 350 |
| 640 | 3300005578 | Ga0068854_100026006 | Ga0068854_1000260061 | 350 |
| 641 | 3300013100 | Ga0157373_10019332 | Ga0157373_100193323 | 350 |
| 642 | 3300013102 | Ga0157371_10014561 | Ga0157371_100145616 | 350 |
| 643 | 3300013104 | Ga0157370_10007287 | Ga0157370_100072876 | 350 |
| 644 | 3300013105 | Ga0157369_10062188 | Ga0157369_100621882 | 350 |
| 645 | 3300013307 | Ga0157372_10060288 | Ga0157372_100602883 | 350 |
| 646 | 3300025909 | Ga0207705_10021462 | Ga0207705_100214625 | 350 |
| 647 | 3300025911 | Ga0207654_10048133 | Ga0207654_100481332 | 350 |
| 648 | 3300025917 | Ga0207660_10036415 | Ga0207660_100364154 | 350 |
| 649 | 3300025919 | Ga0207657_10000289 | Ga0207657_100002898 | 350 |
| 650 | 3300025920 | Ga0207649_10012897 | Ga0207649_100128974 | 350 |
| 651 | 3300025921 | Ga0207652_10044682 | Ga0207652_100446824 | 350 |
| 652 | 3300025933 | Ga0207706_10001712 | Ga0207706_100017126 | 350 |
| 653 | 3300025944 | Ga0207661_10015224 | Ga0207661_100152244 | 350 |
| 654 | 3300025949 | Ga0207667_10064884 | Ga0207667_100648843 | 350 |
| 655 | 3300025981 | Ga0207640_10081303 | Ga0207640_100813031 | 350 |
| 656 | 3300026041 | Ga0207639_10027739 | Ga0207639_100277394 | 350 |
| 657 | 3300026118 | Ga0207675_100031426 | Ga0207675_1000314263 | 350 |
| 658 | iso_pu_bacteria | 2510917021 | 2511126951 | 350 |
| 659 | iso_pu_bacteria | 2739367664 | 2739649952 | 350 |
| 660 | iso_pu_bacteria | 2739367865 | 2740028425 | 350 |
| 661 | iso_pu_bacteria | 2751185897 | 2753763459 | 350 |
| 662 | iso_pu_bacteria | 2848297114 | 2848299877 | 350 |
| 663 | iso_pu_bacteria | 2928526807 | 2928528933 | 350 |
| 664 | iso_pu_bacteria | 2946787523 | 2946787760 | 350 |
| 665 | iso_pu_bacteria | 3000865235 | 3000866064 | 350 |
| 666 | 3300009545 | Ga0105237_10005078 | Ga0105237_1000507810 | 351 |
| 667 | 3300025914 | Ga0207671_10002570 | Ga0207671_1000257014 | 351 |
| 668 | 3300032133 | Ga0316583_10003553 | Ga0316583_100035534 | 351 |
| 669 | 3300053087 | Ga0500643_000030 | Ga0500643_000030_84620_85921 | 351 |
| 670 | 3300037418 | Ga0395900_0012195 | Ga0395900_0012195_1835_3205 | 352 |
| 671 | 3300009093 | Ga0105240_10009242 | Ga0105240_1000924215 | 354 |
| 672 | 3300048928 | Ga0496125_0003787 | Ga0496125_0003787_5165_6412 | 354 |
| 673 | 3300001904 | JGI24736J21556_1001126 | JGI24736J21556_10011266 | 356 |
| 674 | 3300005834 | Ga0068851_10024511 | Ga0068851_100245112 | 356 |
| 675 | 3300025321 | Ga0207656_10004383 | Ga0207656_100043833 | 356 |
| 676 | 3300025904 | Ga0207647_10000038 | Ga0207647_1000003844 | 356 |
| 677 | 3300025949 | Ga0207667_10027810 | Ga0207667_100278102 | 356 |
| 678 | 3300026116 | Ga0207674_10024567 | Ga0207674_100245674 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bgj-assembly1.cif.gz_A | c. thermophilum pyruvate dehydrogenase complex core | 0.935 | 154 | 356 |
| 7bgj-assembly1.cif.gz_A | c. thermophilum pyruvate dehydrogenase complex core | 0.9092 | 154 | 356 |
| 7wta-assembly1.cif.gz_D | cryo-em structure of human pyruvate carboxylase in apo state | 0.9068 | 17 | 61 |
| 4qoy-assembly2.cif.gz_F | novel binding motif and new flexibility revealed by structural analysis of a pyruvate dehydrogenase-dihydrolipoyl acetyltransferase sub-complex from the escherichia coli pyruvate dehydrogenase multi-enzyme complex | 0.8998 | 79 | 113 |
| 1w85-assembly1.cif.gz_I | the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 | 0.8991 | 78 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54KE6_633_699_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.914 | 17 | 62 | 2.40.50.100 |
| 4qoyF00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.8998 | 79 | 113 | 4.10.320.10 |
| af_Q8II35_15_156_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8882 | 13 | 59 | 2.40.50.100 |
| 1w88J00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.8869 | 78 | 114 | 4.10.320.10 |
| af_Q58628_489_566_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8841 | 17 | 64 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A225X675-F1-model_v4 | deleted | 0.9704 | 164 | 355 |
|
| AF-A0A3S4H414-F1-model_v4 | Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) | 0.9578 | 158 | 356 |
GO:0004742
GO:0006086 GO:0045254 |
| AF-A0A7C5DAU7-F1-model_v4 | 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein | 0.9569 | 189 | 356 |
GO:0006086
GO:0016746 GO:0045254 |
| AF-A0A2F0AGV1-F1-model_v4 | Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase | 0.9552 | 188 | 356 |
GO:0006086
GO:0016746 GO:0045254 |
| AF-A0A6A0HCY1-F1-model_v4 | 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein | 0.9537 | 216 | 298 |
GO:0004742
GO:0006086 GO:0045254 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar