F474671
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 293 | 665 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0063827|Ga0495580_0063827_536_1366 |
| Length | 276 |
| Sequence | MLGKGPGPETRRPKPGRTGAARACGATLLACSLAAPGAEYVDVPAGTITSALAGDADTTPTPVAAFALREMPVTQGEFLRFVAAHPEWRRDRVPGVFADAGYLRSWRSPVALADDAEERAPVTDVSWFAAQAFCESEGSRLPTWLEWEYVAAADAERRDARNDPAWLARILGWYARPASDPLPEVGGAPNAYGVRDLHGVVWEWVDDFTALLVEGDSRTGNDPDKLKFCGAGAINLQDRDNYAVLMRIALLSSLNAADSTGSLGFRCARPQFTEAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 5 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 6 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 11 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 12 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 219 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 220 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 223 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 224 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 225 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 226 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0.15 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0 |
| Rhizoplane | 5.31 |
| Rhizosphere | 86.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1002862 | 3300002074 | Bacteria | 1966 |
| 2 | rootH2_10233592 | 3300003320 | Bacteria | 1135 |
| 3 | Ga0055538_1000050 | 3300003751 | Bacteria | 130812 |
| 4 | Ga0055539_1000074 | 3300003752 | Bacteria | 130812 |
| 5 | Ga0055539_1000116 | 3300003752 | Bacteria | 88977 |
| 6 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 7 | Ga0055533_1000081 | 3300003756 | Bacteria | 130812 |
| 8 | Ga0055525_1000108 | 3300003759 | Bacteria | 130812 |
| 9 | Ga0055525_1000955 | 3300003759 | Bacteria | 7917 |
| 10 | Ga0055531_10000064 | 3300003794 | Bacteria | 117923 |
| 11 | Ga0055541_1000052 | 3300003841 | Bacteria | 130812 |
| 12 | Ga0065165_1003189 | 3300005262 | Bacteria | 12005 |
| 13 | Ga0065712_10088811 | 3300005290 | Bacteria | 2501 |
| 14 | Ga0065715_10102977 | 3300005293 | Bacteria | 3070 |
| 15 | Ga0070676_10002044 | 3300005328 | Bacteria | 10256 |
| 16 | Ga0070676_10040815 | 3300005328 | Bacteria | 2689 |
| 17 | Ga0070676_10064471 | 3300005328 | Bacteria | 2185 |
| 18 | Ga0070676_10260102 | 3300005328 | Bacteria | 1162 |
| 19 | Ga0070683_100025851 | 3300005329 | Bacteria | 5280 |
| 20 | Ga0070683_100197012 | 3300005329 | Bacteria | 1913 |
| 21 | Ga0070690_100015015 | 3300005330 | Bacteria | 4609 |
| 22 | Ga0070690_100115459 | 3300005330 | Bacteria | 1796 |
| 23 | Ga0070690_100360797 | 3300005330 | Bacteria | 1057 |
| 24 | Ga0070670_100002614 | 3300005331 | Bacteria | 14885 |
| 25 | Ga0070670_100003776 | 3300005331 | Bacteria | 12608 |
| 26 | Ga0070670_100009164 | 3300005331 | Bacteria | 8459 |
| 27 | Ga0070670_100026051 | 3300005331 | Bacteria | 5032 |
| 28 | Ga0070670_100032014 | 3300005331 | Bacteria | 4528 |
| 29 | Ga0070670_100055955 | 3300005331 | Bacteria | 3385 |
| 30 | Ga0070670_100080610 | 3300005331 | Bacteria | 2797 |
| 31 | Ga0070670_100087124 | 3300005331 | Bacteria | 2683 |
| 32 | Ga0070670_100105022 | 3300005331 | Bacteria | 2433 |
| 33 | Ga0070670_100167191 | 3300005331 | Bacteria | 1907 |
| 34 | Ga0070670_100196559 | 3300005331 | Bacteria | 1752 |
| 35 | Ga0070670_100301718 | 3300005331 | Bacteria | 1401 |
| 36 | Ga0070677_10004837 | 3300005333 | Bacteria | 4419 |
| 37 | Ga0070677_10036912 | 3300005333 | Bacteria | 1904 |
| 38 | Ga0070677_10037664 | 3300005333 | Bacteria | 1888 |
| 39 | Ga0068869_100001806 | 3300005334 | Bacteria | 12848 |
| 40 | Ga0068869_100002842 | 3300005334 | Bacteria | 10491 |
| 41 | Ga0068869_100007068 | 3300005334 | Bacteria | 7147 |
| 42 | Ga0068869_100011109 | 3300005334 | Bacteria | 5899 |
| 43 | Ga0068869_100174295 | 3300005334 | Bacteria | 1682 |
| 44 | Ga0070666_10024486 | 3300005335 | Bacteria | 3932 |
| 45 | Ga0070666_10085797 | 3300005335 | Bacteria | 2157 |
| 46 | Ga0068868_100069917 | 3300005338 | Bacteria | 2798 |
| 47 | Ga0068868_100340508 | 3300005338 | Bacteria | 1282 |
| 48 | Ga0068868_100424659 | 3300005338 | Bacteria | 1151 |
| 49 | Ga0068868_100459369 | 3300005338 | Bacteria | 1109 |
| 50 | Ga0068868_100482202 | 3300005338 | Bacteria | 1083 |
| 51 | Ga0070660_100137406 | 3300005339 | Bacteria | 1959 |
| 52 | Ga0070660_100540062 | 3300005339 | Bacteria | 972 |
| 53 | Ga0070689_100008018 | 3300005340 | Bacteria | 7413 |
| 54 | Ga0070689_100470701 | 3300005340 | Bacteria | 1072 |
| 55 | Ga0070687_100001711 | 3300005343 | Bacteria | 7877 |
| 56 | Ga0070687_100040405 | 3300005343 | Bacteria | 2350 |
| 57 | Ga0070687_100157953 | 3300005343 | Bacteria | 1338 |
| 58 | Ga0070661_100010169 | 3300005344 | Bacteria | 6535 |
| 59 | Ga0070661_100016872 | 3300005344 | Bacteria | 5169 |
| 60 | Ga0070668_100008000 | 3300005347 | Bacteria | 7854 |
| 61 | Ga0070668_100008286 | 3300005347 | Bacteria | 7714 |
| 62 | Ga0070668_100093306 | 3300005347 | Bacteria | 2375 |
| 63 | Ga0070668_100121787 | 3300005347 | Bacteria | 2086 |
| 64 | Ga0070669_100010212 | 3300005353 | Bacteria | 6671 |
| 65 | Ga0070669_100010333 | 3300005353 | Bacteria | 6629 |
| 66 | Ga0070669_100027042 | 3300005353 | Bacteria | 4128 |
| 67 | Ga0070669_100043416 | 3300005353 | Bacteria | 3274 |
| 68 | Ga0070669_100072979 | 3300005353 | Bacteria | 2542 |
| 69 | Ga0070675_100098599 | 3300005354 | Bacteria | 2458 |
| 70 | Ga0070675_100174687 | 3300005354 | Bacteria | 1854 |
| 71 | Ga0070675_100213041 | 3300005354 | Bacteria | 1680 |
| 72 | Ga0070675_100435209 | 3300005354 | Bacteria | 1174 |
| 73 | Ga0070675_100500252 | 3300005354 | Bacteria | 1095 |
| 74 | Ga0070671_100002319 | 3300005355 | Bacteria | 14699 |
| 75 | Ga0070671_100102271 | 3300005355 | Bacteria | 2404 |
| 76 | Ga0070671_100137059 | 3300005355 | Bacteria | 2063 |
| 77 | Ga0070671_100150215 | 3300005355 | Bacteria | 1967 |
| 78 | Ga0070671_100231835 | 3300005355 | Bacteria | 1567 |
| 79 | Ga0070671_100439103 | 3300005355 | Bacteria | 1119 |
| 80 | Ga0070674_100017689 | 3300005356 | Bacteria | 4491 |
| 81 | Ga0070674_100095866 | 3300005356 | Bacteria | 2151 |
| 82 | Ga0070673_100055743 | 3300005364 | Bacteria | 3115 |
| 83 | Ga0070673_100058680 | 3300005364 | Bacteria | 3043 |
| 84 | Ga0070688_100039876 | 3300005365 | Bacteria | 2876 |
| 85 | Ga0070688_100171686 | 3300005365 | Bacteria | 1497 |
| 86 | Ga0070659_100292580 | 3300005366 | Bacteria | 1356 |
| 87 | Ga0070659_100364430 | 3300005366 | Bacteria | 1215 |
| 88 | Ga0070667_100003163 | 3300005367 | Bacteria | 14110 |
| 89 | Ga0070667_100021558 | 3300005367 | Bacteria | 5348 |
| 90 | Ga0070667_100043777 | 3300005367 | Bacteria | 3758 |
| 91 | Ga0070667_100194438 | 3300005367 | Bacteria | 1798 |
| 92 | Ga0070701_10007331 | 3300005438 | Bacteria | 4702 |
| 93 | Ga0070711_100330138 | 3300005439 | Unclassified | 1221 |
| 94 | Ga0070705_100083324 | 3300005440 | Bacteria | 1970 |
| 95 | Ga0070700_100012120 | 3300005441 | Bacteria | 4798 |
| 96 | Ga0070663_100036767 | 3300005455 | Bacteria | 3403 |
| 97 | Ga0070663_100427190 | 3300005455 | Bacteria | 1088 |
| 98 | Ga0070678_100028643 | 3300005456 | Bacteria | 3802 |
| 99 | Ga0070678_100039202 | 3300005456 | Bacteria | 3340 |
| 100 | Ga0070678_100050318 | 3300005456 | Bacteria | 3014 |
| 101 | Ga0070678_100134707 | 3300005456 | Bacteria | 1968 |
| 102 | Ga0070678_100177930 | 3300005456 | Bacteria | 1739 |
| 103 | Ga0070678_100191615 | 3300005456 | Bacteria | 1681 |
| 104 | Ga0070678_100216465 | 3300005456 | Bacteria | 1590 |
| 105 | Ga0070662_100011591 | 3300005457 | Bacteria | 5818 |
| 106 | Ga0070662_100012047 | 3300005457 | Bacteria | 5724 |
| 107 | Ga0070662_100037080 | 3300005457 | Bacteria | 3454 |
| 108 | Ga0068867_100014646 | 3300005459 | Bacteria | 5557 |
| 109 | Ga0068867_100049802 | 3300005459 | Bacteria | 3084 |
| 110 | Ga0068867_100060893 | 3300005459 | Bacteria | 2801 |
| 111 | Ga0068867_100069578 | 3300005459 | Bacteria | 2629 |
| 112 | Ga0068867_100071423 | 3300005459 | Bacteria | 2596 |
| 113 | Ga0068867_100117804 | 3300005459 | Bacteria | 2048 |
| 114 | Ga0068867_100590981 | 3300005459 | Bacteria | 967 |
| 115 | Ga0070685_10004729 | 3300005466 | Bacteria | 6894 |
| 116 | Ga0070679_100066994 | 3300005530 | Bacteria | 3580 |
| 117 | Ga0070684_100034625 | 3300005535 | Bacteria | 4318 |
| 118 | Ga0068853_100151009 | 3300005539 | Bacteria | 2091 |
| 119 | Ga0068853_100209944 | 3300005539 | Bacteria | 1774 |
| 120 | Ga0068853_100228867 | 3300005539 | Bacteria | 1700 |
| 121 | Ga0068853_100486531 | 3300005539 | Bacteria | 1164 |
| 122 | Ga0070672_100011455 | 3300005543 | Bacteria | 6185 |
| 123 | Ga0070672_100013269 | 3300005543 | Bacteria | 5815 |
| 124 | Ga0070672_100015758 | 3300005543 | Bacteria | 5397 |
| 125 | Ga0070672_100119088 | 3300005543 | Bacteria | 2159 |
| 126 | Ga0070672_100160355 | 3300005543 | Bacteria | 1865 |
| 127 | Ga0070672_100296881 | 3300005543 | Bacteria | 1369 |
| 128 | Ga0070672_100315321 | 3300005543 | Bacteria | 1328 |
| 129 | Ga0070686_100244428 | 3300005544 | Bacteria | 1308 |
| 130 | Ga0070695_100153380 | 3300005545 | Bacteria | 1610 |
| 131 | Ga0070665_100010042 | 3300005548 | Bacteria | 9577 |
| 132 | Ga0070665_100016157 | 3300005548 | Bacteria | 7491 |
| 133 | Ga0070665_100262431 | 3300005548 | Bacteria | 1728 |
| 134 | Ga0068855_100017679 | 3300005563 | Bacteria | 8575 |
| 135 | Ga0068855_100244969 | 3300005563 | Bacteria | 2001 |
| 136 | Ga0070664_100229845 | 3300005564 | Bacteria | 1662 |
| 137 | Ga0070664_100234468 | 3300005564 | Bacteria | 1646 |
| 138 | Ga0070664_100272968 | 3300005564 | Bacteria | 1523 |
| 139 | Ga0068857_100026365 | 3300005577 | Bacteria | 5122 |
| 140 | Ga0068857_100041636 | 3300005577 | Bacteria | 4073 |
| 141 | Ga0068854_100160310 | 3300005578 | Bacteria | 1741 |
| 142 | Ga0068856_100092087 | 3300005614 | Bacteria | 3016 |
| 143 | Ga0068856_100115337 | 3300005614 | Bacteria | 2686 |
| 144 | Ga0068856_100264635 | 3300005614 | Bacteria | 1735 |
| 145 | Ga0070702_100004798 | 3300005615 | Bacteria | 6214 |
| 146 | Ga0070702_100051557 | 3300005615 | Bacteria | 2356 |
| 147 | Ga0068852_100192627 | 3300005616 | Bacteria | 1924 |
| 148 | Ga0068852_100194861 | 3300005616 | Bacteria | 1914 |
| 149 | Ga0068859_100000776 | 3300005617 | Bacteria | 32237 |
| 150 | Ga0068859_100001589 | 3300005617 | Bacteria | 23178 |
| 151 | Ga0068859_100025358 | 3300005617 | Bacteria | 5949 |
| 152 | Ga0068859_100034355 | 3300005617 | Bacteria | 5089 |
| 153 | Ga0068859_100088520 | 3300005617 | Bacteria | 3146 |
| 154 | Ga0068859_101026206 | 3300005617 | Bacteria | 906 |
| 155 | Ga0068864_100002477 | 3300005618 | Bacteria | 15242 |
| 156 | Ga0068864_100017913 | 3300005618 | Bacteria | 5909 |
| 157 | Ga0068864_100046308 | 3300005618 | Bacteria | 3731 |
| 158 | Ga0068864_100053340 | 3300005618 | Bacteria | 3488 |
| 159 | Ga0068864_100273325 | 3300005618 | Bacteria | 1575 |
| 160 | Ga0068866_10001890 | 3300005718 | Bacteria | 8769 |
| 161 | Ga0068866_10003270 | 3300005718 | Bacteria | 6664 |
| 162 | Ga0068861_100004069 | 3300005719 | Bacteria | 9796 |
| 163 | Ga0068861_100011595 | 3300005719 | Bacteria | 6133 |
| 164 | Ga0068861_100044446 | 3300005719 | Bacteria | 3340 |
| 165 | Ga0068861_100088337 | 3300005719 | Bacteria | 2441 |
| 166 | Ga0068861_100575234 | 3300005719 | Bacteria | 1030 |
| 167 | Ga0068851_10006652 | 3300005834 | Bacteria | 5287 |
| 168 | Ga0068851_10060285 | 3300005834 | Bacteria | 1942 |
| 169 | Ga0068870_10007244 | 3300005840 | Bacteria | 4940 |
| 170 | Ga0068870_10012938 | 3300005840 | Bacteria | 3909 |
| 171 | Ga0068870_10054432 | 3300005840 | Bacteria | 2128 |
| 172 | Ga0068870_10055645 | 3300005840 | Bacteria | 2108 |
| 173 | Ga0068870_10201494 | 3300005840 | Bacteria | 1207 |
| 174 | Ga0068863_100006737 | 3300005841 | Bacteria | 11264 |
| 175 | Ga0068863_100020088 | 3300005841 | Bacteria | 6389 |
| 176 | Ga0068863_100027507 | 3300005841 | Bacteria | 5425 |
| 177 | Ga0068863_100032649 | 3300005841 | Bacteria | 4961 |
| 178 | Ga0068863_100150402 | 3300005841 | Bacteria | 2227 |
| 179 | Ga0068863_100160934 | 3300005841 | Bacteria | 2151 |
| 180 | Ga0068863_100176168 | 3300005841 | Bacteria | 2053 |
| 181 | Ga0068863_100317521 | 3300005841 | Bacteria | 1513 |
| 182 | Ga0068858_100023672 | 3300005842 | Bacteria | 5721 |
| 183 | Ga0068858_100028111 | 3300005842 | Bacteria | 5225 |
| 184 | Ga0068858_100040886 | 3300005842 | Bacteria | 4300 |
| 185 | Ga0068858_100047410 | 3300005842 | Bacteria | 3983 |
| 186 | Ga0068858_100067440 | 3300005842 | Bacteria | 3314 |
| 187 | Ga0068860_100003196 | 3300005843 | Bacteria | 16912 |
| 188 | Ga0068860_100007275 | 3300005843 | Bacteria | 11073 |
| 189 | Ga0068860_100018088 | 3300005843 | Bacteria | 6863 |
| 190 | Ga0068860_100020846 | 3300005843 | Bacteria | 6350 |
| 191 | Ga0068860_100186932 | 3300005843 | Bacteria | 2004 |
| 192 | Ga0068862_100042009 | 3300005844 | Bacteria | 3893 |
| 193 | Ga0068862_100062463 | 3300005844 | Bacteria | 3203 |
| 194 | Ga0068862_100099071 | 3300005844 | Bacteria | 2547 |
| 195 | Ga0068862_100118337 | 3300005844 | Bacteria | 2332 |
| 196 | Ga0068862_100303568 | 3300005844 | Bacteria | 1469 |
| 197 | Ga0075366_10053644 | 3300006195 | Bacteria | 2395 |
| 198 | Ga0097621_100045292 | 3300006237 | Bacteria | 3552 |
| 199 | Ga0097621_100121296 | 3300006237 | Bacteria | 2217 |
| 200 | Ga0097621_100164075 | 3300006237 | Bacteria | 1911 |
| 201 | Ga0075370_10008300 | 3300006353 | Bacteria | 5338 |
| 202 | Ga0075370_10106626 | 3300006353 | Bacteria | 1625 |
| 203 | Ga0068871_100031888 | 3300006358 | Bacteria | 4158 |
| 204 | Ga0068871_100067442 | 3300006358 | Bacteria | 2935 |
| 205 | Ga0068871_100586657 | 3300006358 | Bacteria | 1012 |
| 206 | Ga0068865_100018347 | 3300006881 | Bacteria | 4512 |
| 207 | Ga0068865_100026863 | 3300006881 | Bacteria | 3799 |
| 208 | Ga0068865_100044512 | 3300006881 | Bacteria | 3038 |
| 209 | Ga0097620_100000776 | 3300006931 | Bacteria | 32237 |
| 210 | Ga0097620_100001589 | 3300006931 | Bacteria | 23178 |
| 211 | Ga0097620_100025359 | 3300006931 | Bacteria | 5949 |
| 212 | Ga0097620_100034354 | 3300006931 | Bacteria | 5089 |
| 213 | Ga0097620_100088526 | 3300006931 | Bacteria | 3146 |
| 214 | Ga0097620_101026026 | 3300006931 | Bacteria | 906 |
| 215 | Ga0105251_10121771 | 3300009011 | Bacteria | 1185 |
| 216 | Ga0105240_10302039 | 3300009093 | Bacteria | 1831 |
| 217 | Ga0111539_10027664 | 3300009094 | Bacteria | 6927 |
| 218 | Ga0105245_10173897 | 3300009098 | Bacteria | 2052 |
| 219 | Ga0105245_10940961 | 3300009098 | Bacteria | 907 |
| 220 | Ga0105247_10031046 | 3300009101 | Bacteria | 3241 |
| 221 | Ga0105243_10020958 | 3300009148 | Bacteria | 4960 |
| 222 | Ga0105243_10067659 | 3300009148 | Bacteria | 2876 |
| 223 | Ga0105243_10071783 | 3300009148 | Bacteria | 2800 |
| 224 | Ga0105241_10035126 | 3300009174 | Bacteria | 3770 |
| 225 | Ga0105241_10288461 | 3300009174 | Bacteria | 1404 |
| 226 | Ga0105242_10001775 | 3300009176 | Bacteria | 17019 |
| 227 | Ga0105242_10042998 | 3300009176 | Bacteria | 3652 |
| 228 | Ga0105248_10003392 | 3300009177 | Bacteria | 17704 |
| 229 | Ga0105248_10009399 | 3300009177 | Bacteria | 10763 |
| 230 | Ga0105248_10056704 | 3300009177 | Bacteria | 4395 |
| 231 | Ga0105248_10148113 | 3300009177 | Bacteria | 2648 |
| 232 | Ga0105248_10194895 | 3300009177 | Bacteria | 2283 |
| 233 | Ga0105248_10216625 | 3300009177 | Bacteria | 2156 |
| 234 | Ga0105237_10092651 | 3300009545 | Bacteria | 3011 |
| 235 | Ga0105238_10005339 | 3300009551 | Bacteria | 12697 |
| 236 | Ga0105238_10111709 | 3300009551 | Bacteria | 2713 |
| 237 | Ga0105249_10028167 | 3300009553 | Bacteria | 5072 |
| 238 | Ga0105032_100445 | 3300009979 | Bacteria | 4133 |
| 239 | Ga0105239_10003023 | 3300010375 | Bacteria | 20958 |
| 240 | Ga0105246_10014664 | 3300011119 | Bacteria | 4932 |
| 241 | Ga0157327_1000667 | 3300012512 | Bacteria | 1916 |
| 242 | Ga0157370_10029183 | 3300013104 | Bacteria | 5418 |
| 243 | Ga0157374_10169624 | 3300013296 | Bacteria | 2128 |
| 244 | Ga0157374_10386931 | 3300013296 | Bacteria | 1394 |
| 245 | Ga0157378_10025796 | 3300013297 | Bacteria | 5177 |
| 246 | Ga0157378_10179787 | 3300013297 | Bacteria | 1989 |
| 247 | Ga0163162_10007086 | 3300013306 | Bacteria | 10880 |
| 248 | Ga0163162_10061859 | 3300013306 | Bacteria | 3782 |
| 249 | Ga0163162_10343624 | 3300013306 | Bacteria | 1625 |
| 250 | Ga0163162_10374544 | 3300013306 | Bacteria | 1557 |
| 251 | Ga0157372_10000819 | 3300013307 | Bacteria | 33686 |
| 252 | Ga0157375_10000342 | 3300013308 | Bacteria | 42091 |
| 253 | Ga0157375_10025214 | 3300013308 | Bacteria | 5520 |
| 254 | Ga0157375_10030411 | 3300013308 | Bacteria | 5092 |
| 255 | Ga0157375_10095250 | 3300013308 | Bacteria | 3047 |
| 256 | Ga0157375_10158522 | 3300013308 | Bacteria | 2404 |
| 257 | Ga0157375_10342108 | 3300013308 | Bacteria | 1661 |
| 258 | Ga0157375_10647883 | 3300013308 | Bacteria | 1213 |
| 259 | Ga0163163_10000039 | 3300014325 | Bacteria | 148715 |
| 260 | Ga0163163_10009155 | 3300014325 | Bacteria | 8826 |
| 261 | Ga0163163_10028200 | 3300014325 | Bacteria | 5388 |
| 262 | Ga0163163_10276062 | 3300014325 | Bacteria | 1732 |
| 263 | Ga0157380_10023836 | 3300014326 | Bacteria | 4622 |
| 264 | Ga0157380_10029238 | 3300014326 | Bacteria | 4211 |
| 265 | Ga0157380_10062017 | 3300014326 | Bacteria | 2993 |
| 266 | Ga0157380_10137847 | 3300014326 | Bacteria | 2091 |
| 267 | Ga0157377_10007567 | 3300014745 | Bacteria | 5253 |
| 268 | Ga0157379_10004427 | 3300014968 | Bacteria | 12043 |
| 269 | Ga0157379_10019612 | 3300014968 | Bacteria | 5973 |
| 270 | Ga0157379_10061419 | 3300014968 | Bacteria | 3360 |
| 271 | Ga0157379_10063497 | 3300014968 | Bacteria | 3301 |
| 272 | Ga0157379_10076628 | 3300014968 | Bacteria | 2995 |
| 273 | Ga0157379_10148011 | 3300014968 | Bacteria | 2118 |
| 274 | Ga0157376_10002239 | 3300014969 | Bacteria | 13037 |
| 275 | Ga0206354_11034403 | 3300020081 | Bacteria | 1011 |
| 276 | Ga0213872_10084758 | 3300021361 | Unclassified | 1421 |
| 277 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 278 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 279 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 280 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 281 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 282 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 283 | Ga0207427_100453 | 3300025231 | Bacteria | 22659 |
| 284 | Ga0209258_100277 | 3300025242 | Bacteria | 86422 |
| 285 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 286 | Ga0209677_100077 | 3300025253 | Bacteria | 126245 |
| 287 | Ga0207666_1000950 | 3300025271 | Bacteria | 3437 |
| 288 | Ga0209050_1010421 | 3300025298 | Bacteria | 4584 |
| 289 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 290 | Ga0207697_10001006 | 3300025315 | Bacteria | 15771 |
| 291 | Ga0207697_10012117 | 3300025315 | Bacteria | 3627 |
| 292 | Ga0207682_10001109 | 3300025893 | Bacteria | 12472 |
| 293 | Ga0207682_10002237 | 3300025893 | Bacteria | 8736 |
| 294 | Ga0207682_10011838 | 3300025893 | Bacteria | 3408 |
| 295 | Ga0207642_10035094 | 3300025899 | Bacteria | 2138 |
| 296 | Ga0207688_10003400 | 3300025901 | Bacteria | 8679 |
| 297 | Ga0207680_10030394 | 3300025903 | Bacteria | 3046 |
| 298 | Ga0207680_10051797 | 3300025903 | Bacteria | 2457 |
| 299 | Ga0207680_10132317 | 3300025903 | Bacteria | 1645 |
| 300 | Ga0207645_10002988 | 3300025907 | Bacteria | 13071 |
| 301 | Ga0207645_10025478 | 3300025907 | Bacteria | 3826 |
| 302 | Ga0207645_10041768 | 3300025907 | Bacteria | 2935 |
| 303 | Ga0207645_10314687 | 3300025907 | Bacteria | 1044 |
| 304 | Ga0207643_10005604 | 3300025908 | Bacteria | 6711 |
| 305 | Ga0207643_10008853 | 3300025908 | Bacteria | 5403 |
| 306 | Ga0207643_10008956 | 3300025908 | Bacteria | 5376 |
| 307 | Ga0207643_10009803 | 3300025908 | Bacteria | 5145 |
| 308 | Ga0207705_10059867 | 3300025909 | Bacteria | 2749 |
| 309 | Ga0207695_10000393 | 3300025913 | Bacteria | 98467 |
| 310 | Ga0207695_10204085 | 3300025913 | Bacteria | 1890 |
| 311 | Ga0207671_10009835 | 3300025914 | Bacteria | 7955 |
| 312 | Ga0207671_10178306 | 3300025914 | Bacteria | 1652 |
| 313 | Ga0207662_10003299 | 3300025918 | Bacteria | 8282 |
| 314 | Ga0207662_10003987 | 3300025918 | Bacteria | 7696 |
| 315 | Ga0207662_10070967 | 3300025918 | Bacteria | 2108 |
| 316 | Ga0207662_10278809 | 3300025918 | Bacteria | 1105 |
| 317 | Ga0207657_10005814 | 3300025919 | Bacteria | 12849 |
| 318 | Ga0207657_10069966 | 3300025919 | Bacteria | 2975 |
| 319 | Ga0207649_10051673 | 3300025920 | Bacteria | 2546 |
| 320 | Ga0207649_10175369 | 3300025920 | Bacteria | 1497 |
| 321 | Ga0207649_10432940 | 3300025920 | Bacteria | 990 |
| 322 | Ga0207652_10643471 | 3300025921 | Bacteria | 948 |
| 323 | Ga0207681_10009555 | 3300025923 | Bacteria | 5926 |
| 324 | Ga0207681_10033032 | 3300025923 | Bacteria | 3391 |
| 325 | Ga0207681_10033643 | 3300025923 | Bacteria | 3362 |
| 326 | Ga0207681_10059392 | 3300025923 | Bacteria | 2621 |
| 327 | Ga0207681_10063258 | 3300025923 | Bacteria | 2551 |
| 328 | Ga0207681_10668208 | 3300025923 | Bacteria | 862 |
| 329 | Ga0207694_10059542 | 3300025924 | Bacteria | 2970 |
| 330 | Ga0207650_10006933 | 3300025925 | Bacteria | 7724 |
| 331 | Ga0207650_10007995 | 3300025925 | Bacteria | 7208 |
| 332 | Ga0207650_10023808 | 3300025925 | Bacteria | 4347 |
| 333 | Ga0207650_10047183 | 3300025925 | Bacteria | 3174 |
| 334 | Ga0207650_10049457 | 3300025925 | Bacteria | 3104 |
| 335 | Ga0207650_10207933 | 3300025925 | Unclassified | 1571 |
| 336 | Ga0207650_10281596 | 3300025925 | Bacteria | 1354 |
| 337 | Ga0207659_10028796 | 3300025926 | Bacteria | 3778 |
| 338 | Ga0207659_10032629 | 3300025926 | Bacteria | 3576 |
| 339 | Ga0207659_10112883 | 3300025926 | Bacteria | 2069 |
| 340 | Ga0207659_10485655 | 3300025926 | Bacteria | 1044 |
| 341 | Ga0207659_10510307 | 3300025926 | Bacteria | 1019 |
| 342 | Ga0207687_10049364 | 3300025927 | Bacteria | 2926 |
| 343 | Ga0207644_10000556 | 3300025931 | Bacteria | 24008 |
| 344 | Ga0207644_10014629 | 3300025931 | Bacteria | 5254 |
| 345 | Ga0207644_10158889 | 3300025931 | Bacteria | 1755 |
| 346 | Ga0207644_10181110 | 3300025931 | Bacteria | 1651 |
| 347 | Ga0207644_10343835 | 3300025931 | Bacteria | 1210 |
| 348 | Ga0207706_10005220 | 3300025933 | Bacteria | 12124 |
| 349 | Ga0207706_10009694 | 3300025933 | Bacteria | 8838 |
| 350 | Ga0207706_10161558 | 3300025933 | Bacteria | 1969 |
| 351 | Ga0207706_10268247 | 3300025933 | Bacteria | 1490 |
| 352 | Ga0207686_10005254 | 3300025934 | Bacteria | 6950 |
| 353 | Ga0207709_10015946 | 3300025935 | Bacteria | 4170 |
| 354 | Ga0207709_10127947 | 3300025935 | Bacteria | 1726 |
| 355 | Ga0207670_10060810 | 3300025936 | Bacteria | 2575 |
| 356 | Ga0207669_10021717 | 3300025937 | Bacteria | 3394 |
| 357 | Ga0207669_10115744 | 3300025937 | Bacteria | 1808 |
| 358 | Ga0207704_10005663 | 3300025938 | Bacteria | 5773 |
| 359 | Ga0207704_10268047 | 3300025938 | Bacteria | 1291 |
| 360 | Ga0207691_10001853 | 3300025940 | Bacteria | 20653 |
| 361 | Ga0207691_10010978 | 3300025940 | Bacteria | 8691 |
| 362 | Ga0207691_10011066 | 3300025940 | Bacteria | 8660 |
| 363 | Ga0207691_10018633 | 3300025940 | Bacteria | 6577 |
| 364 | Ga0207691_10019096 | 3300025940 | Bacteria | 6491 |
| 365 | Ga0207691_10098906 | 3300025940 | Bacteria | 2605 |
| 366 | Ga0207691_10229577 | 3300025940 | Bacteria | 1607 |
| 367 | Ga0207691_10303503 | 3300025940 | Bacteria | 1371 |
| 368 | Ga0207711_10011042 | 3300025941 | Bacteria | 7506 |
| 369 | Ga0207711_10023415 | 3300025941 | Bacteria | 5170 |
| 370 | Ga0207711_10023745 | 3300025941 | Bacteria | 5133 |
| 371 | Ga0207711_10140439 | 3300025941 | Bacteria | 2173 |
| 372 | Ga0207711_10172699 | 3300025941 | Bacteria | 1962 |
| 373 | Ga0207711_10212968 | 3300025941 | Bacteria | 1765 |
| 374 | Ga0207689_10004356 | 3300025942 | Bacteria | 12892 |
| 375 | Ga0207689_10004366 | 3300025942 | Bacteria | 12868 |
| 376 | Ga0207689_10004439 | 3300025942 | Bacteria | 12723 |
| 377 | Ga0207661_10149050 | 3300025944 | Bacteria | 2021 |
| 378 | Ga0207679_10120486 | 3300025945 | Bacteria | 2087 |
| 379 | Ga0207679_10366814 | 3300025945 | Bacteria | 1259 |
| 380 | Ga0207679_10409687 | 3300025945 | Bacteria | 1194 |
| 381 | Ga0207667_10021057 | 3300025949 | Bacteria | 7232 |
| 382 | Ga0207651_10014472 | 3300025960 | Bacteria | 4558 |
| 383 | Ga0207651_10016899 | 3300025960 | Bacteria | 4292 |
| 384 | Ga0207651_10091127 | 3300025960 | Bacteria | 2231 |
| 385 | Ga0207651_10168943 | 3300025960 | Bacteria | 1723 |
| 386 | Ga0207712_10055113 | 3300025961 | Bacteria | 2795 |
| 387 | Ga0207712_10106353 | 3300025961 | Bacteria | 2096 |
| 388 | Ga0207668_10005000 | 3300025972 | Bacteria | 7805 |
| 389 | Ga0207668_10024666 | 3300025972 | Bacteria | 3884 |
| 390 | Ga0207668_10064389 | 3300025972 | Bacteria | 2590 |
| 391 | Ga0207668_10074867 | 3300025972 | Bacteria | 2432 |
| 392 | Ga0207668_10105495 | 3300025972 | Bacteria | 2103 |
| 393 | Ga0207658_10006534 | 3300025986 | Bacteria | 7953 |
| 394 | Ga0207658_10007612 | 3300025986 | Bacteria | 7378 |
| 395 | Ga0207658_10252610 | 3300025986 | Bacteria | 1499 |
| 396 | Ga0207658_10360477 | 3300025986 | Bacteria | 1268 |
| 397 | Ga0207677_10039518 | 3300026023 | Bacteria | 3103 |
| 398 | Ga0207677_10070361 | 3300026023 | Bacteria | 2466 |
| 399 | Ga0207677_10100221 | 3300026023 | Bacteria | 2129 |
| 400 | Ga0207677_10160347 | 3300026023 | Bacteria | 1747 |
| 401 | Ga0207703_10004627 | 3300026035 | Bacteria | 11247 |
| 402 | Ga0207703_10026909 | 3300026035 | Bacteria | 4529 |
| 403 | Ga0207703_10032798 | 3300026035 | Bacteria | 4113 |
| 404 | Ga0207639_10000707 | 3300026041 | Bacteria | 22869 |
| 405 | Ga0207639_10106777 | 3300026041 | Bacteria | 2273 |
| 406 | Ga0207639_10162037 | 3300026041 | Bacteria | 1886 |
| 407 | Ga0207678_10032358 | 3300026067 | Bacteria | 4557 |
| 408 | Ga0207678_10215167 | 3300026067 | Bacteria | 1644 |
| 409 | Ga0207708_10003088 | 3300026075 | Bacteria | 12263 |
| 410 | Ga0207702_10013708 | 3300026078 | Bacteria | 6734 |
| 411 | Ga0207702_10041695 | 3300026078 | Bacteria | 3849 |
| 412 | Ga0207702_10354488 | 3300026078 | Bacteria | 1405 |
| 413 | Ga0207702_10481876 | 3300026078 | Bacteria | 1207 |
| 414 | Ga0207641_10004384 | 3300026088 | Bacteria | 12234 |
| 415 | Ga0207641_10055413 | 3300026088 | Bacteria | 3366 |
| 416 | Ga0207641_10057327 | 3300026088 | Bacteria | 3312 |
| 417 | Ga0207641_10065162 | 3300026088 | Bacteria | 3116 |
| 418 | Ga0207641_10074607 | 3300026088 | Bacteria | 2926 |
| 419 | Ga0207641_10645370 | 3300026088 | Unclassified | 1039 |
| 420 | Ga0207648_10010341 | 3300026089 | Bacteria | 8849 |
| 421 | Ga0207648_10015262 | 3300026089 | Bacteria | 7066 |
| 422 | Ga0207648_10033764 | 3300026089 | Bacteria | 4512 |
| 423 | Ga0207648_10040746 | 3300026089 | Bacteria | 4080 |
| 424 | Ga0207648_10088816 | 3300026089 | Bacteria | 2699 |
| 425 | Ga0207648_10155203 | 3300026089 | Bacteria | 2021 |
| 426 | Ga0207648_10229490 | 3300026089 | Bacteria | 1651 |
| 427 | Ga0207648_10364661 | 3300026089 | Unclassified | 1304 |
| 428 | Ga0207676_10023223 | 3300026095 | Bacteria | 4571 |
| 429 | Ga0207676_10026809 | 3300026095 | Bacteria | 4286 |
| 430 | Ga0207676_10028213 | 3300026095 | Bacteria | 4191 |
| 431 | Ga0207676_10084789 | 3300026095 | Bacteria | 2584 |
| 432 | Ga0207676_10122949 | 3300026095 | Bacteria | 2192 |
| 433 | Ga0207676_10189588 | 3300026095 | Bacteria | 1808 |
| 434 | Ga0207674_10005202 | 3300026116 | Bacteria | 15489 |
| 435 | Ga0207674_10034188 | 3300026116 | Bacteria | 5318 |
| 436 | Ga0207675_100001089 | 3300026118 | Bacteria | 26890 |
| 437 | Ga0207675_100006423 | 3300026118 | Bacteria | 11131 |
| 438 | Ga0207675_100007214 | 3300026118 | Bacteria | 10498 |
| 439 | Ga0207675_100108512 | 3300026118 | Bacteria | 2618 |
| 440 | Ga0207675_100277447 | 3300026118 | Bacteria | 1628 |
| 441 | Ga0207675_100388152 | 3300026118 | Bacteria | 1374 |
| 442 | Ga0207675_100619853 | 3300026118 | Bacteria | 1086 |
| 443 | Ga0207683_10010465 | 3300026121 | Bacteria | 7916 |
| 444 | Ga0207683_10010565 | 3300026121 | Bacteria | 7877 |
| 445 | Ga0207683_10018093 | 3300026121 | Bacteria | 6009 |
| 446 | Ga0207683_10077599 | 3300026121 | Bacteria | 2942 |
| 447 | Ga0207683_10102674 | 3300026121 | Bacteria | 2554 |
| 448 | Ga0207683_10161436 | 3300026121 | Bacteria | 2026 |
| 449 | Ga0207683_10166708 | 3300026121 | Bacteria | 1993 |
| 450 | Ga0207683_10199833 | 3300026121 | Bacteria | 1817 |
| 451 | Ga0207683_10229015 | 3300026121 | Bacteria | 1694 |
| 452 | Ga0207698_10045861 | 3300026142 | Bacteria | 3296 |
| 453 | Ga0207698_10069787 | 3300026142 | Bacteria | 2781 |
| 454 | Ga0207698_10074292 | 3300026142 | Bacteria | 2711 |
| 455 | Ga0207698_10191331 | 3300026142 | Bacteria | 1823 |
| 456 | Ga0207698_10207138 | 3300026142 | Bacteria | 1761 |
| 457 | Ga0207698_10234238 | 3300026142 | Bacteria | 1669 |
| 458 | Ga0207698_10625817 | 3300026142 | Bacteria | 1064 |
| 459 | Ga0209969_1003420 | 3300027360 | Bacteria | 2196 |
| 460 | Ga0209995_1001196 | 3300027471 | Bacteria | 3991 |
| 461 | Ga0209999_1001155 | 3300027543 | Bacteria | 4508 |
| 462 | Ga0209982_1007820 | 3300027552 | Bacteria | 1561 |
| 463 | Ga0209970_1006128 | 3300027614 | Bacteria | 1974 |
| 464 | Ga0209971_1000369 | 3300027682 | Bacteria | 12297 |
| 465 | Ga0209974_10031131 | 3300027876 | Bacteria | 1766 |
| 466 | Ga0268266_10063379 | 3300028379 | Bacteria | 3191 |
| 467 | Ga0268266_10070034 | 3300028379 | Bacteria | 3040 |
| 468 | Ga0268266_10218463 | 3300028379 | Bacteria | 1751 |
| 469 | Ga0268266_10264261 | 3300028379 | Bacteria | 1595 |
| 470 | Ga0268265_10008941 | 3300028380 | Bacteria | 6774 |
| 471 | Ga0268265_10025546 | 3300028380 | Bacteria | 4195 |
| 472 | Ga0268265_10028035 | 3300028380 | Bacteria | 4028 |
| 473 | Ga0268265_10029219 | 3300028380 | Bacteria | 3955 |
| 474 | Ga0268265_10154826 | 3300028380 | Bacteria | 1938 |
| 475 | Ga0268264_10002324 | 3300028381 | Bacteria | 16821 |
| 476 | Ga0268264_10005552 | 3300028381 | Bacteria | 10689 |
| 477 | Ga0268264_10015656 | 3300028381 | Bacteria | 6210 |
| 478 | Ga0268264_10063478 | 3300028381 | Bacteria | 3105 |
| 479 | Ga0268264_10135919 | 3300028381 | Bacteria | 2186 |
| 480 | Ga0268264_10741048 | 3300028381 | Bacteria | 978 |
| 481 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 482 | Ga0307515_10000425 | 3300028794 | Bacteria | 101790 |
| 483 | Ga0307515_10012894 | 3300028794 | Bacteria | 15678 |
| 484 | Ga0307515_10039838 | 3300028794 | Bacteria | 7455 |
| 485 | Ga0307515_10083827 | 3300028794 | Bacteria | 4104 |
| 486 | Ga0265332_10000027 | 3300031238 | Bacteria | 190796 |
| 487 | Ga0307513_10138369 | 3300031456 | Bacteria | 2366 |
| 488 | Ga0307408_100004210 | 3300031548 | Bacteria | 9798 |
| 489 | Ga0307408_100233454 | 3300031548 | Bacteria | 1508 |
| 490 | Ga0307408_100441028 | 3300031548 | Bacteria | 1127 |
| 491 | Ga0307408_100536294 | 3300031548 | Bacteria | 1030 |
| 492 | Ga0307405_10029810 | 3300031731 | Bacteria | 3192 |
| 493 | Ga0307413_10000876 | 3300031824 | Bacteria | 10645 |
| 494 | Ga0307413_10536888 | 3300031824 | Bacteria | 946 |
| 495 | Ga0307410_10057177 | 3300031852 | Bacteria | 2655 |
| 496 | Ga0307410_10075979 | 3300031852 | Bacteria | 2343 |
| 497 | Ga0307406_10008301 | 3300031901 | Bacteria | 5787 |
| 498 | Ga0307406_10391676 | 3300031901 | Bacteria | 1099 |
| 499 | Ga0307407_10004929 | 3300031903 | Bacteria | 5735 |
| 500 | Ga0307407_10095458 | 3300031903 | Bacteria | 1833 |
| 501 | Ga0307412_10091790 | 3300031911 | Bacteria | 2126 |
| 502 | Ga0307412_10121164 | 3300031911 | Bacteria | 1883 |
| 503 | Ga0307412_10168796 | 3300031911 | Bacteria | 1634 |
| 504 | Ga0307412_10413563 | 3300031911 | Bacteria | 1101 |
| 505 | Ga0307409_100024545 | 3300031995 | Bacteria | 4207 |
| 506 | Ga0307409_100175759 | 3300031995 | Bacteria | 1889 |
| 507 | Ga0307409_100758402 | 3300031995 | Bacteria | 975 |
| 508 | Ga0307416_100012737 | 3300032002 | Bacteria | 5682 |
| 509 | Ga0307416_100088403 | 3300032002 | Bacteria | 2649 |
| 510 | Ga0307416_100152973 | 3300032002 | Bacteria | 2119 |
| 511 | Ga0307416_101119200 | 3300032002 | Bacteria | 892 |
| 512 | Ga0307414_10009513 | 3300032004 | Bacteria | 5589 |
| 513 | Ga0307414_10013206 | 3300032004 | Bacteria | 4910 |
| 514 | Ga0307414_10027119 | 3300032004 | Bacteria | 3697 |
| 515 | Ga0307414_10038848 | 3300032004 | Bacteria | 3200 |
| 516 | Ga0307414_10143286 | 3300032004 | Bacteria | 1874 |
| 517 | Ga0307414_10695192 | 3300032004 | Bacteria | 920 |
| 518 | Ga0307411_10012698 | 3300032005 | Bacteria | 4611 |
| 519 | Ga0307411_10016663 | 3300032005 | Bacteria | 4163 |
| 520 | Ga0307411_10406493 | 3300032005 | Bacteria | 1127 |
| 521 | Ga0307415_100001077 | 3300032126 | Bacteria | 12688 |
| 522 | Ga0373940_0004499 | 3300035088 | Bacteria | 2948 |
| 523 | Ga0373932_0084041 | 3300035112 | Bacteria | 1011 |
| 524 | Ga0373939_0000410 | 3300035114 | Bacteria | 10797 |
| 525 | Ga0373953_0074659 | 3300035117 | Bacteria | 1403 |
| 526 | Ga0373960_0002496 | 3300035121 | Bacteria | 4137 |
| 527 | Ga0373943_0085756 | 3300035170 | Bacteria | 1622 |
| 528 | Ga0373943_0167539 | 3300035170 | Bacteria | 1200 |
| 529 | Ga0373946_0053028 | 3300035171 | Bacteria | 1703 |
| 530 | Ga0373931_0000228 | 3300035691 | Bacteria | 23922 |
| 531 | Ga0373947_0082224 | 3300035725 | Bacteria | 1996 |
| 532 | Ga0373937_0416352 | 3300036401 | Bacteria | 1275 |
| 533 | Ga0373925_0217126 | 3300037068 | Bacteria | 1525 |
| 534 | Ga0395905_0000676 | 3300037471 | Bacteria | 45246 |
| 535 | Ga0395901_0015234 | 3300038443 | Bacteria | 7824 |
| 536 | Ga0436361_0081204 | 3300039447 | Unclassified | 2557 |
| 537 | Ga0439453_0005277 | 3300041408 | Bacteria | 1962 |
| 538 | Ga0439465_0016461 | 3300041413 | Bacteria | 2306 |
| 539 | Ga0451791_1002939 | 3300041451 | Bacteria | 2240 |
| 540 | Ga0451793_1438105 | 3300041452 | Bacteria | 3242 |
| 541 | Ga0451797_0531083 | 3300041453 | Bacteria | 1843 |
| 542 | Ga0451797_0572638 | 3300041453 | Bacteria | 2187 |
| 543 | Ga0451802_2089645 | 3300041460 | Bacteria | 4816 |
| 544 | Ga0451807_0034953 | 3300041486 | Bacteria | 7992 |
| 545 | Ga0451807_0720322 | 3300041486 | Bacteria | 5832 |
| 546 | Ga0451807_2299026 | 3300041486 | Bacteria | 1596 |
| 547 | Ga0451837_0074019 | 3300041494 | Bacteria | 989 |
| 548 | Ga0451837_0154854 | 3300041494 | Bacteria | 4997 |
| 549 | Ga0451837_0205854 | 3300041494 | Bacteria | 2004 |
| 550 | Ga0451837_0692191 | 3300041494 | Bacteria | 2773 |
| 551 | Ga0451851_1081793 | 3300041507 | Bacteria | 908 |
| 552 | Ga0451843_0190080 | 3300041509 | Bacteria | 4075 |
| 553 | Ga0451843_0906883 | 3300041509 | Bacteria | 1243 |
| 554 | Ga0439431_0035802 | 3300041997 | Bacteria | 1248 |
| 555 | Ga0439431_0096133 | 3300041997 | Bacteria | 811 |
| 556 | Ga0439443_010797 | 3300042003 | Bacteria | 1329 |
| 557 | Ga0439432_061071 | 3300042006 | Bacteria | 1162 |
| 558 | Ga0450920_002714 | 3300042122 | Bacteria | 3035 |
| 559 | Ga0450923_009553 | 3300042125 | Bacteria | 1700 |
| 560 | Ga0450896_002242 | 3300042133 | Bacteria | 2481 |
| 561 | Ga0450898_026334 | 3300042134 | Bacteria | 1048 |
| 562 | Ga0439446_0001503 | 3300042156 | Bacteria | 5336 |
| 563 | Ga0450908_001664 | 3300042184 | Bacteria | 4323 |
| 564 | Ga0450908_002271 | 3300042184 | Bacteria | 3755 |
| 565 | Ga0439434_0002955 | 3300042435 | Bacteria | 4967 |
| 566 | Ga0439435_0000148 | 3300042436 | Bacteria | 9467 |
| 567 | Ga0439435_0101752 | 3300042436 | Bacteria | 884 |
| 568 | Ga0439444_0000013 | 3300042437 | Bacteria | 14340 |
| 569 | Ga0450918_002739 | 3300042531 | Bacteria | 3304 |
| 570 | Ga0439440_0010489 | 3300042993 | Bacteria | 1938 |
| 571 | Ga0453684_0002611 | 3300044712 | Bacteria | 43058 |
| 572 | Ga0453684_0212692 | 3300044712 | Bacteria | 2246 |
| 573 | Ga0453684_0375171 | 3300044712 | Bacteria | 1598 |
| 574 | Ga0451576_0000042 | 3300045051 | Bacteria | 342102 |
| 575 | Ga0451576_0266347 | 3300045051 | Bacteria | 1791 |
| 576 | Ga0495580_0063827 | 3300046472 | Bacteria | 2582 |
| 577 | Ga0495594_0137924 | 3300046499 | Unclassified | 1383 |
| 578 | Ga0495663_0016213 | 3300046525 | Bacteria | 2106 |
| 579 | Ga0495598_0000828 | 3300046537 | Bacteria | 5933 |
| 580 | Ga0495598_0025574 | 3300046537 | Bacteria | 1611 |
| 581 | Ga0495621_0000271 | 3300046539 | Bacteria | 12420 |
| 582 | Ga0495621_0013377 | 3300046539 | Bacteria | 2576 |
| 583 | Ga0495621_0053926 | 3300046539 | Bacteria | 1444 |
| 584 | Ga0495621_0116528 | 3300046539 | Bacteria | 1029 |
| 585 | Ga0495633_0110071 | 3300046558 | Bacteria | 1277 |
| 586 | Ga0495656_0011107 | 3300046615 | Bacteria | 3298 |
| 587 | Ga0495656_0064915 | 3300046615 | Bacteria | 1604 |
| 588 | Ga0495656_0209541 | 3300046615 | Bacteria | 970 |
| 589 | Ga0495659_0032880 | 3300046664 | Bacteria | 1818 |
| 590 | Ga0495647_0011922 | 3300046681 | Bacteria | 2985 |
| 591 | Ga0495658_0137919 | 3300046683 | Bacteria | 1490 |
| 592 | Ga0495613_0451568 | 3300046689 | Unclassified | 871 |
| 593 | Ga0495670_0270838 | 3300046691 | Bacteria | 907 |
| 594 | Ga0495600_0065975 | 3300046809 | Bacteria | 2367 |
| 595 | Ga0495636_0001496 | 3300047318 | Bacteria | 8857 |
| 596 | Ga0495636_0024512 | 3300047318 | Bacteria | 2447 |
| 597 | Ga0495684_0142614 | 3300047471 | Bacteria | 1796 |
| 598 | Ga0496100_0123979 | 3300048903 | Bacteria | 1811 |
| 599 | Ga0496101_0031890 | 3300048904 | Bacteria | 3706 |
| 600 | Ga0496101_0122931 | 3300048904 | Bacteria | 1964 |
| 601 | Ga0496102_0156312 | 3300048905 | Bacteria | 2143 |
| 602 | Ga0496103_0016203 | 3300048906 | Bacteria | 4447 |
| 603 | Ga0496104_0000017 | 3300048907 | Bacteria | 325877 |
| 604 | Ga0496104_0112629 | 3300048907 | Bacteria | 2609 |
| 605 | Ga0496104_0439809 | 3300048907 | Bacteria | 1216 |
| 606 | Ga0496105_0000009 | 3300048908 | Bacteria | 325734 |
| 607 | Ga0496105_0387104 | 3300048908 | Bacteria | 1112 |
| 608 | Ga0496106_0047660 | 3300048909 | Bacteria | 3226 |
| 609 | Ga0496106_0192782 | 3300048909 | Bacteria | 1621 |
| 610 | Ga0496106_0283314 | 3300048909 | Bacteria | 1328 |
| 611 | Ga0496107_0043602 | 3300048910 | Bacteria | 3223 |
| 612 | Ga0496107_0097807 | 3300048910 | Bacteria | 2149 |
| 613 | Ga0496108_0016568 | 3300048911 | Bacteria | 6017 |
| 614 | Ga0496108_0185991 | 3300048911 | Bacteria | 1799 |
| 615 | Ga0496109_0031279 | 3300048912 | Bacteria | 4775 |
| 616 | Ga0496109_0296386 | 3300048912 | Bacteria | 1525 |
| 617 | Ga0496109_0703952 | 3300048912 | Bacteria | 947 |
| 618 | Ga0496110_0016522 | 3300048913 | Bacteria | 6163 |
| 619 | Ga0496110_0127916 | 3300048913 | Bacteria | 2292 |
| 620 | Ga0496110_0628413 | 3300048913 | Bacteria | 973 |
| 621 | Ga0496111_0208339 | 3300048914 | Bacteria | 1452 |
| 622 | Ga0496113_0073437 | 3300048916 | Bacteria | 2606 |
| 623 | Ga0496113_0158950 | 3300048916 | Bacteria | 1786 |
| 624 | Ga0496113_0649012 | 3300048916 | Unclassified | 844 |
| 625 | Ga0496114_0055839 | 3300048917 | Bacteria | 3294 |
| 626 | Ga0496124_0254628 | 3300048927 | Bacteria | 1296 |
| 627 | Ga0496126_0420927 | 3300048929 | Unclassified | 1080 |
| 628 | Ga0501031_0122362 | 3300049568 | Bacteria | 1700 |
| 629 | Ga0501032_0087926 | 3300049569 | Bacteria | 2063 |
| 630 | Ga0501032_0380786 | 3300049569 | Bacteria | 907 |
| 631 | Ga0501033_0019842 | 3300049570 | Bacteria | 5081 |
| 632 | Ga0501034_0000544 | 3300049571 | Bacteria | 59969 |
| 633 | Ga0501034_0032339 | 3300049571 | Bacteria | 5313 |
| 634 | Ga0501036_0156238 | 3300049572 | Bacteria | 1924 |
| 635 | Ga0501037_0247264 | 3300049573 | Bacteria | 1249 |
| 636 | Ga0501038_0087191 | 3300049574 | Bacteria | 2621 |
| 637 | Ga0501038_0109028 | 3300049574 | Bacteria | 2295 |
| 638 | Ga0501039_0179245 | 3300049575 | Bacteria | 1666 |
| 639 | Ga0501039_0239978 | 3300049575 | Bacteria | 1425 |
| 640 | Ga0501047_0003127 | 3300049581 | Bacteria | 15702 |
| 641 | Ga0501047_0169081 | 3300049581 | Bacteria | 2055 |
| 642 | Ga0501067_0016843 | 3300049583 | Bacteria | 4036 |
| 643 | Ga0501068_0009244 | 3300049584 | Bacteria | 5509 |
| 644 | Ga0501070_0066342 | 3300049586 | Bacteria | 2988 |
| 645 | Ga0501072_0020226 | 3300049588 | Bacteria | 5155 |
| 646 | Ga0501073_0000406 | 3300049589 | Bacteria | 29411 |
| 647 | Ga0501225_0028958 | 3300049705 | Bacteria | 1522 |
| 648 | Ga0501079_0049523 | 3300049741 | Bacteria | 3242 |
| 649 | Ga0501080_0013933 | 3300049742 | Bacteria | 7399 |
| 650 | Ga0501080_0194496 | 3300049742 | Bacteria | 1863 |
| 651 | Ga0501083_0008440 | 3300049744 | Bacteria | 7279 |
| 652 | Ga0501035_0050901 | 3300049822 | Bacteria | 3710 |
| 653 | Ga0501035_0087317 | 3300049822 | Bacteria | 2749 |
| 654 | Ga0501044_0011438 | 3300049823 | Bacteria | 9614 |
| 655 | Ga0501044_0039840 | 3300049823 | Bacteria | 4899 |
| 656 | Ga0501044_0065224 | 3300049823 | Bacteria | 3714 |
| 657 | Ga0501044_0523323 | 3300049823 | Bacteria | 1085 |
| 658 | nmdc:mga0k408_24917_c1 | 3300050493 | Bacteria | 3385 |
| 659 | nmdc:mga0k408_443367_c1 | 3300050493 | Unclassified | 771 |
| 660 | nmdc:mga0k408_9257_c1 | 3300050493 | Bacteria | 5307 |
| 661 | nmdc:mga07m45_4968_c1 | 3300050496 | Bacteria | 6562 |
| 662 | nmdc:mga07m45_95851_c1 | 3300050496 | Bacteria | 1702 |
| 663 | Ga0495619_0066884 | 3300053085 | Bacteria | 2399 |
| 664 | Ga0500642_0052515 | 3300053130 | Bacteria | 1804 |
| 665 | Ga0501082_0073547 | 3300060353 | Bacteria | 2944 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10278809 | Ga0207662_102788091 | 212 |
| 2 | 3300009174 | Ga0105241_10288461 | Ga0105241_102884612 | 216 |
| 3 | 3300009093 | Ga0105240_10302039 | Ga0105240_103020392 | 219 |
| 4 | 3300025913 | Ga0207695_10204085 | Ga0207695_102040852 | 219 |
| 5 | 3300046539 | Ga0495621_0053926 | Ga0495621_0053926_761_1426 | 221 |
| 6 | 3300005618 | Ga0068864_100273325 | Ga0068864_1002733252 | 222 |
| 7 | 3300049575 | Ga0501039_0179245 | Ga0501039_0179245_969_1640 | 222 |
| 8 | 3300050493 | nmdc:mga0k408_443367_c1 | nmdc:mga0k408_443367_c1_62_748 | 223 |
| 9 | 3300048913 | Ga0496110_0628413 | Ga0496110_0628413_32_796 | 226 |
| 10 | 3300025242 | Ga0209258_100277 | Ga0209258_10027754 | 227 |
| 11 | 3300049742 | Ga0501080_0194496 | Ga0501080_0194496_876_1685 | 228 |
| 12 | 3300003752 | Ga0055539_1000116 | Ga0055539_100011686 | 230 |
| 13 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016293 | 230 |
| 14 | 3300003759 | Ga0055525_1000955 | Ga0055525_10009554 | 230 |
| 15 | 3300005335 | Ga0070666_10085797 | Ga0070666_100857973 | 230 |
| 16 | 3300005354 | Ga0070675_100174687 | Ga0070675_1001746872 | 230 |
| 17 | 3300005355 | Ga0070671_100102271 | Ga0070671_1001022711 | 230 |
| 18 | 3300005457 | Ga0070662_100037080 | Ga0070662_1000370802 | 230 |
| 19 | 3300005459 | Ga0068867_100049802 | Ga0068867_1000498023 | 230 |
| 20 | 3300009177 | Ga0105248_10216625 | Ga0105248_102166253 | 230 |
| 21 | 3300025226 | Ga0209674_100041 | Ga0209674_10004191 | 230 |
| 22 | 3300025230 | Ga0209563_100043 | Ga0209563_10004391 | 230 |
| 23 | 3300025253 | Ga0209677_100077 | Ga0209677_10007791 | 230 |
| 24 | 3300025903 | Ga0207680_10030394 | Ga0207680_100303942 | 230 |
| 25 | 3300025931 | Ga0207644_10181110 | Ga0207644_101811102 | 230 |
| 26 | 3300025933 | Ga0207706_10268247 | Ga0207706_102682472 | 230 |
| 27 | 3300025941 | Ga0207711_10140439 | Ga0207711_101404393 | 230 |
| 28 | 3300026121 | Ga0207683_10229015 | Ga0207683_102290152 | 230 |
| 29 | 3300048912 | Ga0496109_0296386 | Ga0496109_0296386_652_1464 | 230 |
| 30 | 3300049581 | Ga0501047_0003127 | Ga0501047_0003127_13882_14697 | 230 |
| 31 | 3300049823 | Ga0501044_0011438 | Ga0501044_0011438_7786_8601 | 230 |
| 32 | iso_pu_bacteria | 2643221585 | 2643937134 | 230 |
| 33 | iso_pu_bacteria | 2643221656 | 2644318299 | 230 |
| 34 | 3300025920 | Ga0207649_10175369 | Ga0207649_101753692 | 231 |
| 35 | 3300028794 | Ga0307515_10039838 | Ga0307515_100398387 | 231 |
| 36 | 3300046539 | Ga0495621_0013377 | Ga0495621_0013377_810_1550 | 231 |
| 37 | 3300049569 | Ga0501032_0380786 | Ga0501032_0380786_57_851 | 231 |
| 38 | 3300049570 | Ga0501033_0019842 | Ga0501033_0019842_570_1364 | 231 |
| 39 | 3300005333 | Ga0070677_10037664 | Ga0070677_100376641 | 232 |
| 40 | 3300005840 | Ga0068870_10201494 | Ga0068870_102014942 | 232 |
| 41 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021375 | 232 |
| 42 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031375 | 232 |
| 43 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041375 | 232 |
| 44 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061375 | 232 |
| 45 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031375 | 232 |
| 46 | 3300026142 | Ga0207698_10625817 | Ga0207698_106258172 | 232 |
| 47 | 3300035088 | Ga0373940_0004499 | Ga0373940_0004499_791_1501 | 232 |
| 48 | 3300035114 | Ga0373939_0000410 | Ga0373939_0000410_3156_3866 | 232 |
| 49 | 3300035121 | Ga0373960_0002496 | Ga0373960_0002496_1393_2103 | 232 |
| 50 | 3300035691 | Ga0373931_0000228 | Ga0373931_0000228_20326_21036 | 232 |
| 51 | 3300048909 | Ga0496106_0192782 | Ga0496106_0192782_357_1172 | 232 |
| 52 | 3300044712 | Ga0453684_0212692 | Ga0453684_0212692_769_1518 | 233 |
| 53 | 3300005459 | Ga0068867_100069578 | Ga0068867_1000695782 | 234 |
| 54 | 3300025231 | Ga0207427_100453 | Ga0207427_10045312 | 234 |
| 55 | 3300026041 | Ga0207639_10162037 | Ga0207639_101620372 | 234 |
| 56 | 3300026089 | Ga0207648_10033764 | Ga0207648_100337642 | 234 |
| 57 | 3300026095 | Ga0207676_10084789 | Ga0207676_100847892 | 234 |
| 58 | 3300003794 | Ga0055531_10000064 | Ga0055531_1000006472 | 235 |
| 59 | 3300005331 | Ga0070670_100032014 | Ga0070670_1000320141 | 235 |
| 60 | 3300005617 | Ga0068859_101026206 | Ga0068859_1010262061 | 235 |
| 61 | 3300005842 | Ga0068858_100028111 | Ga0068858_1000281114 | 235 |
| 62 | 3300006353 | Ga0075370_10106626 | Ga0075370_101066262 | 235 |
| 63 | 3300006931 | Ga0097620_101026026 | Ga0097620_1010260261 | 235 |
| 64 | 3300025298 | Ga0209050_1010421 | Ga0209050_10104216 | 235 |
| 65 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032591 | 235 |
| 66 | 3300037471 | Ga0395905_0000676 | Ga0395905_0000676_32309_33028 | 235 |
| 67 | 3300050496 | nmdc:mga07m45_95851_c1 | nmdc:mga07m45_95851_c1_500_1222 | 235 |
| 68 | 3300005331 | Ga0070670_100055955 | Ga0070670_1000559552 | 236 |
| 69 | 3300005355 | Ga0070671_100002319 | Ga0070671_10000231913 | 236 |
| 70 | 3300005355 | Ga0070671_100150215 | Ga0070671_1001502152 | 236 |
| 71 | 3300005356 | Ga0070674_100095866 | Ga0070674_1000958662 | 236 |
| 72 | 3300005456 | Ga0070678_100050318 | Ga0070678_1000503183 | 236 |
| 73 | 3300005543 | Ga0070672_100119088 | Ga0070672_1001190882 | 236 |
| 74 | 3300005618 | Ga0068864_100046308 | Ga0068864_1000463084 | 236 |
| 75 | 3300006237 | Ga0097621_100045292 | Ga0097621_1000452922 | 236 |
| 76 | 3300006358 | Ga0068871_100031888 | Ga0068871_1000318882 | 236 |
| 77 | 3300009177 | Ga0105248_10056704 | Ga0105248_100567042 | 236 |
| 78 | 3300009177 | Ga0105248_10194895 | Ga0105248_101948953 | 236 |
| 79 | 3300013306 | Ga0163162_10374544 | Ga0163162_103745442 | 236 |
| 80 | 3300013308 | Ga0157375_10158522 | Ga0157375_101585222 | 236 |
| 81 | 3300013308 | Ga0157375_10342108 | Ga0157375_103421082 | 236 |
| 82 | 3300014325 | Ga0163163_10276062 | Ga0163163_102760622 | 236 |
| 83 | 3300025893 | Ga0207682_10002237 | Ga0207682_100022372 | 236 |
| 84 | 3300025907 | Ga0207645_10025478 | Ga0207645_100254782 | 236 |
| 85 | 3300025923 | Ga0207681_10668208 | Ga0207681_106682081 | 236 |
| 86 | 3300025925 | Ga0207650_10047183 | Ga0207650_100471833 | 236 |
| 87 | 3300025931 | Ga0207644_10000556 | Ga0207644_100005565 | 236 |
| 88 | 3300025937 | Ga0207669_10115744 | Ga0207669_101157442 | 236 |
| 89 | 3300025940 | Ga0207691_10229577 | Ga0207691_102295772 | 236 |
| 90 | 3300025941 | Ga0207711_10023745 | Ga0207711_100237452 | 236 |
| 91 | 3300025941 | Ga0207711_10172699 | Ga0207711_101726992 | 236 |
| 92 | 3300026088 | Ga0207641_10074607 | Ga0207641_100746073 | 236 |
| 93 | 3300026089 | Ga0207648_10155203 | Ga0207648_101552032 | 236 |
| 94 | 3300026095 | Ga0207676_10028213 | Ga0207676_100282132 | 236 |
| 95 | 3300026118 | Ga0207675_100277447 | Ga0207675_1002774472 | 236 |
| 96 | 3300026121 | Ga0207683_10010565 | Ga0207683_100105652 | 236 |
| 97 | 3300026121 | Ga0207683_10166708 | Ga0207683_101667082 | 236 |
| 98 | 3300026142 | Ga0207698_10069787 | Ga0207698_100697872 | 236 |
| 99 | 3300026142 | Ga0207698_10234238 | Ga0207698_102342382 | 236 |
| 100 | 3300046539 | Ga0495621_0116528 | Ga0495621_0116528_78_890 | 236 |
| 101 | 3300049568 | Ga0501031_0122362 | Ga0501031_0122362_115_912 | 236 |
| 102 | 3300049572 | Ga0501036_0156238 | Ga0501036_0156238_330_1124 | 236 |
| 103 | 3300049573 | Ga0501037_0247264 | Ga0501037_0247264_192_989 | 236 |
| 104 | 3300049822 | Ga0501035_0050901 | Ga0501035_0050901_2376_3173 | 236 |
| 105 | iso_pu_bacteria | 2643221639 | 2644217885 | 236 |
| 106 | iso_pu_bacteria | 2643221646 | 2644258378 | 236 |
| 107 | 3300005614 | Ga0068856_100115337 | Ga0068856_1001153372 | 237 |
| 108 | 3300026078 | Ga0207702_10041695 | Ga0207702_100416954 | 237 |
| 109 | 3300026089 | Ga0207648_10040746 | Ga0207648_100407464 | 237 |
| 110 | 3300032004 | Ga0307414_10027119 | Ga0307414_100271193 | 237 |
| 111 | 3300045051 | Ga0451576_0266347 | Ga0451576_0266347_1032_1760 | 237 |
| 112 | 3300049823 | Ga0501044_0065224 | Ga0501044_0065224_1545_2318 | 237 |
| 113 | 3300005564 | Ga0070664_100272968 | Ga0070664_1002729682 | 238 |
| 114 | 3300014968 | Ga0157379_10019612 | Ga0157379_100196123 | 238 |
| 115 | 3300035112 | Ga0373932_0084041 | Ga0373932_0084041_99_887 | 238 |
| 116 | 3300005539 | Ga0068853_100209944 | Ga0068853_1002099442 | 239 |
| 117 | 3300048916 | Ga0496113_0649012 | Ga0496113_0649012_79_831 | 239 |
| 118 | 3300049574 | Ga0501038_0109028 | Ga0501038_0109028_879_1661 | 239 |
| 119 | 3300049822 | Ga0501035_0087317 | Ga0501035_0087317_578_1414 | 239 |
| 120 | 3300005331 | Ga0070670_100196559 | Ga0070670_1001965592 | 240 |
| 121 | 3300005338 | Ga0068868_100069917 | Ga0068868_1000699172 | 240 |
| 122 | 3300005618 | Ga0068864_100017913 | Ga0068864_1000179134 | 240 |
| 123 | 3300005841 | Ga0068863_100160934 | Ga0068863_1001609342 | 240 |
| 124 | 3300005843 | Ga0068860_100186932 | Ga0068860_1001869322 | 240 |
| 125 | 3300006195 | Ga0075366_10053644 | Ga0075366_100536442 | 240 |
| 126 | 3300006353 | Ga0075370_10008300 | Ga0075370_100083006 | 240 |
| 127 | 3300014968 | Ga0157379_10148011 | Ga0157379_101480112 | 240 |
| 128 | 3300025925 | Ga0207650_10281596 | Ga0207650_102815962 | 240 |
| 129 | 3300025927 | Ga0207687_10049364 | Ga0207687_100493642 | 240 |
| 130 | 3300026023 | Ga0207677_10039518 | Ga0207677_100395182 | 240 |
| 131 | 3300026088 | Ga0207641_10645370 | Ga0207641_106453702 | 240 |
| 132 | 3300028381 | Ga0268264_10135919 | Ga0268264_101359191 | 240 |
| 133 | 3300028794 | Ga0307515_10000425 | Ga0307515_1000042582 | 240 |
| 134 | 3300049571 | Ga0501034_0000544 | Ga0501034_0000544_43994_44764 | 240 |
| 135 | 3300050493 | nmdc:mga0k408_24917_c1 | nmdc:mga0k408_24917_c1_1342_2118 | 240 |
| 136 | 3300050493 | nmdc:mga0k408_9257_c1 | nmdc:mga0k408_9257_c1_3384_4169 | 240 |
| 137 | 3300028794 | Ga0307515_10083827 | Ga0307515_100838275 | 241 |
| 138 | 3300046499 | Ga0495594_0137924 | Ga0495594_0137924_546_1325 | 241 |
| 139 | 3300048929 | Ga0496126_0420927 | Ga0496126_0420927_19_792 | 241 |
| 140 | 3300028794 | Ga0307515_10000026 | Ga0307515_1000002687 | 243 |
| 141 | 3300005331 | Ga0070670_100003776 | Ga0070670_10000377610 | 244 |
| 142 | 3300005355 | Ga0070671_100137059 | Ga0070671_1001370593 | 244 |
| 143 | 3300005439 | Ga0070711_100330138 | Ga0070711_1003301382 | 244 |
| 144 | 3300005543 | Ga0070672_100315321 | Ga0070672_1003153212 | 244 |
| 145 | 3300005618 | Ga0068864_100053340 | Ga0068864_1000533402 | 244 |
| 146 | 3300005841 | Ga0068863_100317521 | Ga0068863_1003175212 | 244 |
| 147 | 3300013308 | Ga0157375_10647883 | Ga0157375_106478832 | 244 |
| 148 | 3300021361 | Ga0213872_10084758 | Ga0213872_100847582 | 244 |
| 149 | 3300025914 | Ga0207671_10178306 | Ga0207671_101783062 | 244 |
| 150 | 3300025925 | Ga0207650_10006933 | Ga0207650_100069334 | 244 |
| 151 | 3300026088 | Ga0207641_10065162 | Ga0207641_100651622 | 244 |
| 152 | 3300028379 | Ga0268266_10218463 | Ga0268266_102184632 | 244 |
| 153 | 3300039447 | Ga0436361_0081204 | Ga0436361_0081204_568_1341 | 244 |
| 154 | 3300042122 | Ga0450920_002714 | Ga0450920_002714_1895_2674 | 244 |
| 155 | 3300042125 | Ga0450923_009553 | Ga0450923_009553_610_1389 | 244 |
| 156 | 3300042184 | Ga0450908_002271 | Ga0450908_002271_1057_1836 | 244 |
| 157 | 3300042531 | Ga0450918_002739 | Ga0450918_002739_2415_3194 | 244 |
| 158 | iso_pu_bacteria | 2524614729 | 2525557182 | 244 |
| 159 | iso_pu_bacteria | 2627854209 | 2630648778 | 244 |
| 160 | 3300005459 | Ga0068867_100117804 | Ga0068867_1001178042 | 245 |
| 161 | 3300031238 | Ga0265332_10000027 | Ga0265332_1000002738 | 245 |
| 162 | 3300005365 | Ga0070688_100171686 | Ga0070688_1001716861 | 246 |
| 163 | 3300005366 | Ga0070659_100292580 | Ga0070659_1002925802 | 246 |
| 164 | 3300005530 | Ga0070679_100066994 | Ga0070679_1000669944 | 246 |
| 165 | 3300013308 | Ga0157375_10025214 | Ga0157375_100252144 | 246 |
| 166 | iso_pu_bacteria | 2588253510 | 2588295561 | 246 |
| 167 | iso_pu_bacteria | 2643221592 | 2643968245 | 246 |
| 168 | iso_pu_bacteria | 2643221625 | 2644143602 | 246 |
| 169 | iso_pu_bacteria | 2643221648 | 2644272023 | 246 |
| 170 | 3300005331 | Ga0070670_100105022 | Ga0070670_1001050222 | 247 |
| 171 | 3300005334 | Ga0068869_100007068 | Ga0068869_1000070688 | 247 |
| 172 | 3300005338 | Ga0068868_100459369 | Ga0068868_1004593691 | 247 |
| 173 | 3300005347 | Ga0070668_100008000 | Ga0070668_1000080006 | 247 |
| 174 | 3300005354 | Ga0070675_100213041 | Ga0070675_1002130412 | 247 |
| 175 | 3300005456 | Ga0070678_100028643 | Ga0070678_1000286433 | 247 |
| 176 | 3300005459 | Ga0068867_100590981 | Ga0068867_1005909811 | 247 |
| 177 | 3300005543 | Ga0070672_100011455 | Ga0070672_1000114554 | 247 |
| 178 | 3300005548 | Ga0070665_100016157 | Ga0070665_1000161576 | 247 |
| 179 | 3300005616 | Ga0068852_100194861 | Ga0068852_1001948612 | 247 |
| 180 | 3300005617 | Ga0068859_100088520 | Ga0068859_1000885202 | 247 |
| 181 | 3300005840 | Ga0068870_10054432 | Ga0068870_100544321 | 247 |
| 182 | 3300005843 | Ga0068860_100007275 | Ga0068860_1000072759 | 247 |
| 183 | 3300006881 | Ga0068865_100026863 | Ga0068865_1000268632 | 247 |
| 184 | 3300006931 | Ga0097620_100088526 | Ga0097620_1000885262 | 247 |
| 185 | 3300013306 | Ga0163162_10343624 | Ga0163162_103436242 | 247 |
| 186 | 3300014325 | Ga0163163_10000039 | Ga0163163_1000003969 | 247 |
| 187 | 3300025907 | Ga0207645_10041768 | Ga0207645_100417682 | 247 |
| 188 | 3300025908 | Ga0207643_10008956 | Ga0207643_100089562 | 247 |
| 189 | 3300025923 | Ga0207681_10033032 | Ga0207681_100330323 | 247 |
| 190 | 3300025926 | Ga0207659_10510307 | Ga0207659_105103072 | 247 |
| 191 | 3300025938 | Ga0207704_10268047 | Ga0207704_102680472 | 247 |
| 192 | 3300025940 | Ga0207691_10010978 | Ga0207691_100109787 | 247 |
| 193 | 3300025960 | Ga0207651_10091127 | Ga0207651_100911272 | 247 |
| 194 | 3300025972 | Ga0207668_10074867 | Ga0207668_100748672 | 247 |
| 195 | 3300026023 | Ga0207677_10160347 | Ga0207677_101603471 | 247 |
| 196 | 3300026121 | Ga0207683_10018093 | Ga0207683_100180932 | 247 |
| 197 | 3300026142 | Ga0207698_10191331 | Ga0207698_101913312 | 247 |
| 198 | 3300028381 | Ga0268264_10015656 | Ga0268264_100156562 | 247 |
| 199 | 3300005328 | Ga0070676_10002044 | Ga0070676_100020443 | 248 |
| 200 | 3300005328 | Ga0070676_10064471 | Ga0070676_100644712 | 248 |
| 201 | 3300005331 | Ga0070670_100167191 | Ga0070670_1001671912 | 248 |
| 202 | 3300005334 | Ga0068869_100011109 | Ga0068869_1000111091 | 248 |
| 203 | 3300005334 | Ga0068869_100174295 | Ga0068869_1001742952 | 248 |
| 204 | 3300005340 | Ga0070689_100470701 | Ga0070689_1004707011 | 248 |
| 205 | 3300005347 | Ga0070668_100093306 | Ga0070668_1000933062 | 248 |
| 206 | 3300005353 | Ga0070669_100010333 | Ga0070669_1000103332 | 248 |
| 207 | 3300005355 | Ga0070671_100231835 | Ga0070671_1002318352 | 248 |
| 208 | 3300005364 | Ga0070673_100058680 | Ga0070673_1000586802 | 248 |
| 209 | 3300005367 | Ga0070667_100021558 | Ga0070667_1000215585 | 248 |
| 210 | 3300005455 | Ga0070663_100427190 | Ga0070663_1004271901 | 248 |
| 211 | 3300005456 | Ga0070678_100177930 | Ga0070678_1001779302 | 248 |
| 212 | 3300005457 | Ga0070662_100012047 | Ga0070662_1000120475 | 248 |
| 213 | 3300005539 | Ga0068853_100486531 | Ga0068853_1004865312 | 248 |
| 214 | 3300005543 | Ga0070672_100013269 | Ga0070672_1000132695 | 248 |
| 215 | 3300005564 | Ga0070664_100234468 | Ga0070664_1002344682 | 248 |
| 216 | 3300005617 | Ga0068859_100025358 | Ga0068859_1000253584 | 248 |
| 217 | 3300005718 | Ga0068866_10001890 | Ga0068866_100018902 | 248 |
| 218 | 3300005719 | Ga0068861_100044446 | Ga0068861_1000444464 | 248 |
| 219 | 3300005841 | Ga0068863_100006737 | Ga0068863_1000067374 | 248 |
| 220 | 3300005842 | Ga0068858_100040886 | Ga0068858_1000408862 | 248 |
| 221 | 3300006881 | Ga0068865_100018347 | Ga0068865_1000183472 | 248 |
| 222 | 3300006931 | Ga0097620_100025359 | Ga0097620_1000253594 | 248 |
| 223 | 3300009098 | Ga0105245_10173897 | Ga0105245_101738972 | 248 |
| 224 | 3300009148 | Ga0105243_10020958 | Ga0105243_100209584 | 248 |
| 225 | 3300009176 | Ga0105242_10001775 | Ga0105242_1000177510 | 248 |
| 226 | 3300013306 | Ga0163162_10007086 | Ga0163162_100070866 | 248 |
| 227 | 3300013308 | Ga0157375_10000342 | Ga0157375_1000034234 | 248 |
| 228 | 3300013308 | Ga0157375_10030411 | Ga0157375_100304114 | 248 |
| 229 | 3300014326 | Ga0157380_10023836 | Ga0157380_100238365 | 248 |
| 230 | 3300014969 | Ga0157376_10002239 | Ga0157376_100022393 | 248 |
| 231 | 3300025315 | Ga0207697_10012117 | Ga0207697_100121174 | 248 |
| 232 | 3300025893 | Ga0207682_10011838 | Ga0207682_100118382 | 248 |
| 233 | 3300025903 | Ga0207680_10051797 | Ga0207680_100517972 | 248 |
| 234 | 3300025907 | Ga0207645_10002988 | Ga0207645_1000298811 | 248 |
| 235 | 3300025918 | Ga0207662_10003987 | Ga0207662_100039875 | 248 |
| 236 | 3300025933 | Ga0207706_10009694 | Ga0207706_100096942 | 248 |
| 237 | 3300025934 | Ga0207686_10005254 | Ga0207686_100052542 | 248 |
| 238 | 3300025938 | Ga0207704_10005663 | Ga0207704_100056633 | 248 |
| 239 | 3300025940 | Ga0207691_10001853 | Ga0207691_1000185316 | 248 |
| 240 | 3300025940 | Ga0207691_10019096 | Ga0207691_100190967 | 248 |
| 241 | 3300025942 | Ga0207689_10004439 | Ga0207689_100044399 | 248 |
| 242 | 3300025945 | Ga0207679_10120486 | Ga0207679_101204862 | 248 |
| 243 | 3300025945 | Ga0207679_10409687 | Ga0207679_104096872 | 248 |
| 244 | 3300025960 | Ga0207651_10014472 | Ga0207651_100144724 | 248 |
| 245 | 3300025960 | Ga0207651_10168943 | Ga0207651_101689432 | 248 |
| 246 | 3300025961 | Ga0207712_10055113 | Ga0207712_100551132 | 248 |
| 247 | 3300025972 | Ga0207668_10024666 | Ga0207668_100246664 | 248 |
| 248 | 3300025986 | Ga0207658_10006534 | Ga0207658_100065346 | 248 |
| 249 | 3300026035 | Ga0207703_10026909 | Ga0207703_100269095 | 248 |
| 250 | 3300026067 | Ga0207678_10215167 | Ga0207678_102151672 | 248 |
| 251 | 3300026088 | Ga0207641_10004384 | Ga0207641_1000438412 | 248 |
| 252 | 3300026089 | Ga0207648_10010341 | Ga0207648_100103412 | 248 |
| 253 | 3300026089 | Ga0207648_10229490 | Ga0207648_102294902 | 248 |
| 254 | 3300026118 | Ga0207675_100001089 | Ga0207675_10000108919 | 248 |
| 255 | 3300026121 | Ga0207683_10199833 | Ga0207683_101998332 | 248 |
| 256 | 3300026142 | Ga0207698_10074292 | Ga0207698_100742923 | 248 |
| 257 | 3300028381 | Ga0268264_10005552 | Ga0268264_100055527 | 248 |
| 258 | 3300028794 | Ga0307515_10012894 | Ga0307515_100128944 | 248 |
| 259 | 3300035117 | Ga0373953_0074659 | Ga0373953_0074659_344_1156 | 248 |
| 260 | 3300035170 | Ga0373943_0085756 | Ga0373943_0085756_218_1030 | 248 |
| 261 | 3300036401 | Ga0373937_0416352 | Ga0373937_0416352_257_1069 | 248 |
| 262 | 3300037068 | Ga0373925_0217126 | Ga0373925_0217126_592_1404 | 248 |
| 263 | 3300042436 | Ga0439435_0101752 | Ga0439435_0101752_82_873 | 248 |
| 264 | 3300044712 | Ga0453684_0375171 | Ga0453684_0375171_46_870 | 248 |
| 265 | 3300046681 | Ga0495647_0011922 | Ga0495647_0011922_987_1799 | 248 |
| 266 | 3300046689 | Ga0495613_0451568 | Ga0495613_0451568_22_834 | 248 |
| 267 | 3300046809 | Ga0495600_0065975 | Ga0495600_0065975_1360_2172 | 248 |
| 268 | 3300047471 | Ga0495684_0142614 | Ga0495684_0142614_723_1535 | 248 |
| 269 | 3300048907 | Ga0496104_0000017 | Ga0496104_0000017_137804_138610 | 248 |
| 270 | 3300048908 | Ga0496105_0000009 | Ga0496105_0000009_264440_265246 | 248 |
| 271 | 3300049569 | Ga0501032_0087926 | Ga0501032_0087926_265_1041 | 248 |
| 272 | 3300049571 | Ga0501034_0032339 | Ga0501034_0032339_3389_4165 | 248 |
| 273 | 3300049574 | Ga0501038_0087191 | Ga0501038_0087191_793_1569 | 248 |
| 274 | 3300049575 | Ga0501039_0239978 | Ga0501039_0239978_65_841 | 248 |
| 275 | 3300049581 | Ga0501047_0169081 | Ga0501047_0169081_1050_1826 | 248 |
| 276 | 3300049583 | Ga0501067_0016843 | Ga0501067_0016843_33_809 | 248 |
| 277 | 3300049584 | Ga0501068_0009244 | Ga0501068_0009244_505_1281 | 248 |
| 278 | 3300049586 | Ga0501070_0066342 | Ga0501070_0066342_1964_2740 | 248 |
| 279 | 3300049588 | Ga0501072_0020226 | Ga0501072_0020226_2944_3720 | 248 |
| 280 | 3300049589 | Ga0501073_0000406 | Ga0501073_0000406_25518_26294 | 248 |
| 281 | 3300049741 | Ga0501079_0049523 | Ga0501079_0049523_2274_3050 | 248 |
| 282 | 3300049742 | Ga0501080_0013933 | Ga0501080_0013933_3098_3874 | 248 |
| 283 | 3300049744 | Ga0501083_0008440 | Ga0501083_0008440_3543_4319 | 248 |
| 284 | 3300049823 | Ga0501044_0039840 | Ga0501044_0039840_946_1722 | 248 |
| 285 | 3300053085 | Ga0495619_0066884 | Ga0495619_0066884_868_1680 | 248 |
| 286 | 3300060353 | Ga0501082_0073547 | Ga0501082_0073547_714_1490 | 248 |
| 287 | 3300003751 | Ga0055538_1000050 | Ga0055538_100005018 | 249 |
| 288 | 3300003752 | Ga0055539_1000074 | Ga0055539_100007418 | 249 |
| 289 | 3300003756 | Ga0055533_1000081 | Ga0055533_100008118 | 249 |
| 290 | 3300003759 | Ga0055525_1000108 | Ga0055525_1000108109 | 249 |
| 291 | 3300003841 | Ga0055541_1000052 | Ga0055541_100005218 | 249 |
| 292 | 3300005331 | Ga0070670_100301718 | Ga0070670_1003017182 | 249 |
| 293 | 3300005347 | Ga0070668_100121787 | Ga0070668_1001217872 | 249 |
| 294 | 3300005353 | Ga0070669_100072979 | Ga0070669_1000729792 | 249 |
| 295 | 3300005365 | Ga0070688_100039876 | Ga0070688_1000398762 | 249 |
| 296 | 3300005367 | Ga0070667_100194438 | Ga0070667_1001944382 | 249 |
| 297 | 3300005456 | Ga0070678_100191615 | Ga0070678_1001916152 | 249 |
| 298 | 3300005548 | Ga0070665_100010042 | Ga0070665_10001004212 | 249 |
| 299 | 3300005719 | Ga0068861_100575234 | Ga0068861_1005752342 | 249 |
| 300 | 3300005844 | Ga0068862_100303568 | Ga0068862_1003035682 | 249 |
| 301 | 3300025923 | Ga0207681_10063258 | Ga0207681_100632582 | 249 |
| 302 | 3300025925 | Ga0207650_10207933 | Ga0207650_102079332 | 249 |
| 303 | 3300025926 | Ga0207659_10028796 | Ga0207659_100287963 | 249 |
| 304 | 3300025972 | Ga0207668_10105495 | Ga0207668_101054952 | 249 |
| 305 | 3300025986 | Ga0207658_10360477 | Ga0207658_103604772 | 249 |
| 306 | 3300026089 | Ga0207648_10364661 | Ga0207648_103646612 | 249 |
| 307 | 3300026118 | Ga0207675_100619853 | Ga0207675_1006198532 | 249 |
| 308 | 3300028379 | Ga0268266_10070034 | Ga0268266_100700342 | 249 |
| 309 | 3300041507 | Ga0451851_1081793 | Ga0451851_1081793_19_825 | 249 |
| 310 | iso_pu_bacteria | 8002869464 | 8002870159 | 249 |
| 311 | 3300005262 | Ga0065165_1003189 | Ga0065165_100318911 | 250 |
| 312 | 3300005331 | Ga0070670_100026051 | Ga0070670_1000260515 | 250 |
| 313 | 3300005339 | Ga0070660_100540062 | Ga0070660_1005400621 | 250 |
| 314 | 3300005344 | Ga0070661_100010169 | Ga0070661_1000101692 | 250 |
| 315 | 3300005563 | Ga0068855_100017679 | Ga0068855_1000176792 | 250 |
| 316 | 3300005578 | Ga0068854_100160310 | Ga0068854_1001603102 | 250 |
| 317 | 3300005614 | Ga0068856_100264635 | Ga0068856_1002646352 | 250 |
| 318 | 3300005616 | Ga0068852_100192627 | Ga0068852_1001926273 | 250 |
| 319 | 3300005719 | Ga0068861_100088337 | Ga0068861_1000883372 | 250 |
| 320 | 3300005841 | Ga0068863_100032649 | Ga0068863_1000326494 | 250 |
| 321 | 3300009011 | Ga0105251_10121771 | Ga0105251_101217712 | 250 |
| 322 | 3300009174 | Ga0105241_10035126 | Ga0105241_100351262 | 250 |
| 323 | 3300009545 | Ga0105237_10092651 | Ga0105237_100926512 | 250 |
| 324 | 3300009551 | Ga0105238_10005339 | Ga0105238_100053396 | 250 |
| 325 | 3300010375 | Ga0105239_10003023 | Ga0105239_1000302314 | 250 |
| 326 | 3300013104 | Ga0157370_10029183 | Ga0157370_100291836 | 250 |
| 327 | 3300013296 | Ga0157374_10386931 | Ga0157374_103869312 | 250 |
| 328 | 3300013307 | Ga0157372_10000819 | Ga0157372_1000081926 | 250 |
| 329 | 3300014968 | Ga0157379_10063497 | Ga0157379_100634974 | 250 |
| 330 | 3300020081 | Ga0206354_11034403 | Ga0206354_110344032 | 250 |
| 331 | 3300025913 | Ga0207695_10000393 | Ga0207695_1000039323 | 250 |
| 332 | 3300025914 | Ga0207671_10009835 | Ga0207671_100098355 | 250 |
| 333 | 3300025920 | Ga0207649_10051673 | Ga0207649_100516732 | 250 |
| 334 | 3300025924 | Ga0207694_10059542 | Ga0207694_100595422 | 250 |
| 335 | 3300025925 | Ga0207650_10049457 | Ga0207650_100494574 | 250 |
| 336 | 3300025949 | Ga0207667_10021057 | Ga0207667_100210572 | 250 |
| 337 | 3300026041 | Ga0207639_10000707 | Ga0207639_1000070712 | 250 |
| 338 | 3300026078 | Ga0207702_10481876 | Ga0207702_104818762 | 250 |
| 339 | 3300026088 | Ga0207641_10055413 | Ga0207641_100554135 | 250 |
| 340 | 3300026142 | Ga0207698_10207138 | Ga0207698_102071382 | 250 |
| 341 | 3300028380 | Ga0268265_10008941 | Ga0268265_100089414 | 250 |
| 342 | 3300031548 | Ga0307408_100004210 | Ga0307408_10000421010 | 250 |
| 343 | 3300031731 | Ga0307405_10029810 | Ga0307405_100298105 | 250 |
| 344 | 3300031852 | Ga0307410_10075979 | Ga0307410_100759792 | 250 |
| 345 | 3300031901 | Ga0307406_10008301 | Ga0307406_100083014 | 250 |
| 346 | 3300031903 | Ga0307407_10004929 | Ga0307407_100049294 | 250 |
| 347 | 3300031911 | Ga0307412_10091790 | Ga0307412_100917902 | 250 |
| 348 | 3300031995 | Ga0307409_100024545 | Ga0307409_1000245456 | 250 |
| 349 | 3300032002 | Ga0307416_100012737 | Ga0307416_1000127373 | 250 |
| 350 | 3300032005 | Ga0307411_10012698 | Ga0307411_100126982 | 250 |
| 351 | 3300032126 | Ga0307415_100001077 | Ga0307415_1000010774 | 250 |
| 352 | 3300038443 | Ga0395901_0015234 | Ga0395901_0015234_253_1044 | 250 |
| 353 | 3300041408 | Ga0439453_0005277 | Ga0439453_0005277_328_1098 | 250 |
| 354 | 3300041997 | Ga0439431_0096133 | Ga0439431_0096133_15_785 | 250 |
| 355 | 3300042003 | Ga0439443_010797 | Ga0439443_010797_481_1251 | 250 |
| 356 | 3300042133 | Ga0450896_002242 | Ga0450896_002242_1092_1862 | 250 |
| 357 | 3300042134 | Ga0450898_026334 | Ga0450898_026334_111_881 | 250 |
| 358 | 3300042156 | Ga0439446_0001503 | Ga0439446_0001503_595_1365 | 250 |
| 359 | 3300042184 | Ga0450908_001664 | Ga0450908_001664_2770_3540 | 250 |
| 360 | 3300042435 | Ga0439434_0002955 | Ga0439434_0002955_3097_3867 | 250 |
| 361 | 3300042436 | Ga0439435_0000148 | Ga0439435_0000148_8238_9008 | 250 |
| 362 | 3300042437 | Ga0439444_0000013 | Ga0439444_0000013_4969_5739 | 250 |
| 363 | 3300046472 | Ga0495580_0063827 | Ga0495580_0063827_536_1366 | 250 |
| 364 | 3300046615 | Ga0495656_0209541 | Ga0495656_0209541_91_855 | 250 |
| 365 | 3300046683 | Ga0495658_0137919 | Ga0495658_0137919_452_1282 | 250 |
| 366 | 3300048906 | Ga0496103_0016203 | Ga0496103_0016203_2812_3579 | 250 |
| 367 | 3300050496 | nmdc:mga07m45_4968_c1 | nmdc:mga07m45_4968_c1_5347_6150 | 250 |
| 368 | 3300053130 | Ga0500642_0052515 | Ga0500642_0052515_763_1557 | 250 |
| 369 | iso_pu_bacteria | 2571042365 | 2572253608 | 250 |
| 370 | iso_pu_bacteria | 2643221586 | 2643941256 | 250 |
| 371 | 3300009177 | Ga0105248_10009399 | Ga0105248_1000939910 | 251 |
| 372 | 3300025909 | Ga0207705_10059867 | Ga0207705_100598672 | 251 |
| 373 | 3300025919 | Ga0207657_10069966 | Ga0207657_100699663 | 251 |
| 374 | 3300025921 | Ga0207652_10643471 | Ga0207652_106434711 | 251 |
| 375 | 3300025941 | Ga0207711_10023415 | Ga0207711_100234153 | 251 |
| 376 | 3300025945 | Ga0207679_10366814 | Ga0207679_103668141 | 251 |
| 377 | 3300026078 | Ga0207702_10013708 | Ga0207702_100137084 | 251 |
| 378 | 3300026095 | Ga0207676_10122949 | Ga0207676_101229492 | 251 |
| 379 | 3300032004 | Ga0307414_10009513 | Ga0307414_100095135 | 251 |
| 380 | 3300041452 | Ga0451793_1438105 | Ga0451793_1438105_1916_2704 | 251 |
| 381 | 3300041453 | Ga0451797_0572638 | Ga0451797_0572638_331_1119 | 251 |
| 382 | 3300041486 | Ga0451807_0720322 | Ga0451807_0720322_3268_4056 | 251 |
| 383 | 3300041494 | Ga0451837_0074019 | Ga0451837_0074019_158_946 | 251 |
| 384 | 3300046615 | Ga0495656_0011107 | Ga0495656_0011107_1590_2378 | 251 |
| 385 | 3300047318 | Ga0495636_0024512 | Ga0495636_0024512_721_1509 | 251 |
| 386 | 3300048904 | Ga0496101_0122931 | Ga0496101_0122931_1057_1845 | 251 |
| 387 | 3300048907 | Ga0496104_0439809 | Ga0496104_0439809_125_934 | 251 |
| 388 | 3300048910 | Ga0496107_0097807 | Ga0496107_0097807_290_1078 | 251 |
| 389 | 3300048912 | Ga0496109_0703952 | Ga0496109_0703952_101_889 | 251 |
| 390 | 3300048916 | Ga0496113_0073437 | Ga0496113_0073437_1518_2306 | 251 |
| 391 | 3300048927 | Ga0496124_0254628 | Ga0496124_0254628_88_876 | 251 |
| 392 | 3300005329 | Ga0070683_100197012 | Ga0070683_1001970122 | 252 |
| 393 | 3300005331 | Ga0070670_100087124 | Ga0070670_1000871243 | 252 |
| 394 | 3300005333 | Ga0070677_10036912 | Ga0070677_100369122 | 252 |
| 395 | 3300025920 | Ga0207649_10432940 | Ga0207649_104329402 | 252 |
| 396 | 3300025944 | Ga0207661_10149050 | Ga0207661_101490502 | 252 |
| 397 | 3300026121 | Ga0207683_10077599 | Ga0207683_100775992 | 252 |
| 398 | 3300031548 | Ga0307408_100233454 | Ga0307408_1002334542 | 252 |
| 399 | 3300031824 | Ga0307413_10536888 | Ga0307413_105368882 | 252 |
| 400 | 3300032004 | Ga0307414_10013206 | Ga0307414_100132063 | 252 |
| 401 | 3300041451 | Ga0451791_1002939 | Ga0451791_1002939_524_1291 | 252 |
| 402 | 3300041453 | Ga0451797_0531083 | Ga0451797_0531083_989_1756 | 252 |
| 403 | 3300041460 | Ga0451802_2089645 | Ga0451802_2089645_918_1685 | 252 |
| 404 | 3300041486 | Ga0451807_0034953 | Ga0451807_0034953_820_1587 | 252 |
| 405 | 3300041486 | Ga0451807_2299026 | Ga0451807_2299026_467_1240 | 252 |
| 406 | 3300041494 | Ga0451837_0154854 | Ga0451837_0154854_3304_4071 | 252 |
| 407 | 3300041509 | Ga0451843_0906883 | Ga0451843_0906883_425_1192 | 252 |
| 408 | 3300042993 | Ga0439440_0010489 | Ga0439440_0010489_590_1369 | 252 |
| 409 | 3300049823 | Ga0501044_0523323 | Ga0501044_0523323_104_898 | 252 |
| 410 | 3300005330 | Ga0070690_100360797 | Ga0070690_1003607972 | 253 |
| 411 | 3300005354 | Ga0070675_100500252 | Ga0070675_1005002521 | 253 |
| 412 | 3300005539 | Ga0068853_100228867 | Ga0068853_1002288672 | 253 |
| 413 | 3300005543 | Ga0070672_100160355 | Ga0070672_1001603551 | 253 |
| 414 | 3300009551 | Ga0105238_10111709 | Ga0105238_101117093 | 253 |
| 415 | 3300025926 | Ga0207659_10485655 | Ga0207659_104856552 | 253 |
| 416 | 3300025940 | Ga0207691_10011066 | Ga0207691_100110666 | 253 |
| 417 | 3300027360 | Ga0209969_1003420 | Ga0209969_10034202 | 253 |
| 418 | 3300027471 | Ga0209995_1001196 | Ga0209995_10011964 | 253 |
| 419 | 3300027543 | Ga0209999_1001155 | Ga0209999_10011553 | 253 |
| 420 | 3300027552 | Ga0209982_1007820 | Ga0209982_10078201 | 253 |
| 421 | 3300027614 | Ga0209970_1006128 | Ga0209970_10061282 | 253 |
| 422 | 3300027682 | Ga0209971_1000369 | Ga0209971_100036912 | 253 |
| 423 | 3300027876 | Ga0209974_10031131 | Ga0209974_100311311 | 253 |
| 424 | 3300032002 | Ga0307416_100152973 | Ga0307416_1001529732 | 253 |
| 425 | 3300032004 | Ga0307414_10038848 | Ga0307414_100388484 | 253 |
| 426 | 3300032004 | Ga0307414_10143286 | Ga0307414_101432863 | 253 |
| 427 | 3300032004 | Ga0307414_10695192 | Ga0307414_106951922 | 253 |
| 428 | 3300032005 | Ga0307411_10406493 | Ga0307411_104064932 | 253 |
| 429 | 3300041413 | Ga0439465_0016461 | Ga0439465_0016461_463_1239 | 253 |
| 430 | 3300041494 | Ga0451837_0692191 | Ga0451837_0692191_1172_1942 | 253 |
| 431 | 3300041509 | Ga0451843_0190080 | Ga0451843_0190080_2409_3179 | 253 |
| 432 | 3300046537 | Ga0495598_0000828 | Ga0495598_0000828_1156_1926 | 253 |
| 433 | 3300046615 | Ga0495656_0064915 | Ga0495656_0064915_760_1533 | 253 |
| 434 | 3300046664 | Ga0495659_0032880 | Ga0495659_0032880_338_1111 | 253 |
| 435 | 3300046691 | Ga0495670_0270838 | Ga0495670_0270838_37_798 | 253 |
| 436 | 3300047318 | Ga0495636_0001496 | Ga0495636_0001496_7407_8180 | 253 |
| 437 | 3300003320 | rootH2_10233592 | rootH2_102335921 | 254 |
| 438 | 3300005347 | Ga0070668_100008286 | Ga0070668_1000082868 | 254 |
| 439 | 3300005367 | Ga0070667_100043777 | Ga0070667_1000437774 | 254 |
| 440 | 3300005440 | Ga0070705_100083324 | Ga0070705_1000833243 | 254 |
| 441 | 3300005456 | Ga0070678_100134707 | Ga0070678_1001347072 | 254 |
| 442 | 3300005459 | Ga0068867_100071423 | Ga0068867_1000714233 | 254 |
| 443 | 3300005617 | Ga0068859_100000776 | Ga0068859_10000077617 | 254 |
| 444 | 3300005834 | Ga0068851_10060285 | Ga0068851_100602852 | 254 |
| 445 | 3300005841 | Ga0068863_100176168 | Ga0068863_1001761682 | 254 |
| 446 | 3300005843 | Ga0068860_100020846 | Ga0068860_1000208466 | 254 |
| 447 | 3300005844 | Ga0068862_100099071 | Ga0068862_1000990712 | 254 |
| 448 | 3300006931 | Ga0097620_100000776 | Ga0097620_10000077617 | 254 |
| 449 | 3300009176 | Ga0105242_10042998 | Ga0105242_100429982 | 254 |
| 450 | 3300009177 | Ga0105248_10148113 | Ga0105248_101481132 | 254 |
| 451 | 3300009979 | Ga0105032_100445 | Ga0105032_1004452 | 254 |
| 452 | 3300012512 | Ga0157327_1000667 | Ga0157327_10006672 | 254 |
| 453 | 3300014326 | Ga0157380_10062017 | Ga0157380_100620173 | 254 |
| 454 | 3300014968 | Ga0157379_10076628 | Ga0157379_100766284 | 254 |
| 455 | 3300025931 | Ga0207644_10158889 | Ga0207644_101588893 | 254 |
| 456 | 3300025933 | Ga0207706_10161558 | Ga0207706_101615582 | 254 |
| 457 | 3300025941 | Ga0207711_10212968 | Ga0207711_102129682 | 254 |
| 458 | 3300025972 | Ga0207668_10005000 | Ga0207668_100050006 | 254 |
| 459 | 3300025986 | Ga0207658_10252610 | Ga0207658_102526102 | 254 |
| 460 | 3300026089 | Ga0207648_10088816 | Ga0207648_100888163 | 254 |
| 461 | 3300026118 | Ga0207675_100388152 | Ga0207675_1003881522 | 254 |
| 462 | 3300026121 | Ga0207683_10010465 | Ga0207683_100104652 | 254 |
| 463 | 3300028379 | Ga0268266_10063379 | Ga0268266_100633792 | 254 |
| 464 | 3300031456 | Ga0307513_10138369 | Ga0307513_101383692 | 254 |
| 465 | 3300031548 | Ga0307408_100441028 | Ga0307408_1004410282 | 254 |
| 466 | 3300031548 | Ga0307408_100536294 | Ga0307408_1005362942 | 254 |
| 467 | 3300031852 | Ga0307410_10057177 | Ga0307410_100571773 | 254 |
| 468 | 3300031901 | Ga0307406_10391676 | Ga0307406_103916762 | 254 |
| 469 | 3300031911 | Ga0307412_10121164 | Ga0307412_101211642 | 254 |
| 470 | 3300031911 | Ga0307412_10168796 | Ga0307412_101687962 | 254 |
| 471 | 3300031911 | Ga0307412_10413563 | Ga0307412_104135632 | 254 |
| 472 | 3300031995 | Ga0307409_100175759 | Ga0307409_1001757591 | 254 |
| 473 | 3300031995 | Ga0307409_100758402 | Ga0307409_1007584022 | 254 |
| 474 | 3300032002 | Ga0307416_101119200 | Ga0307416_1011192001 | 254 |
| 475 | 3300032005 | Ga0307411_10016663 | Ga0307411_100166634 | 254 |
| 476 | 3300041494 | Ga0451837_0205854 | Ga0451837_0205854_1220_1993 | 254 |
| 477 | 3300042006 | Ga0439432_061071 | Ga0439432_061071_190_966 | 254 |
| 478 | 3300046525 | Ga0495663_0016213 | Ga0495663_0016213_465_1253 | 254 |
| 479 | 3300046539 | Ga0495621_0000271 | Ga0495621_0000271_86_880 | 254 |
| 480 | 3300046558 | Ga0495633_0110071 | Ga0495633_0110071_375_1169 | 254 |
| 481 | 3300048911 | Ga0496108_0185991 | Ga0496108_0185991_148_936 | 254 |
| 482 | 3300048913 | Ga0496110_0127916 | Ga0496110_0127916_1229_2017 | 254 |
| 483 | 3300048914 | Ga0496111_0208339 | Ga0496111_0208339_85_873 | 254 |
| 484 | 3300049705 | Ga0501225_0028958 | Ga0501225_0028958_597_1373 | 254 |
| 485 | 3300005331 | Ga0070670_100009164 | Ga0070670_1000091647 | 255 |
| 486 | 3300005338 | Ga0068868_100482202 | Ga0068868_1004822021 | 255 |
| 487 | 3300005343 | Ga0070687_100040405 | Ga0070687_1000404053 | 255 |
| 488 | 3300005353 | Ga0070669_100027042 | Ga0070669_1000270422 | 255 |
| 489 | 3300005354 | Ga0070675_100098599 | Ga0070675_1000985992 | 255 |
| 490 | 3300005545 | Ga0070695_100153380 | Ga0070695_1001533802 | 255 |
| 491 | 3300005842 | Ga0068858_100067440 | Ga0068858_1000674403 | 255 |
| 492 | 3300009148 | Ga0105243_10071783 | Ga0105243_100717832 | 255 |
| 493 | 3300014326 | Ga0157380_10137847 | Ga0157380_101378472 | 255 |
| 494 | 3300025926 | Ga0207659_10112883 | Ga0207659_101128832 | 255 |
| 495 | 3300025935 | Ga0207709_10127947 | Ga0207709_101279472 | 255 |
| 496 | 3300025940 | Ga0207691_10098906 | Ga0207691_100989062 | 255 |
| 497 | 3300026095 | Ga0207676_10189588 | Ga0207676_101895882 | 255 |
| 498 | 3300026118 | Ga0207675_100108512 | Ga0207675_1001085123 | 255 |
| 499 | 3300028380 | Ga0268265_10029219 | Ga0268265_100292193 | 255 |
| 500 | 3300028381 | Ga0268264_10063478 | Ga0268264_100634782 | 255 |
| 501 | 3300031824 | Ga0307413_10000876 | Ga0307413_100008768 | 255 |
| 502 | 3300031903 | Ga0307407_10095458 | Ga0307407_100954582 | 255 |
| 503 | 3300032002 | Ga0307416_100088403 | Ga0307416_1000884033 | 255 |
| 504 | 3300041997 | Ga0439431_0035802 | Ga0439431_0035802_395_1183 | 255 |
| 505 | 3300044712 | Ga0453684_0002611 | Ga0453684_0002611_2615_3400 | 255 |
| 506 | 3300045051 | Ga0451576_0000042 | Ga0451576_0000042_168666_169451 | 255 |
| 507 | 3300002074 | JGI24748J21848_1002862 | JGI24748J21848_10028623 | 256 |
| 508 | 3300005290 | Ga0065712_10088811 | Ga0065712_100888112 | 256 |
| 509 | 3300005293 | Ga0065715_10102977 | Ga0065715_101029772 | 256 |
| 510 | 3300005328 | Ga0070676_10040815 | Ga0070676_100408152 | 256 |
| 511 | 3300005328 | Ga0070676_10260102 | Ga0070676_102601022 | 256 |
| 512 | 3300005329 | Ga0070683_100025851 | Ga0070683_1000258512 | 256 |
| 513 | 3300005330 | Ga0070690_100015015 | Ga0070690_1000150155 | 256 |
| 514 | 3300005330 | Ga0070690_100115459 | Ga0070690_1001154592 | 256 |
| 515 | 3300005331 | Ga0070670_100002614 | Ga0070670_1000026143 | 256 |
| 516 | 3300005331 | Ga0070670_100080610 | Ga0070670_1000806102 | 256 |
| 517 | 3300005333 | Ga0070677_10004837 | Ga0070677_100048374 | 256 |
| 518 | 3300005334 | Ga0068869_100001806 | Ga0068869_1000018065 | 256 |
| 519 | 3300005334 | Ga0068869_100002842 | Ga0068869_1000028427 | 256 |
| 520 | 3300005335 | Ga0070666_10024486 | Ga0070666_100244863 | 256 |
| 521 | 3300005338 | Ga0068868_100340508 | Ga0068868_1003405082 | 256 |
| 522 | 3300005338 | Ga0068868_100424659 | Ga0068868_1004246592 | 256 |
| 523 | 3300005339 | Ga0070660_100137406 | Ga0070660_1001374062 | 256 |
| 524 | 3300005340 | Ga0070689_100008018 | Ga0070689_1000080182 | 256 |
| 525 | 3300005343 | Ga0070687_100001711 | Ga0070687_1000017112 | 256 |
| 526 | 3300005343 | Ga0070687_100157953 | Ga0070687_1001579532 | 256 |
| 527 | 3300005344 | Ga0070661_100016872 | Ga0070661_1000168724 | 256 |
| 528 | 3300005353 | Ga0070669_100010212 | Ga0070669_1000102126 | 256 |
| 529 | 3300005353 | Ga0070669_100043416 | Ga0070669_1000434164 | 256 |
| 530 | 3300005354 | Ga0070675_100435209 | Ga0070675_1004352092 | 256 |
| 531 | 3300005355 | Ga0070671_100439103 | Ga0070671_1004391032 | 256 |
| 532 | 3300005356 | Ga0070674_100017689 | Ga0070674_1000176894 | 256 |
| 533 | 3300005364 | Ga0070673_100055743 | Ga0070673_1000557432 | 256 |
| 534 | 3300005366 | Ga0070659_100364430 | Ga0070659_1003644302 | 256 |
| 535 | 3300005367 | Ga0070667_100003163 | Ga0070667_10000316312 | 256 |
| 536 | 3300005438 | Ga0070701_10007331 | Ga0070701_100073315 | 256 |
| 537 | 3300005441 | Ga0070700_100012120 | Ga0070700_1000121205 | 256 |
| 538 | 3300005455 | Ga0070663_100036767 | Ga0070663_1000367674 | 256 |
| 539 | 3300005456 | Ga0070678_100039202 | Ga0070678_1000392023 | 256 |
| 540 | 3300005456 | Ga0070678_100216465 | Ga0070678_1002164652 | 256 |
| 541 | 3300005457 | Ga0070662_100011591 | Ga0070662_1000115915 | 256 |
| 542 | 3300005459 | Ga0068867_100014646 | Ga0068867_1000146468 | 256 |
| 543 | 3300005459 | Ga0068867_100060893 | Ga0068867_1000608934 | 256 |
| 544 | 3300005466 | Ga0070685_10004729 | Ga0070685_100047294 | 256 |
| 545 | 3300005535 | Ga0070684_100034625 | Ga0070684_1000346252 | 256 |
| 546 | 3300005539 | Ga0068853_100151009 | Ga0068853_1001510092 | 256 |
| 547 | 3300005543 | Ga0070672_100015758 | Ga0070672_1000157584 | 256 |
| 548 | 3300005543 | Ga0070672_100296881 | Ga0070672_1002968812 | 256 |
| 549 | 3300005544 | Ga0070686_100244428 | Ga0070686_1002444282 | 256 |
| 550 | 3300005548 | Ga0070665_100262431 | Ga0070665_1002624311 | 256 |
| 551 | 3300005563 | Ga0068855_100244969 | Ga0068855_1002449692 | 256 |
| 552 | 3300005564 | Ga0070664_100229845 | Ga0070664_1002298451 | 256 |
| 553 | 3300005577 | Ga0068857_100026365 | Ga0068857_1000263653 | 256 |
| 554 | 3300005577 | Ga0068857_100041636 | Ga0068857_1000416364 | 256 |
| 555 | 3300005614 | Ga0068856_100092087 | Ga0068856_1000920872 | 256 |
| 556 | 3300005615 | Ga0070702_100004798 | Ga0070702_1000047984 | 256 |
| 557 | 3300005615 | Ga0070702_100051557 | Ga0070702_1000515573 | 256 |
| 558 | 3300005617 | Ga0068859_100001589 | Ga0068859_1000015892 | 256 |
| 559 | 3300005617 | Ga0068859_100034355 | Ga0068859_1000343554 | 256 |
| 560 | 3300005618 | Ga0068864_100002477 | Ga0068864_1000024775 | 256 |
| 561 | 3300005718 | Ga0068866_10003270 | Ga0068866_100032703 | 256 |
| 562 | 3300005719 | Ga0068861_100004069 | Ga0068861_1000040692 | 256 |
| 563 | 3300005719 | Ga0068861_100011595 | Ga0068861_1000115954 | 256 |
| 564 | 3300005834 | Ga0068851_10006652 | Ga0068851_100066522 | 256 |
| 565 | 3300005840 | Ga0068870_10007244 | Ga0068870_100072444 | 256 |
| 566 | 3300005840 | Ga0068870_10012938 | Ga0068870_100129382 | 256 |
| 567 | 3300005840 | Ga0068870_10055645 | Ga0068870_100556453 | 256 |
| 568 | 3300005841 | Ga0068863_100020088 | Ga0068863_1000200889 | 256 |
| 569 | 3300005841 | Ga0068863_100027507 | Ga0068863_1000275073 | 256 |
| 570 | 3300005841 | Ga0068863_100150402 | Ga0068863_1001504021 | 256 |
| 571 | 3300005842 | Ga0068858_100023672 | Ga0068858_1000236724 | 256 |
| 572 | 3300005842 | Ga0068858_100047410 | Ga0068858_1000474102 | 256 |
| 573 | 3300005843 | Ga0068860_100003196 | Ga0068860_1000031968 | 256 |
| 574 | 3300005843 | Ga0068860_100018088 | Ga0068860_1000180885 | 256 |
| 575 | 3300005844 | Ga0068862_100042009 | Ga0068862_1000420096 | 256 |
| 576 | 3300005844 | Ga0068862_100062463 | Ga0068862_1000624634 | 256 |
| 577 | 3300005844 | Ga0068862_100118337 | Ga0068862_1001183371 | 256 |
| 578 | 3300006237 | Ga0097621_100121296 | Ga0097621_1001212963 | 256 |
| 579 | 3300006237 | Ga0097621_100164075 | Ga0097621_1001640753 | 256 |
| 580 | 3300006358 | Ga0068871_100067442 | Ga0068871_1000674423 | 256 |
| 581 | 3300006358 | Ga0068871_100586657 | Ga0068871_1005866572 | 256 |
| 582 | 3300006881 | Ga0068865_100044512 | Ga0068865_1000445122 | 256 |
| 583 | 3300006931 | Ga0097620_100001589 | Ga0097620_1000015892 | 256 |
| 584 | 3300006931 | Ga0097620_100034354 | Ga0097620_1000343543 | 256 |
| 585 | 3300009094 | Ga0111539_10027664 | Ga0111539_100276645 | 256 |
| 586 | 3300009098 | Ga0105245_10940961 | Ga0105245_109409611 | 256 |
| 587 | 3300009101 | Ga0105247_10031046 | Ga0105247_100310461 | 256 |
| 588 | 3300009148 | Ga0105243_10067659 | Ga0105243_100676593 | 256 |
| 589 | 3300009177 | Ga0105248_10003392 | Ga0105248_100033924 | 256 |
| 590 | 3300009553 | Ga0105249_10028167 | Ga0105249_100281674 | 256 |
| 591 | 3300011119 | Ga0105246_10014664 | Ga0105246_100146642 | 256 |
| 592 | 3300013296 | Ga0157374_10169624 | Ga0157374_101696242 | 256 |
| 593 | 3300013297 | Ga0157378_10025796 | Ga0157378_100257963 | 256 |
| 594 | 3300013297 | Ga0157378_10179787 | Ga0157378_101797871 | 256 |
| 595 | 3300013306 | Ga0163162_10061859 | Ga0163162_100618594 | 256 |
| 596 | 3300013308 | Ga0157375_10095250 | Ga0157375_100952504 | 256 |
| 597 | 3300014325 | Ga0163163_10009155 | Ga0163163_100091554 | 256 |
| 598 | 3300014325 | Ga0163163_10028200 | Ga0163163_100282002 | 256 |
| 599 | 3300014326 | Ga0157380_10029238 | Ga0157380_100292384 | 256 |
| 600 | 3300014745 | Ga0157377_10007567 | Ga0157377_100075674 | 256 |
| 601 | 3300014968 | Ga0157379_10004427 | Ga0157379_100044274 | 256 |
| 602 | 3300014968 | Ga0157379_10061419 | Ga0157379_100614192 | 256 |
| 603 | 3300025271 | Ga0207666_1000950 | Ga0207666_10009504 | 256 |
| 604 | 3300025315 | Ga0207697_10001006 | Ga0207697_1000100615 | 256 |
| 605 | 3300025893 | Ga0207682_10001109 | Ga0207682_100011098 | 256 |
| 606 | 3300025899 | Ga0207642_10035094 | Ga0207642_100350943 | 256 |
| 607 | 3300025901 | Ga0207688_10003400 | Ga0207688_100034007 | 256 |
| 608 | 3300025903 | Ga0207680_10132317 | Ga0207680_101323172 | 256 |
| 609 | 3300025907 | Ga0207645_10314687 | Ga0207645_103146872 | 256 |
| 610 | 3300025908 | Ga0207643_10005604 | Ga0207643_100056046 | 256 |
| 611 | 3300025908 | Ga0207643_10008853 | Ga0207643_100088535 | 256 |
| 612 | 3300025908 | Ga0207643_10009803 | Ga0207643_100098033 | 256 |
| 613 | 3300025918 | Ga0207662_10003299 | Ga0207662_100032997 | 256 |
| 614 | 3300025918 | Ga0207662_10070967 | Ga0207662_100709672 | 256 |
| 615 | 3300025919 | Ga0207657_10005814 | Ga0207657_100058146 | 256 |
| 616 | 3300025923 | Ga0207681_10009555 | Ga0207681_100095557 | 256 |
| 617 | 3300025923 | Ga0207681_10033643 | Ga0207681_100336432 | 256 |
| 618 | 3300025923 | Ga0207681_10059392 | Ga0207681_100593922 | 256 |
| 619 | 3300025925 | Ga0207650_10007995 | Ga0207650_100079954 | 256 |
| 620 | 3300025925 | Ga0207650_10023808 | Ga0207650_100238084 | 256 |
| 621 | 3300025926 | Ga0207659_10032629 | Ga0207659_100326292 | 256 |
| 622 | 3300025931 | Ga0207644_10014629 | Ga0207644_100146294 | 256 |
| 623 | 3300025931 | Ga0207644_10343835 | Ga0207644_103438352 | 256 |
| 624 | 3300025933 | Ga0207706_10005220 | Ga0207706_100052205 | 256 |
| 625 | 3300025935 | Ga0207709_10015946 | Ga0207709_100159464 | 256 |
| 626 | 3300025936 | Ga0207670_10060810 | Ga0207670_100608104 | 256 |
| 627 | 3300025937 | Ga0207669_10021717 | Ga0207669_100217174 | 256 |
| 628 | 3300025940 | Ga0207691_10018633 | Ga0207691_100186334 | 256 |
| 629 | 3300025940 | Ga0207691_10303503 | Ga0207691_103035032 | 256 |
| 630 | 3300025941 | Ga0207711_10011042 | Ga0207711_100110423 | 256 |
| 631 | 3300025942 | Ga0207689_10004356 | Ga0207689_100043565 | 256 |
| 632 | 3300025942 | Ga0207689_10004366 | Ga0207689_1000436613 | 256 |
| 633 | 3300025960 | Ga0207651_10016899 | Ga0207651_100168993 | 256 |
| 634 | 3300025961 | Ga0207712_10106353 | Ga0207712_101063533 | 256 |
| 635 | 3300025972 | Ga0207668_10064389 | Ga0207668_100643892 | 256 |
| 636 | 3300025986 | Ga0207658_10007612 | Ga0207658_100076125 | 256 |
| 637 | 3300026023 | Ga0207677_10070361 | Ga0207677_100703612 | 256 |
| 638 | 3300026023 | Ga0207677_10100221 | Ga0207677_101002212 | 256 |
| 639 | 3300026035 | Ga0207703_10004627 | Ga0207703_1000462711 | 256 |
| 640 | 3300026035 | Ga0207703_10032798 | Ga0207703_100327984 | 256 |
| 641 | 3300026041 | Ga0207639_10106777 | Ga0207639_101067772 | 256 |
| 642 | 3300026067 | Ga0207678_10032358 | Ga0207678_100323585 | 256 |
| 643 | 3300026075 | Ga0207708_10003088 | Ga0207708_100030888 | 256 |
| 644 | 3300026078 | Ga0207702_10354488 | Ga0207702_103544882 | 256 |
| 645 | 3300026088 | Ga0207641_10057327 | Ga0207641_100573273 | 256 |
| 646 | 3300026089 | Ga0207648_10015262 | Ga0207648_100152624 | 256 |
| 647 | 3300026095 | Ga0207676_10023223 | Ga0207676_100232234 | 256 |
| 648 | 3300026095 | Ga0207676_10026809 | Ga0207676_100268094 | 256 |
| 649 | 3300026116 | Ga0207674_10005202 | Ga0207674_100052025 | 256 |
| 650 | 3300026116 | Ga0207674_10034188 | Ga0207674_100341887 | 256 |
| 651 | 3300026118 | Ga0207675_100006423 | Ga0207675_10000642314 | 256 |
| 652 | 3300026118 | Ga0207675_100007214 | Ga0207675_1000072147 | 256 |
| 653 | 3300026121 | Ga0207683_10102674 | Ga0207683_101026743 | 256 |
| 654 | 3300026121 | Ga0207683_10161436 | Ga0207683_101614362 | 256 |
| 655 | 3300026142 | Ga0207698_10045861 | Ga0207698_100458612 | 256 |
| 656 | 3300028379 | Ga0268266_10264261 | Ga0268266_102642612 | 256 |
| 657 | 3300028380 | Ga0268265_10025546 | Ga0268265_100255466 | 256 |
| 658 | 3300028380 | Ga0268265_10028035 | Ga0268265_100280354 | 256 |
| 659 | 3300028380 | Ga0268265_10154826 | Ga0268265_101548262 | 256 |
| 660 | 3300028381 | Ga0268264_10002324 | Ga0268264_1000232412 | 256 |
| 661 | 3300028381 | Ga0268264_10741048 | Ga0268264_107410482 | 256 |
| 662 | 3300035170 | Ga0373943_0167539 | Ga0373943_0167539_74_844 | 256 |
| 663 | 3300035171 | Ga0373946_0053028 | Ga0373946_0053028_124_894 | 256 |
| 664 | 3300035725 | Ga0373947_0082224 | Ga0373947_0082224_454_1224 | 256 |
| 665 | 3300046537 | Ga0495598_0025574 | Ga0495598_0025574_132_902 | 256 |
| 666 | 3300048903 | Ga0496100_0123979 | Ga0496100_0123979_857_1627 | 256 |
| 667 | 3300048904 | Ga0496101_0031890 | Ga0496101_0031890_1034_1804 | 256 |
| 668 | 3300048905 | Ga0496102_0156312 | Ga0496102_0156312_903_1673 | 256 |
| 669 | 3300048907 | Ga0496104_0112629 | Ga0496104_0112629_669_1439 | 256 |
| 670 | 3300048908 | Ga0496105_0387104 | Ga0496105_0387104_179_949 | 256 |
| 671 | 3300048909 | Ga0496106_0047660 | Ga0496106_0047660_1983_2753 | 256 |
| 672 | 3300048909 | Ga0496106_0283314 | Ga0496106_0283314_102_872 | 256 |
| 673 | 3300048910 | Ga0496107_0043602 | Ga0496107_0043602_903_1673 | 256 |
| 674 | 3300048911 | Ga0496108_0016568 | Ga0496108_0016568_3351_4121 | 256 |
| 675 | 3300048912 | Ga0496109_0031279 | Ga0496109_0031279_819_1589 | 256 |
| 676 | 3300048913 | Ga0496110_0016522 | Ga0496110_0016522_1814_2584 | 256 |
| 677 | 3300048916 | Ga0496113_0158950 | Ga0496113_0158950_412_1182 | 256 |
| 678 | 3300048917 | Ga0496114_0055839 | Ga0496114_0055839_1545_2315 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pf5-assembly5.cif.gz_E | crystal structure of the human tsg-6 link module | 0.7966 | 109 | 134 |
| 2pf5-assembly3.cif.gz_C | crystal structure of the human tsg-6 link module | 0.7463 | 108 | 139 |
| 2pf5-assembly2.cif.gz_B | crystal structure of the human tsg-6 link module | 0.734 | 108 | 139 |
| 2i83-assembly1.cif.gz_A | hyaluronan-binding domain of cd44 in its ligand-bound form | 0.7335 | 106 | 140 |
| 2pf5-assembly4.cif.gz_D | crystal structure of the human tsg-6 link module | 0.7324 | 108 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QLT6_37_131_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.815 | 105 | 134 | 3.10.100.10 |
| af_Q8R4U0_2206_2297_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.8001 | 106 | 134 | 3.10.100.10 |
| af_A8WFK8_153_292_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7876 | 103 | 126 | 3.10.100.10 |
| af_A0A2R8RJD1_252_376_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7467 | 109 | 131 | 3.10.100.10 |
| af_D4A3B8_261_389_3.10.100.10 | Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A | 0.7412 | 109 | 133 | 3.10.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4MCI1-F1-model_v4 | Sulfatase-modifying factor enzyme domain-containing protein | 0.9348 | 24 | 253 |
GO:0120147
|
| AF-A0A401K024-F1-model_v4 | Probable signal peptide protein | 0.9327 | 23 | 206 |
GO:0120147
|
| AF-A0A350EQC3-F1-model_v4 | Sulfatase-modifying factor enzyme domain-containing protein | 0.9304 | 24 | 171 |
GO:0120147
|
| AF-A0A2W4MCI1-F1-model_v4 | Sulfatase-modifying factor enzyme domain-containing protein | 0.9269 | 24 | 253 |
GO:0120147
|
| AF-A0A350EQC3-F1-model_v4 | Sulfatase-modifying factor enzyme domain-containing protein | 0.9185 | 24 | 171 |
GO:0120147
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar