F474671

General Info

Members Datasets Scaffolds Average Seq Length
678 293 665 256

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0063827|Ga0495580_0063827_536_1366
Length 276
Sequence MLGKGPGPETRRPKPGRTGAARACGATLLACSLAAPGAEYVDVPAGTITSALAGDADTTPTPVAAFALREMPVTQGEFLRFVAAHPEWRRDRVPGVFADAGYLRSWRSPVALADDAEERAPVTDVSWFAAQAFCESEGSRLPTWLEWEYVAAADAERRDARNDPAWLARILGWYARPASDPLPEVGGAPNAYGVRDLHGVVWEWVDDFTALLVEGDSRTGNDPDKLKFCGAGAINLQDRDNYAVLMRIALLSSLNAADSTGSLGFRCARPQFTEAP

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221656 Pelomonas sp. Root405 Isolate Unclassified
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
219 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
226 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.15
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 5.31
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1002862 3300002074 Bacteria 1966
2 rootH2_10233592 3300003320 Bacteria 1135
3 Ga0055538_1000050 3300003751 Bacteria 130812
4 Ga0055539_1000074 3300003752 Bacteria 130812
5 Ga0055539_1000116 3300003752 Bacteria 88977
6 Ga0055533_1000016 3300003756 Bacteria 396179
7 Ga0055533_1000081 3300003756 Bacteria 130812
8 Ga0055525_1000108 3300003759 Bacteria 130812
9 Ga0055525_1000955 3300003759 Bacteria 7917
10 Ga0055531_10000064 3300003794 Bacteria 117923
11 Ga0055541_1000052 3300003841 Bacteria 130812
12 Ga0065165_1003189 3300005262 Bacteria 12005
13 Ga0065712_10088811 3300005290 Bacteria 2501
14 Ga0065715_10102977 3300005293 Bacteria 3070
15 Ga0070676_10002044 3300005328 Bacteria 10256
16 Ga0070676_10040815 3300005328 Bacteria 2689
17 Ga0070676_10064471 3300005328 Bacteria 2185
18 Ga0070676_10260102 3300005328 Bacteria 1162
19 Ga0070683_100025851 3300005329 Bacteria 5280
20 Ga0070683_100197012 3300005329 Bacteria 1913
21 Ga0070690_100015015 3300005330 Bacteria 4609
22 Ga0070690_100115459 3300005330 Bacteria 1796
23 Ga0070690_100360797 3300005330 Bacteria 1057
24 Ga0070670_100002614 3300005331 Bacteria 14885
25 Ga0070670_100003776 3300005331 Bacteria 12608
26 Ga0070670_100009164 3300005331 Bacteria 8459
27 Ga0070670_100026051 3300005331 Bacteria 5032
28 Ga0070670_100032014 3300005331 Bacteria 4528
29 Ga0070670_100055955 3300005331 Bacteria 3385
30 Ga0070670_100080610 3300005331 Bacteria 2797
31 Ga0070670_100087124 3300005331 Bacteria 2683
32 Ga0070670_100105022 3300005331 Bacteria 2433
33 Ga0070670_100167191 3300005331 Bacteria 1907
34 Ga0070670_100196559 3300005331 Bacteria 1752
35 Ga0070670_100301718 3300005331 Bacteria 1401
36 Ga0070677_10004837 3300005333 Bacteria 4419
37 Ga0070677_10036912 3300005333 Bacteria 1904
38 Ga0070677_10037664 3300005333 Bacteria 1888
39 Ga0068869_100001806 3300005334 Bacteria 12848
40 Ga0068869_100002842 3300005334 Bacteria 10491
41 Ga0068869_100007068 3300005334 Bacteria 7147
42 Ga0068869_100011109 3300005334 Bacteria 5899
43 Ga0068869_100174295 3300005334 Bacteria 1682
44 Ga0070666_10024486 3300005335 Bacteria 3932
45 Ga0070666_10085797 3300005335 Bacteria 2157
46 Ga0068868_100069917 3300005338 Bacteria 2798
47 Ga0068868_100340508 3300005338 Bacteria 1282
48 Ga0068868_100424659 3300005338 Bacteria 1151
49 Ga0068868_100459369 3300005338 Bacteria 1109
50 Ga0068868_100482202 3300005338 Bacteria 1083
51 Ga0070660_100137406 3300005339 Bacteria 1959
52 Ga0070660_100540062 3300005339 Bacteria 972
53 Ga0070689_100008018 3300005340 Bacteria 7413
54 Ga0070689_100470701 3300005340 Bacteria 1072
55 Ga0070687_100001711 3300005343 Bacteria 7877
56 Ga0070687_100040405 3300005343 Bacteria 2350
57 Ga0070687_100157953 3300005343 Bacteria 1338
58 Ga0070661_100010169 3300005344 Bacteria 6535
59 Ga0070661_100016872 3300005344 Bacteria 5169
60 Ga0070668_100008000 3300005347 Bacteria 7854
61 Ga0070668_100008286 3300005347 Bacteria 7714
62 Ga0070668_100093306 3300005347 Bacteria 2375
63 Ga0070668_100121787 3300005347 Bacteria 2086
64 Ga0070669_100010212 3300005353 Bacteria 6671
65 Ga0070669_100010333 3300005353 Bacteria 6629
66 Ga0070669_100027042 3300005353 Bacteria 4128
67 Ga0070669_100043416 3300005353 Bacteria 3274
68 Ga0070669_100072979 3300005353 Bacteria 2542
69 Ga0070675_100098599 3300005354 Bacteria 2458
70 Ga0070675_100174687 3300005354 Bacteria 1854
71 Ga0070675_100213041 3300005354 Bacteria 1680
72 Ga0070675_100435209 3300005354 Bacteria 1174
73 Ga0070675_100500252 3300005354 Bacteria 1095
74 Ga0070671_100002319 3300005355 Bacteria 14699
75 Ga0070671_100102271 3300005355 Bacteria 2404
76 Ga0070671_100137059 3300005355 Bacteria 2063
77 Ga0070671_100150215 3300005355 Bacteria 1967
78 Ga0070671_100231835 3300005355 Bacteria 1567
79 Ga0070671_100439103 3300005355 Bacteria 1119
80 Ga0070674_100017689 3300005356 Bacteria 4491
81 Ga0070674_100095866 3300005356 Bacteria 2151
82 Ga0070673_100055743 3300005364 Bacteria 3115
83 Ga0070673_100058680 3300005364 Bacteria 3043
84 Ga0070688_100039876 3300005365 Bacteria 2876
85 Ga0070688_100171686 3300005365 Bacteria 1497
86 Ga0070659_100292580 3300005366 Bacteria 1356
87 Ga0070659_100364430 3300005366 Bacteria 1215
88 Ga0070667_100003163 3300005367 Bacteria 14110
89 Ga0070667_100021558 3300005367 Bacteria 5348
90 Ga0070667_100043777 3300005367 Bacteria 3758
91 Ga0070667_100194438 3300005367 Bacteria 1798
92 Ga0070701_10007331 3300005438 Bacteria 4702
93 Ga0070711_100330138 3300005439 Unclassified 1221
94 Ga0070705_100083324 3300005440 Bacteria 1970
95 Ga0070700_100012120 3300005441 Bacteria 4798
96 Ga0070663_100036767 3300005455 Bacteria 3403
97 Ga0070663_100427190 3300005455 Bacteria 1088
98 Ga0070678_100028643 3300005456 Bacteria 3802
99 Ga0070678_100039202 3300005456 Bacteria 3340
100 Ga0070678_100050318 3300005456 Bacteria 3014
101 Ga0070678_100134707 3300005456 Bacteria 1968
102 Ga0070678_100177930 3300005456 Bacteria 1739
103 Ga0070678_100191615 3300005456 Bacteria 1681
104 Ga0070678_100216465 3300005456 Bacteria 1590
105 Ga0070662_100011591 3300005457 Bacteria 5818
106 Ga0070662_100012047 3300005457 Bacteria 5724
107 Ga0070662_100037080 3300005457 Bacteria 3454
108 Ga0068867_100014646 3300005459 Bacteria 5557
109 Ga0068867_100049802 3300005459 Bacteria 3084
110 Ga0068867_100060893 3300005459 Bacteria 2801
111 Ga0068867_100069578 3300005459 Bacteria 2629
112 Ga0068867_100071423 3300005459 Bacteria 2596
113 Ga0068867_100117804 3300005459 Bacteria 2048
114 Ga0068867_100590981 3300005459 Bacteria 967
115 Ga0070685_10004729 3300005466 Bacteria 6894
116 Ga0070679_100066994 3300005530 Bacteria 3580
117 Ga0070684_100034625 3300005535 Bacteria 4318
118 Ga0068853_100151009 3300005539 Bacteria 2091
119 Ga0068853_100209944 3300005539 Bacteria 1774
120 Ga0068853_100228867 3300005539 Bacteria 1700
121 Ga0068853_100486531 3300005539 Bacteria 1164
122 Ga0070672_100011455 3300005543 Bacteria 6185
123 Ga0070672_100013269 3300005543 Bacteria 5815
124 Ga0070672_100015758 3300005543 Bacteria 5397
125 Ga0070672_100119088 3300005543 Bacteria 2159
126 Ga0070672_100160355 3300005543 Bacteria 1865
127 Ga0070672_100296881 3300005543 Bacteria 1369
128 Ga0070672_100315321 3300005543 Bacteria 1328
129 Ga0070686_100244428 3300005544 Bacteria 1308
130 Ga0070695_100153380 3300005545 Bacteria 1610
131 Ga0070665_100010042 3300005548 Bacteria 9577
132 Ga0070665_100016157 3300005548 Bacteria 7491
133 Ga0070665_100262431 3300005548 Bacteria 1728
134 Ga0068855_100017679 3300005563 Bacteria 8575
135 Ga0068855_100244969 3300005563 Bacteria 2001
136 Ga0070664_100229845 3300005564 Bacteria 1662
137 Ga0070664_100234468 3300005564 Bacteria 1646
138 Ga0070664_100272968 3300005564 Bacteria 1523
139 Ga0068857_100026365 3300005577 Bacteria 5122
140 Ga0068857_100041636 3300005577 Bacteria 4073
141 Ga0068854_100160310 3300005578 Bacteria 1741
142 Ga0068856_100092087 3300005614 Bacteria 3016
143 Ga0068856_100115337 3300005614 Bacteria 2686
144 Ga0068856_100264635 3300005614 Bacteria 1735
145 Ga0070702_100004798 3300005615 Bacteria 6214
146 Ga0070702_100051557 3300005615 Bacteria 2356
147 Ga0068852_100192627 3300005616 Bacteria 1924
148 Ga0068852_100194861 3300005616 Bacteria 1914
149 Ga0068859_100000776 3300005617 Bacteria 32237
150 Ga0068859_100001589 3300005617 Bacteria 23178
151 Ga0068859_100025358 3300005617 Bacteria 5949
152 Ga0068859_100034355 3300005617 Bacteria 5089
153 Ga0068859_100088520 3300005617 Bacteria 3146
154 Ga0068859_101026206 3300005617 Bacteria 906
155 Ga0068864_100002477 3300005618 Bacteria 15242
156 Ga0068864_100017913 3300005618 Bacteria 5909
157 Ga0068864_100046308 3300005618 Bacteria 3731
158 Ga0068864_100053340 3300005618 Bacteria 3488
159 Ga0068864_100273325 3300005618 Bacteria 1575
160 Ga0068866_10001890 3300005718 Bacteria 8769
161 Ga0068866_10003270 3300005718 Bacteria 6664
162 Ga0068861_100004069 3300005719 Bacteria 9796
163 Ga0068861_100011595 3300005719 Bacteria 6133
164 Ga0068861_100044446 3300005719 Bacteria 3340
165 Ga0068861_100088337 3300005719 Bacteria 2441
166 Ga0068861_100575234 3300005719 Bacteria 1030
167 Ga0068851_10006652 3300005834 Bacteria 5287
168 Ga0068851_10060285 3300005834 Bacteria 1942
169 Ga0068870_10007244 3300005840 Bacteria 4940
170 Ga0068870_10012938 3300005840 Bacteria 3909
171 Ga0068870_10054432 3300005840 Bacteria 2128
172 Ga0068870_10055645 3300005840 Bacteria 2108
173 Ga0068870_10201494 3300005840 Bacteria 1207
174 Ga0068863_100006737 3300005841 Bacteria 11264
175 Ga0068863_100020088 3300005841 Bacteria 6389
176 Ga0068863_100027507 3300005841 Bacteria 5425
177 Ga0068863_100032649 3300005841 Bacteria 4961
178 Ga0068863_100150402 3300005841 Bacteria 2227
179 Ga0068863_100160934 3300005841 Bacteria 2151
180 Ga0068863_100176168 3300005841 Bacteria 2053
181 Ga0068863_100317521 3300005841 Bacteria 1513
182 Ga0068858_100023672 3300005842 Bacteria 5721
183 Ga0068858_100028111 3300005842 Bacteria 5225
184 Ga0068858_100040886 3300005842 Bacteria 4300
185 Ga0068858_100047410 3300005842 Bacteria 3983
186 Ga0068858_100067440 3300005842 Bacteria 3314
187 Ga0068860_100003196 3300005843 Bacteria 16912
188 Ga0068860_100007275 3300005843 Bacteria 11073
189 Ga0068860_100018088 3300005843 Bacteria 6863
190 Ga0068860_100020846 3300005843 Bacteria 6350
191 Ga0068860_100186932 3300005843 Bacteria 2004
192 Ga0068862_100042009 3300005844 Bacteria 3893
193 Ga0068862_100062463 3300005844 Bacteria 3203
194 Ga0068862_100099071 3300005844 Bacteria 2547
195 Ga0068862_100118337 3300005844 Bacteria 2332
196 Ga0068862_100303568 3300005844 Bacteria 1469
197 Ga0075366_10053644 3300006195 Bacteria 2395
198 Ga0097621_100045292 3300006237 Bacteria 3552
199 Ga0097621_100121296 3300006237 Bacteria 2217
200 Ga0097621_100164075 3300006237 Bacteria 1911
201 Ga0075370_10008300 3300006353 Bacteria 5338
202 Ga0075370_10106626 3300006353 Bacteria 1625
203 Ga0068871_100031888 3300006358 Bacteria 4158
204 Ga0068871_100067442 3300006358 Bacteria 2935
205 Ga0068871_100586657 3300006358 Bacteria 1012
206 Ga0068865_100018347 3300006881 Bacteria 4512
207 Ga0068865_100026863 3300006881 Bacteria 3799
208 Ga0068865_100044512 3300006881 Bacteria 3038
209 Ga0097620_100000776 3300006931 Bacteria 32237
210 Ga0097620_100001589 3300006931 Bacteria 23178
211 Ga0097620_100025359 3300006931 Bacteria 5949
212 Ga0097620_100034354 3300006931 Bacteria 5089
213 Ga0097620_100088526 3300006931 Bacteria 3146
214 Ga0097620_101026026 3300006931 Bacteria 906
215 Ga0105251_10121771 3300009011 Bacteria 1185
216 Ga0105240_10302039 3300009093 Bacteria 1831
217 Ga0111539_10027664 3300009094 Bacteria 6927
218 Ga0105245_10173897 3300009098 Bacteria 2052
219 Ga0105245_10940961 3300009098 Bacteria 907
220 Ga0105247_10031046 3300009101 Bacteria 3241
221 Ga0105243_10020958 3300009148 Bacteria 4960
222 Ga0105243_10067659 3300009148 Bacteria 2876
223 Ga0105243_10071783 3300009148 Bacteria 2800
224 Ga0105241_10035126 3300009174 Bacteria 3770
225 Ga0105241_10288461 3300009174 Bacteria 1404
226 Ga0105242_10001775 3300009176 Bacteria 17019
227 Ga0105242_10042998 3300009176 Bacteria 3652
228 Ga0105248_10003392 3300009177 Bacteria 17704
229 Ga0105248_10009399 3300009177 Bacteria 10763
230 Ga0105248_10056704 3300009177 Bacteria 4395
231 Ga0105248_10148113 3300009177 Bacteria 2648
232 Ga0105248_10194895 3300009177 Bacteria 2283
233 Ga0105248_10216625 3300009177 Bacteria 2156
234 Ga0105237_10092651 3300009545 Bacteria 3011
235 Ga0105238_10005339 3300009551 Bacteria 12697
236 Ga0105238_10111709 3300009551 Bacteria 2713
237 Ga0105249_10028167 3300009553 Bacteria 5072
238 Ga0105032_100445 3300009979 Bacteria 4133
239 Ga0105239_10003023 3300010375 Bacteria 20958
240 Ga0105246_10014664 3300011119 Bacteria 4932
241 Ga0157327_1000667 3300012512 Bacteria 1916
242 Ga0157370_10029183 3300013104 Bacteria 5418
243 Ga0157374_10169624 3300013296 Bacteria 2128
244 Ga0157374_10386931 3300013296 Bacteria 1394
245 Ga0157378_10025796 3300013297 Bacteria 5177
246 Ga0157378_10179787 3300013297 Bacteria 1989
247 Ga0163162_10007086 3300013306 Bacteria 10880
248 Ga0163162_10061859 3300013306 Bacteria 3782
249 Ga0163162_10343624 3300013306 Bacteria 1625
250 Ga0163162_10374544 3300013306 Bacteria 1557
251 Ga0157372_10000819 3300013307 Bacteria 33686
252 Ga0157375_10000342 3300013308 Bacteria 42091
253 Ga0157375_10025214 3300013308 Bacteria 5520
254 Ga0157375_10030411 3300013308 Bacteria 5092
255 Ga0157375_10095250 3300013308 Bacteria 3047
256 Ga0157375_10158522 3300013308 Bacteria 2404
257 Ga0157375_10342108 3300013308 Bacteria 1661
258 Ga0157375_10647883 3300013308 Bacteria 1213
259 Ga0163163_10000039 3300014325 Bacteria 148715
260 Ga0163163_10009155 3300014325 Bacteria 8826
261 Ga0163163_10028200 3300014325 Bacteria 5388
262 Ga0163163_10276062 3300014325 Bacteria 1732
263 Ga0157380_10023836 3300014326 Bacteria 4622
264 Ga0157380_10029238 3300014326 Bacteria 4211
265 Ga0157380_10062017 3300014326 Bacteria 2993
266 Ga0157380_10137847 3300014326 Bacteria 2091
267 Ga0157377_10007567 3300014745 Bacteria 5253
268 Ga0157379_10004427 3300014968 Bacteria 12043
269 Ga0157379_10019612 3300014968 Bacteria 5973
270 Ga0157379_10061419 3300014968 Bacteria 3360
271 Ga0157379_10063497 3300014968 Bacteria 3301
272 Ga0157379_10076628 3300014968 Bacteria 2995
273 Ga0157379_10148011 3300014968 Bacteria 2118
274 Ga0157376_10002239 3300014969 Bacteria 13037
275 Ga0206354_11034403 3300020081 Bacteria 1011
276 Ga0213872_10084758 3300021361 Unclassified 1421
277 Ga0209784_100002 3300025224 Bacteria 1753105
278 Ga0209566_100003 3300025225 Bacteria 1753105
279 Ga0209674_100004 3300025226 Bacteria 1753105
280 Ga0209674_100041 3300025226 Bacteria 396231
281 Ga0209563_100006 3300025230 Bacteria 1753105
282 Ga0209563_100043 3300025230 Bacteria 397271
283 Ga0207427_100453 3300025231 Bacteria 22659
284 Ga0209258_100277 3300025242 Bacteria 86422
285 Ga0209677_100003 3300025253 Bacteria 1753105
286 Ga0209677_100077 3300025253 Bacteria 126245
287 Ga0207666_1000950 3300025271 Bacteria 3437
288 Ga0209050_1010421 3300025298 Bacteria 4584
289 Ga0209257_1000032 3300025304 Bacteria 680354
290 Ga0207697_10001006 3300025315 Bacteria 15771
291 Ga0207697_10012117 3300025315 Bacteria 3627
292 Ga0207682_10001109 3300025893 Bacteria 12472
293 Ga0207682_10002237 3300025893 Bacteria 8736
294 Ga0207682_10011838 3300025893 Bacteria 3408
295 Ga0207642_10035094 3300025899 Bacteria 2138
296 Ga0207688_10003400 3300025901 Bacteria 8679
297 Ga0207680_10030394 3300025903 Bacteria 3046
298 Ga0207680_10051797 3300025903 Bacteria 2457
299 Ga0207680_10132317 3300025903 Bacteria 1645
300 Ga0207645_10002988 3300025907 Bacteria 13071
301 Ga0207645_10025478 3300025907 Bacteria 3826
302 Ga0207645_10041768 3300025907 Bacteria 2935
303 Ga0207645_10314687 3300025907 Bacteria 1044
304 Ga0207643_10005604 3300025908 Bacteria 6711
305 Ga0207643_10008853 3300025908 Bacteria 5403
306 Ga0207643_10008956 3300025908 Bacteria 5376
307 Ga0207643_10009803 3300025908 Bacteria 5145
308 Ga0207705_10059867 3300025909 Bacteria 2749
309 Ga0207695_10000393 3300025913 Bacteria 98467
310 Ga0207695_10204085 3300025913 Bacteria 1890
311 Ga0207671_10009835 3300025914 Bacteria 7955
312 Ga0207671_10178306 3300025914 Bacteria 1652
313 Ga0207662_10003299 3300025918 Bacteria 8282
314 Ga0207662_10003987 3300025918 Bacteria 7696
315 Ga0207662_10070967 3300025918 Bacteria 2108
316 Ga0207662_10278809 3300025918 Bacteria 1105
317 Ga0207657_10005814 3300025919 Bacteria 12849
318 Ga0207657_10069966 3300025919 Bacteria 2975
319 Ga0207649_10051673 3300025920 Bacteria 2546
320 Ga0207649_10175369 3300025920 Bacteria 1497
321 Ga0207649_10432940 3300025920 Bacteria 990
322 Ga0207652_10643471 3300025921 Bacteria 948
323 Ga0207681_10009555 3300025923 Bacteria 5926
324 Ga0207681_10033032 3300025923 Bacteria 3391
325 Ga0207681_10033643 3300025923 Bacteria 3362
326 Ga0207681_10059392 3300025923 Bacteria 2621
327 Ga0207681_10063258 3300025923 Bacteria 2551
328 Ga0207681_10668208 3300025923 Bacteria 862
329 Ga0207694_10059542 3300025924 Bacteria 2970
330 Ga0207650_10006933 3300025925 Bacteria 7724
331 Ga0207650_10007995 3300025925 Bacteria 7208
332 Ga0207650_10023808 3300025925 Bacteria 4347
333 Ga0207650_10047183 3300025925 Bacteria 3174
334 Ga0207650_10049457 3300025925 Bacteria 3104
335 Ga0207650_10207933 3300025925 Unclassified 1571
336 Ga0207650_10281596 3300025925 Bacteria 1354
337 Ga0207659_10028796 3300025926 Bacteria 3778
338 Ga0207659_10032629 3300025926 Bacteria 3576
339 Ga0207659_10112883 3300025926 Bacteria 2069
340 Ga0207659_10485655 3300025926 Bacteria 1044
341 Ga0207659_10510307 3300025926 Bacteria 1019
342 Ga0207687_10049364 3300025927 Bacteria 2926
343 Ga0207644_10000556 3300025931 Bacteria 24008
344 Ga0207644_10014629 3300025931 Bacteria 5254
345 Ga0207644_10158889 3300025931 Bacteria 1755
346 Ga0207644_10181110 3300025931 Bacteria 1651
347 Ga0207644_10343835 3300025931 Bacteria 1210
348 Ga0207706_10005220 3300025933 Bacteria 12124
349 Ga0207706_10009694 3300025933 Bacteria 8838
350 Ga0207706_10161558 3300025933 Bacteria 1969
351 Ga0207706_10268247 3300025933 Bacteria 1490
352 Ga0207686_10005254 3300025934 Bacteria 6950
353 Ga0207709_10015946 3300025935 Bacteria 4170
354 Ga0207709_10127947 3300025935 Bacteria 1726
355 Ga0207670_10060810 3300025936 Bacteria 2575
356 Ga0207669_10021717 3300025937 Bacteria 3394
357 Ga0207669_10115744 3300025937 Bacteria 1808
358 Ga0207704_10005663 3300025938 Bacteria 5773
359 Ga0207704_10268047 3300025938 Bacteria 1291
360 Ga0207691_10001853 3300025940 Bacteria 20653
361 Ga0207691_10010978 3300025940 Bacteria 8691
362 Ga0207691_10011066 3300025940 Bacteria 8660
363 Ga0207691_10018633 3300025940 Bacteria 6577
364 Ga0207691_10019096 3300025940 Bacteria 6491
365 Ga0207691_10098906 3300025940 Bacteria 2605
366 Ga0207691_10229577 3300025940 Bacteria 1607
367 Ga0207691_10303503 3300025940 Bacteria 1371
368 Ga0207711_10011042 3300025941 Bacteria 7506
369 Ga0207711_10023415 3300025941 Bacteria 5170
370 Ga0207711_10023745 3300025941 Bacteria 5133
371 Ga0207711_10140439 3300025941 Bacteria 2173
372 Ga0207711_10172699 3300025941 Bacteria 1962
373 Ga0207711_10212968 3300025941 Bacteria 1765
374 Ga0207689_10004356 3300025942 Bacteria 12892
375 Ga0207689_10004366 3300025942 Bacteria 12868
376 Ga0207689_10004439 3300025942 Bacteria 12723
377 Ga0207661_10149050 3300025944 Bacteria 2021
378 Ga0207679_10120486 3300025945 Bacteria 2087
379 Ga0207679_10366814 3300025945 Bacteria 1259
380 Ga0207679_10409687 3300025945 Bacteria 1194
381 Ga0207667_10021057 3300025949 Bacteria 7232
382 Ga0207651_10014472 3300025960 Bacteria 4558
383 Ga0207651_10016899 3300025960 Bacteria 4292
384 Ga0207651_10091127 3300025960 Bacteria 2231
385 Ga0207651_10168943 3300025960 Bacteria 1723
386 Ga0207712_10055113 3300025961 Bacteria 2795
387 Ga0207712_10106353 3300025961 Bacteria 2096
388 Ga0207668_10005000 3300025972 Bacteria 7805
389 Ga0207668_10024666 3300025972 Bacteria 3884
390 Ga0207668_10064389 3300025972 Bacteria 2590
391 Ga0207668_10074867 3300025972 Bacteria 2432
392 Ga0207668_10105495 3300025972 Bacteria 2103
393 Ga0207658_10006534 3300025986 Bacteria 7953
394 Ga0207658_10007612 3300025986 Bacteria 7378
395 Ga0207658_10252610 3300025986 Bacteria 1499
396 Ga0207658_10360477 3300025986 Bacteria 1268
397 Ga0207677_10039518 3300026023 Bacteria 3103
398 Ga0207677_10070361 3300026023 Bacteria 2466
399 Ga0207677_10100221 3300026023 Bacteria 2129
400 Ga0207677_10160347 3300026023 Bacteria 1747
401 Ga0207703_10004627 3300026035 Bacteria 11247
402 Ga0207703_10026909 3300026035 Bacteria 4529
403 Ga0207703_10032798 3300026035 Bacteria 4113
404 Ga0207639_10000707 3300026041 Bacteria 22869
405 Ga0207639_10106777 3300026041 Bacteria 2273
406 Ga0207639_10162037 3300026041 Bacteria 1886
407 Ga0207678_10032358 3300026067 Bacteria 4557
408 Ga0207678_10215167 3300026067 Bacteria 1644
409 Ga0207708_10003088 3300026075 Bacteria 12263
410 Ga0207702_10013708 3300026078 Bacteria 6734
411 Ga0207702_10041695 3300026078 Bacteria 3849
412 Ga0207702_10354488 3300026078 Bacteria 1405
413 Ga0207702_10481876 3300026078 Bacteria 1207
414 Ga0207641_10004384 3300026088 Bacteria 12234
415 Ga0207641_10055413 3300026088 Bacteria 3366
416 Ga0207641_10057327 3300026088 Bacteria 3312
417 Ga0207641_10065162 3300026088 Bacteria 3116
418 Ga0207641_10074607 3300026088 Bacteria 2926
419 Ga0207641_10645370 3300026088 Unclassified 1039
420 Ga0207648_10010341 3300026089 Bacteria 8849
421 Ga0207648_10015262 3300026089 Bacteria 7066
422 Ga0207648_10033764 3300026089 Bacteria 4512
423 Ga0207648_10040746 3300026089 Bacteria 4080
424 Ga0207648_10088816 3300026089 Bacteria 2699
425 Ga0207648_10155203 3300026089 Bacteria 2021
426 Ga0207648_10229490 3300026089 Bacteria 1651
427 Ga0207648_10364661 3300026089 Unclassified 1304
428 Ga0207676_10023223 3300026095 Bacteria 4571
429 Ga0207676_10026809 3300026095 Bacteria 4286
430 Ga0207676_10028213 3300026095 Bacteria 4191
431 Ga0207676_10084789 3300026095 Bacteria 2584
432 Ga0207676_10122949 3300026095 Bacteria 2192
433 Ga0207676_10189588 3300026095 Bacteria 1808
434 Ga0207674_10005202 3300026116 Bacteria 15489
435 Ga0207674_10034188 3300026116 Bacteria 5318
436 Ga0207675_100001089 3300026118 Bacteria 26890
437 Ga0207675_100006423 3300026118 Bacteria 11131
438 Ga0207675_100007214 3300026118 Bacteria 10498
439 Ga0207675_100108512 3300026118 Bacteria 2618
440 Ga0207675_100277447 3300026118 Bacteria 1628
441 Ga0207675_100388152 3300026118 Bacteria 1374
442 Ga0207675_100619853 3300026118 Bacteria 1086
443 Ga0207683_10010465 3300026121 Bacteria 7916
444 Ga0207683_10010565 3300026121 Bacteria 7877
445 Ga0207683_10018093 3300026121 Bacteria 6009
446 Ga0207683_10077599 3300026121 Bacteria 2942
447 Ga0207683_10102674 3300026121 Bacteria 2554
448 Ga0207683_10161436 3300026121 Bacteria 2026
449 Ga0207683_10166708 3300026121 Bacteria 1993
450 Ga0207683_10199833 3300026121 Bacteria 1817
451 Ga0207683_10229015 3300026121 Bacteria 1694
452 Ga0207698_10045861 3300026142 Bacteria 3296
453 Ga0207698_10069787 3300026142 Bacteria 2781
454 Ga0207698_10074292 3300026142 Bacteria 2711
455 Ga0207698_10191331 3300026142 Bacteria 1823
456 Ga0207698_10207138 3300026142 Bacteria 1761
457 Ga0207698_10234238 3300026142 Bacteria 1669
458 Ga0207698_10625817 3300026142 Bacteria 1064
459 Ga0209969_1003420 3300027360 Bacteria 2196
460 Ga0209995_1001196 3300027471 Bacteria 3991
461 Ga0209999_1001155 3300027543 Bacteria 4508
462 Ga0209982_1007820 3300027552 Bacteria 1561
463 Ga0209970_1006128 3300027614 Bacteria 1974
464 Ga0209971_1000369 3300027682 Bacteria 12297
465 Ga0209974_10031131 3300027876 Bacteria 1766
466 Ga0268266_10063379 3300028379 Bacteria 3191
467 Ga0268266_10070034 3300028379 Bacteria 3040
468 Ga0268266_10218463 3300028379 Bacteria 1751
469 Ga0268266_10264261 3300028379 Bacteria 1595
470 Ga0268265_10008941 3300028380 Bacteria 6774
471 Ga0268265_10025546 3300028380 Bacteria 4195
472 Ga0268265_10028035 3300028380 Bacteria 4028
473 Ga0268265_10029219 3300028380 Bacteria 3955
474 Ga0268265_10154826 3300028380 Bacteria 1938
475 Ga0268264_10002324 3300028381 Bacteria 16821
476 Ga0268264_10005552 3300028381 Bacteria 10689
477 Ga0268264_10015656 3300028381 Bacteria 6210
478 Ga0268264_10063478 3300028381 Bacteria 3105
479 Ga0268264_10135919 3300028381 Bacteria 2186
480 Ga0268264_10741048 3300028381 Bacteria 978
481 Ga0307515_10000026 3300028794 Bacteria 382411
482 Ga0307515_10000425 3300028794 Bacteria 101790
483 Ga0307515_10012894 3300028794 Bacteria 15678
484 Ga0307515_10039838 3300028794 Bacteria 7455
485 Ga0307515_10083827 3300028794 Bacteria 4104
486 Ga0265332_10000027 3300031238 Bacteria 190796
487 Ga0307513_10138369 3300031456 Bacteria 2366
488 Ga0307408_100004210 3300031548 Bacteria 9798
489 Ga0307408_100233454 3300031548 Bacteria 1508
490 Ga0307408_100441028 3300031548 Bacteria 1127
491 Ga0307408_100536294 3300031548 Bacteria 1030
492 Ga0307405_10029810 3300031731 Bacteria 3192
493 Ga0307413_10000876 3300031824 Bacteria 10645
494 Ga0307413_10536888 3300031824 Bacteria 946
495 Ga0307410_10057177 3300031852 Bacteria 2655
496 Ga0307410_10075979 3300031852 Bacteria 2343
497 Ga0307406_10008301 3300031901 Bacteria 5787
498 Ga0307406_10391676 3300031901 Bacteria 1099
499 Ga0307407_10004929 3300031903 Bacteria 5735
500 Ga0307407_10095458 3300031903 Bacteria 1833
501 Ga0307412_10091790 3300031911 Bacteria 2126
502 Ga0307412_10121164 3300031911 Bacteria 1883
503 Ga0307412_10168796 3300031911 Bacteria 1634
504 Ga0307412_10413563 3300031911 Bacteria 1101
505 Ga0307409_100024545 3300031995 Bacteria 4207
506 Ga0307409_100175759 3300031995 Bacteria 1889
507 Ga0307409_100758402 3300031995 Bacteria 975
508 Ga0307416_100012737 3300032002 Bacteria 5682
509 Ga0307416_100088403 3300032002 Bacteria 2649
510 Ga0307416_100152973 3300032002 Bacteria 2119
511 Ga0307416_101119200 3300032002 Bacteria 892
512 Ga0307414_10009513 3300032004 Bacteria 5589
513 Ga0307414_10013206 3300032004 Bacteria 4910
514 Ga0307414_10027119 3300032004 Bacteria 3697
515 Ga0307414_10038848 3300032004 Bacteria 3200
516 Ga0307414_10143286 3300032004 Bacteria 1874
517 Ga0307414_10695192 3300032004 Bacteria 920
518 Ga0307411_10012698 3300032005 Bacteria 4611
519 Ga0307411_10016663 3300032005 Bacteria 4163
520 Ga0307411_10406493 3300032005 Bacteria 1127
521 Ga0307415_100001077 3300032126 Bacteria 12688
522 Ga0373940_0004499 3300035088 Bacteria 2948
523 Ga0373932_0084041 3300035112 Bacteria 1011
524 Ga0373939_0000410 3300035114 Bacteria 10797
525 Ga0373953_0074659 3300035117 Bacteria 1403
526 Ga0373960_0002496 3300035121 Bacteria 4137
527 Ga0373943_0085756 3300035170 Bacteria 1622
528 Ga0373943_0167539 3300035170 Bacteria 1200
529 Ga0373946_0053028 3300035171 Bacteria 1703
530 Ga0373931_0000228 3300035691 Bacteria 23922
531 Ga0373947_0082224 3300035725 Bacteria 1996
532 Ga0373937_0416352 3300036401 Bacteria 1275
533 Ga0373925_0217126 3300037068 Bacteria 1525
534 Ga0395905_0000676 3300037471 Bacteria 45246
535 Ga0395901_0015234 3300038443 Bacteria 7824
536 Ga0436361_0081204 3300039447 Unclassified 2557
537 Ga0439453_0005277 3300041408 Bacteria 1962
538 Ga0439465_0016461 3300041413 Bacteria 2306
539 Ga0451791_1002939 3300041451 Bacteria 2240
540 Ga0451793_1438105 3300041452 Bacteria 3242
541 Ga0451797_0531083 3300041453 Bacteria 1843
542 Ga0451797_0572638 3300041453 Bacteria 2187
543 Ga0451802_2089645 3300041460 Bacteria 4816
544 Ga0451807_0034953 3300041486 Bacteria 7992
545 Ga0451807_0720322 3300041486 Bacteria 5832
546 Ga0451807_2299026 3300041486 Bacteria 1596
547 Ga0451837_0074019 3300041494 Bacteria 989
548 Ga0451837_0154854 3300041494 Bacteria 4997
549 Ga0451837_0205854 3300041494 Bacteria 2004
550 Ga0451837_0692191 3300041494 Bacteria 2773
551 Ga0451851_1081793 3300041507 Bacteria 908
552 Ga0451843_0190080 3300041509 Bacteria 4075
553 Ga0451843_0906883 3300041509 Bacteria 1243
554 Ga0439431_0035802 3300041997 Bacteria 1248
555 Ga0439431_0096133 3300041997 Bacteria 811
556 Ga0439443_010797 3300042003 Bacteria 1329
557 Ga0439432_061071 3300042006 Bacteria 1162
558 Ga0450920_002714 3300042122 Bacteria 3035
559 Ga0450923_009553 3300042125 Bacteria 1700
560 Ga0450896_002242 3300042133 Bacteria 2481
561 Ga0450898_026334 3300042134 Bacteria 1048
562 Ga0439446_0001503 3300042156 Bacteria 5336
563 Ga0450908_001664 3300042184 Bacteria 4323
564 Ga0450908_002271 3300042184 Bacteria 3755
565 Ga0439434_0002955 3300042435 Bacteria 4967
566 Ga0439435_0000148 3300042436 Bacteria 9467
567 Ga0439435_0101752 3300042436 Bacteria 884
568 Ga0439444_0000013 3300042437 Bacteria 14340
569 Ga0450918_002739 3300042531 Bacteria 3304
570 Ga0439440_0010489 3300042993 Bacteria 1938
571 Ga0453684_0002611 3300044712 Bacteria 43058
572 Ga0453684_0212692 3300044712 Bacteria 2246
573 Ga0453684_0375171 3300044712 Bacteria 1598
574 Ga0451576_0000042 3300045051 Bacteria 342102
575 Ga0451576_0266347 3300045051 Bacteria 1791
576 Ga0495580_0063827 3300046472 Bacteria 2582
577 Ga0495594_0137924 3300046499 Unclassified 1383
578 Ga0495663_0016213 3300046525 Bacteria 2106
579 Ga0495598_0000828 3300046537 Bacteria 5933
580 Ga0495598_0025574 3300046537 Bacteria 1611
581 Ga0495621_0000271 3300046539 Bacteria 12420
582 Ga0495621_0013377 3300046539 Bacteria 2576
583 Ga0495621_0053926 3300046539 Bacteria 1444
584 Ga0495621_0116528 3300046539 Bacteria 1029
585 Ga0495633_0110071 3300046558 Bacteria 1277
586 Ga0495656_0011107 3300046615 Bacteria 3298
587 Ga0495656_0064915 3300046615 Bacteria 1604
588 Ga0495656_0209541 3300046615 Bacteria 970
589 Ga0495659_0032880 3300046664 Bacteria 1818
590 Ga0495647_0011922 3300046681 Bacteria 2985
591 Ga0495658_0137919 3300046683 Bacteria 1490
592 Ga0495613_0451568 3300046689 Unclassified 871
593 Ga0495670_0270838 3300046691 Bacteria 907
594 Ga0495600_0065975 3300046809 Bacteria 2367
595 Ga0495636_0001496 3300047318 Bacteria 8857
596 Ga0495636_0024512 3300047318 Bacteria 2447
597 Ga0495684_0142614 3300047471 Bacteria 1796
598 Ga0496100_0123979 3300048903 Bacteria 1811
599 Ga0496101_0031890 3300048904 Bacteria 3706
600 Ga0496101_0122931 3300048904 Bacteria 1964
601 Ga0496102_0156312 3300048905 Bacteria 2143
602 Ga0496103_0016203 3300048906 Bacteria 4447
603 Ga0496104_0000017 3300048907 Bacteria 325877
604 Ga0496104_0112629 3300048907 Bacteria 2609
605 Ga0496104_0439809 3300048907 Bacteria 1216
606 Ga0496105_0000009 3300048908 Bacteria 325734
607 Ga0496105_0387104 3300048908 Bacteria 1112
608 Ga0496106_0047660 3300048909 Bacteria 3226
609 Ga0496106_0192782 3300048909 Bacteria 1621
610 Ga0496106_0283314 3300048909 Bacteria 1328
611 Ga0496107_0043602 3300048910 Bacteria 3223
612 Ga0496107_0097807 3300048910 Bacteria 2149
613 Ga0496108_0016568 3300048911 Bacteria 6017
614 Ga0496108_0185991 3300048911 Bacteria 1799
615 Ga0496109_0031279 3300048912 Bacteria 4775
616 Ga0496109_0296386 3300048912 Bacteria 1525
617 Ga0496109_0703952 3300048912 Bacteria 947
618 Ga0496110_0016522 3300048913 Bacteria 6163
619 Ga0496110_0127916 3300048913 Bacteria 2292
620 Ga0496110_0628413 3300048913 Bacteria 973
621 Ga0496111_0208339 3300048914 Bacteria 1452
622 Ga0496113_0073437 3300048916 Bacteria 2606
623 Ga0496113_0158950 3300048916 Bacteria 1786
624 Ga0496113_0649012 3300048916 Unclassified 844
625 Ga0496114_0055839 3300048917 Bacteria 3294
626 Ga0496124_0254628 3300048927 Bacteria 1296
627 Ga0496126_0420927 3300048929 Unclassified 1080
628 Ga0501031_0122362 3300049568 Bacteria 1700
629 Ga0501032_0087926 3300049569 Bacteria 2063
630 Ga0501032_0380786 3300049569 Bacteria 907
631 Ga0501033_0019842 3300049570 Bacteria 5081
632 Ga0501034_0000544 3300049571 Bacteria 59969
633 Ga0501034_0032339 3300049571 Bacteria 5313
634 Ga0501036_0156238 3300049572 Bacteria 1924
635 Ga0501037_0247264 3300049573 Bacteria 1249
636 Ga0501038_0087191 3300049574 Bacteria 2621
637 Ga0501038_0109028 3300049574 Bacteria 2295
638 Ga0501039_0179245 3300049575 Bacteria 1666
639 Ga0501039_0239978 3300049575 Bacteria 1425
640 Ga0501047_0003127 3300049581 Bacteria 15702
641 Ga0501047_0169081 3300049581 Bacteria 2055
642 Ga0501067_0016843 3300049583 Bacteria 4036
643 Ga0501068_0009244 3300049584 Bacteria 5509
644 Ga0501070_0066342 3300049586 Bacteria 2988
645 Ga0501072_0020226 3300049588 Bacteria 5155
646 Ga0501073_0000406 3300049589 Bacteria 29411
647 Ga0501225_0028958 3300049705 Bacteria 1522
648 Ga0501079_0049523 3300049741 Bacteria 3242
649 Ga0501080_0013933 3300049742 Bacteria 7399
650 Ga0501080_0194496 3300049742 Bacteria 1863
651 Ga0501083_0008440 3300049744 Bacteria 7279
652 Ga0501035_0050901 3300049822 Bacteria 3710
653 Ga0501035_0087317 3300049822 Bacteria 2749
654 Ga0501044_0011438 3300049823 Bacteria 9614
655 Ga0501044_0039840 3300049823 Bacteria 4899
656 Ga0501044_0065224 3300049823 Bacteria 3714
657 Ga0501044_0523323 3300049823 Bacteria 1085
658 nmdc:mga0k408_24917_c1 3300050493 Bacteria 3385
659 nmdc:mga0k408_443367_c1 3300050493 Unclassified 771
660 nmdc:mga0k408_9257_c1 3300050493 Bacteria 5307
661 nmdc:mga07m45_4968_c1 3300050496 Bacteria 6562
662 nmdc:mga07m45_95851_c1 3300050496 Bacteria 1702
663 Ga0495619_0066884 3300053085 Bacteria 2399
664 Ga0500642_0052515 3300053130 Bacteria 1804
665 Ga0501082_0073547 3300060353 Bacteria 2944

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10278809 Ga0207662_102788091 212
2 3300009174 Ga0105241_10288461 Ga0105241_102884612 216
3 3300009093 Ga0105240_10302039 Ga0105240_103020392 219
4 3300025913 Ga0207695_10204085 Ga0207695_102040852 219
5 3300046539 Ga0495621_0053926 Ga0495621_0053926_761_1426 221
6 3300005618 Ga0068864_100273325 Ga0068864_1002733252 222
7 3300049575 Ga0501039_0179245 Ga0501039_0179245_969_1640 222
8 3300050493 nmdc:mga0k408_443367_c1 nmdc:mga0k408_443367_c1_62_748 223
9 3300048913 Ga0496110_0628413 Ga0496110_0628413_32_796 226
10 3300025242 Ga0209258_100277 Ga0209258_10027754 227
11 3300049742 Ga0501080_0194496 Ga0501080_0194496_876_1685 228
12 3300003752 Ga0055539_1000116 Ga0055539_100011686 230
13 3300003756 Ga0055533_1000016 Ga0055533_1000016293 230
14 3300003759 Ga0055525_1000955 Ga0055525_10009554 230
15 3300005335 Ga0070666_10085797 Ga0070666_100857973 230
16 3300005354 Ga0070675_100174687 Ga0070675_1001746872 230
17 3300005355 Ga0070671_100102271 Ga0070671_1001022711 230
18 3300005457 Ga0070662_100037080 Ga0070662_1000370802 230
19 3300005459 Ga0068867_100049802 Ga0068867_1000498023 230
20 3300009177 Ga0105248_10216625 Ga0105248_102166253 230
21 3300025226 Ga0209674_100041 Ga0209674_10004191 230
22 3300025230 Ga0209563_100043 Ga0209563_10004391 230
23 3300025253 Ga0209677_100077 Ga0209677_10007791 230
24 3300025903 Ga0207680_10030394 Ga0207680_100303942 230
25 3300025931 Ga0207644_10181110 Ga0207644_101811102 230
26 3300025933 Ga0207706_10268247 Ga0207706_102682472 230
27 3300025941 Ga0207711_10140439 Ga0207711_101404393 230
28 3300026121 Ga0207683_10229015 Ga0207683_102290152 230
29 3300048912 Ga0496109_0296386 Ga0496109_0296386_652_1464 230
30 3300049581 Ga0501047_0003127 Ga0501047_0003127_13882_14697 230
31 3300049823 Ga0501044_0011438 Ga0501044_0011438_7786_8601 230
32 iso_pu_bacteria 2643221585 2643937134 230
33 iso_pu_bacteria 2643221656 2644318299 230
34 3300025920 Ga0207649_10175369 Ga0207649_101753692 231
35 3300028794 Ga0307515_10039838 Ga0307515_100398387 231
36 3300046539 Ga0495621_0013377 Ga0495621_0013377_810_1550 231
37 3300049569 Ga0501032_0380786 Ga0501032_0380786_57_851 231
38 3300049570 Ga0501033_0019842 Ga0501033_0019842_570_1364 231
39 3300005333 Ga0070677_10037664 Ga0070677_100376641 232
40 3300005840 Ga0068870_10201494 Ga0068870_102014942 232
41 3300025224 Ga0209784_100002 Ga0209784_1000021375 232
42 3300025225 Ga0209566_100003 Ga0209566_1000031375 232
43 3300025226 Ga0209674_100004 Ga0209674_1000041375 232
44 3300025230 Ga0209563_100006 Ga0209563_1000061375 232
45 3300025253 Ga0209677_100003 Ga0209677_1000031375 232
46 3300026142 Ga0207698_10625817 Ga0207698_106258172 232
47 3300035088 Ga0373940_0004499 Ga0373940_0004499_791_1501 232
48 3300035114 Ga0373939_0000410 Ga0373939_0000410_3156_3866 232
49 3300035121 Ga0373960_0002496 Ga0373960_0002496_1393_2103 232
50 3300035691 Ga0373931_0000228 Ga0373931_0000228_20326_21036 232
51 3300048909 Ga0496106_0192782 Ga0496106_0192782_357_1172 232
52 3300044712 Ga0453684_0212692 Ga0453684_0212692_769_1518 233
53 3300005459 Ga0068867_100069578 Ga0068867_1000695782 234
54 3300025231 Ga0207427_100453 Ga0207427_10045312 234
55 3300026041 Ga0207639_10162037 Ga0207639_101620372 234
56 3300026089 Ga0207648_10033764 Ga0207648_100337642 234
57 3300026095 Ga0207676_10084789 Ga0207676_100847892 234
58 3300003794 Ga0055531_10000064 Ga0055531_1000006472 235
59 3300005331 Ga0070670_100032014 Ga0070670_1000320141 235
60 3300005617 Ga0068859_101026206 Ga0068859_1010262061 235
61 3300005842 Ga0068858_100028111 Ga0068858_1000281114 235
62 3300006353 Ga0075370_10106626 Ga0075370_101066262 235
63 3300006931 Ga0097620_101026026 Ga0097620_1010260261 235
64 3300025298 Ga0209050_1010421 Ga0209050_10104216 235
65 3300025304 Ga0209257_1000032 Ga0209257_1000032591 235
66 3300037471 Ga0395905_0000676 Ga0395905_0000676_32309_33028 235
67 3300050496 nmdc:mga07m45_95851_c1 nmdc:mga07m45_95851_c1_500_1222 235
68 3300005331 Ga0070670_100055955 Ga0070670_1000559552 236
69 3300005355 Ga0070671_100002319 Ga0070671_10000231913 236
70 3300005355 Ga0070671_100150215 Ga0070671_1001502152 236
71 3300005356 Ga0070674_100095866 Ga0070674_1000958662 236
72 3300005456 Ga0070678_100050318 Ga0070678_1000503183 236
73 3300005543 Ga0070672_100119088 Ga0070672_1001190882 236
74 3300005618 Ga0068864_100046308 Ga0068864_1000463084 236
75 3300006237 Ga0097621_100045292 Ga0097621_1000452922 236
76 3300006358 Ga0068871_100031888 Ga0068871_1000318882 236
77 3300009177 Ga0105248_10056704 Ga0105248_100567042 236
78 3300009177 Ga0105248_10194895 Ga0105248_101948953 236
79 3300013306 Ga0163162_10374544 Ga0163162_103745442 236
80 3300013308 Ga0157375_10158522 Ga0157375_101585222 236
81 3300013308 Ga0157375_10342108 Ga0157375_103421082 236
82 3300014325 Ga0163163_10276062 Ga0163163_102760622 236
83 3300025893 Ga0207682_10002237 Ga0207682_100022372 236
84 3300025907 Ga0207645_10025478 Ga0207645_100254782 236
85 3300025923 Ga0207681_10668208 Ga0207681_106682081 236
86 3300025925 Ga0207650_10047183 Ga0207650_100471833 236
87 3300025931 Ga0207644_10000556 Ga0207644_100005565 236
88 3300025937 Ga0207669_10115744 Ga0207669_101157442 236
89 3300025940 Ga0207691_10229577 Ga0207691_102295772 236
90 3300025941 Ga0207711_10023745 Ga0207711_100237452 236
91 3300025941 Ga0207711_10172699 Ga0207711_101726992 236
92 3300026088 Ga0207641_10074607 Ga0207641_100746073 236
93 3300026089 Ga0207648_10155203 Ga0207648_101552032 236
94 3300026095 Ga0207676_10028213 Ga0207676_100282132 236
95 3300026118 Ga0207675_100277447 Ga0207675_1002774472 236
96 3300026121 Ga0207683_10010565 Ga0207683_100105652 236
97 3300026121 Ga0207683_10166708 Ga0207683_101667082 236
98 3300026142 Ga0207698_10069787 Ga0207698_100697872 236
99 3300026142 Ga0207698_10234238 Ga0207698_102342382 236
100 3300046539 Ga0495621_0116528 Ga0495621_0116528_78_890 236
101 3300049568 Ga0501031_0122362 Ga0501031_0122362_115_912 236
102 3300049572 Ga0501036_0156238 Ga0501036_0156238_330_1124 236
103 3300049573 Ga0501037_0247264 Ga0501037_0247264_192_989 236
104 3300049822 Ga0501035_0050901 Ga0501035_0050901_2376_3173 236
105 iso_pu_bacteria 2643221639 2644217885 236
106 iso_pu_bacteria 2643221646 2644258378 236
107 3300005614 Ga0068856_100115337 Ga0068856_1001153372 237
108 3300026078 Ga0207702_10041695 Ga0207702_100416954 237
109 3300026089 Ga0207648_10040746 Ga0207648_100407464 237
110 3300032004 Ga0307414_10027119 Ga0307414_100271193 237
111 3300045051 Ga0451576_0266347 Ga0451576_0266347_1032_1760 237
112 3300049823 Ga0501044_0065224 Ga0501044_0065224_1545_2318 237
113 3300005564 Ga0070664_100272968 Ga0070664_1002729682 238
114 3300014968 Ga0157379_10019612 Ga0157379_100196123 238
115 3300035112 Ga0373932_0084041 Ga0373932_0084041_99_887 238
116 3300005539 Ga0068853_100209944 Ga0068853_1002099442 239
117 3300048916 Ga0496113_0649012 Ga0496113_0649012_79_831 239
118 3300049574 Ga0501038_0109028 Ga0501038_0109028_879_1661 239
119 3300049822 Ga0501035_0087317 Ga0501035_0087317_578_1414 239
120 3300005331 Ga0070670_100196559 Ga0070670_1001965592 240
121 3300005338 Ga0068868_100069917 Ga0068868_1000699172 240
122 3300005618 Ga0068864_100017913 Ga0068864_1000179134 240
123 3300005841 Ga0068863_100160934 Ga0068863_1001609342 240
124 3300005843 Ga0068860_100186932 Ga0068860_1001869322 240
125 3300006195 Ga0075366_10053644 Ga0075366_100536442 240
126 3300006353 Ga0075370_10008300 Ga0075370_100083006 240
127 3300014968 Ga0157379_10148011 Ga0157379_101480112 240
128 3300025925 Ga0207650_10281596 Ga0207650_102815962 240
129 3300025927 Ga0207687_10049364 Ga0207687_100493642 240
130 3300026023 Ga0207677_10039518 Ga0207677_100395182 240
131 3300026088 Ga0207641_10645370 Ga0207641_106453702 240
132 3300028381 Ga0268264_10135919 Ga0268264_101359191 240
133 3300028794 Ga0307515_10000425 Ga0307515_1000042582 240
134 3300049571 Ga0501034_0000544 Ga0501034_0000544_43994_44764 240
135 3300050493 nmdc:mga0k408_24917_c1 nmdc:mga0k408_24917_c1_1342_2118 240
136 3300050493 nmdc:mga0k408_9257_c1 nmdc:mga0k408_9257_c1_3384_4169 240
137 3300028794 Ga0307515_10083827 Ga0307515_100838275 241
138 3300046499 Ga0495594_0137924 Ga0495594_0137924_546_1325 241
139 3300048929 Ga0496126_0420927 Ga0496126_0420927_19_792 241
140 3300028794 Ga0307515_10000026 Ga0307515_1000002687 243
141 3300005331 Ga0070670_100003776 Ga0070670_10000377610 244
142 3300005355 Ga0070671_100137059 Ga0070671_1001370593 244
143 3300005439 Ga0070711_100330138 Ga0070711_1003301382 244
144 3300005543 Ga0070672_100315321 Ga0070672_1003153212 244
145 3300005618 Ga0068864_100053340 Ga0068864_1000533402 244
146 3300005841 Ga0068863_100317521 Ga0068863_1003175212 244
147 3300013308 Ga0157375_10647883 Ga0157375_106478832 244
148 3300021361 Ga0213872_10084758 Ga0213872_100847582 244
149 3300025914 Ga0207671_10178306 Ga0207671_101783062 244
150 3300025925 Ga0207650_10006933 Ga0207650_100069334 244
151 3300026088 Ga0207641_10065162 Ga0207641_100651622 244
152 3300028379 Ga0268266_10218463 Ga0268266_102184632 244
153 3300039447 Ga0436361_0081204 Ga0436361_0081204_568_1341 244
154 3300042122 Ga0450920_002714 Ga0450920_002714_1895_2674 244
155 3300042125 Ga0450923_009553 Ga0450923_009553_610_1389 244
156 3300042184 Ga0450908_002271 Ga0450908_002271_1057_1836 244
157 3300042531 Ga0450918_002739 Ga0450918_002739_2415_3194 244
158 iso_pu_bacteria 2524614729 2525557182 244
159 iso_pu_bacteria 2627854209 2630648778 244
160 3300005459 Ga0068867_100117804 Ga0068867_1001178042 245
161 3300031238 Ga0265332_10000027 Ga0265332_1000002738 245
162 3300005365 Ga0070688_100171686 Ga0070688_1001716861 246
163 3300005366 Ga0070659_100292580 Ga0070659_1002925802 246
164 3300005530 Ga0070679_100066994 Ga0070679_1000669944 246
165 3300013308 Ga0157375_10025214 Ga0157375_100252144 246
166 iso_pu_bacteria 2588253510 2588295561 246
167 iso_pu_bacteria 2643221592 2643968245 246
168 iso_pu_bacteria 2643221625 2644143602 246
169 iso_pu_bacteria 2643221648 2644272023 246
170 3300005331 Ga0070670_100105022 Ga0070670_1001050222 247
171 3300005334 Ga0068869_100007068 Ga0068869_1000070688 247
172 3300005338 Ga0068868_100459369 Ga0068868_1004593691 247
173 3300005347 Ga0070668_100008000 Ga0070668_1000080006 247
174 3300005354 Ga0070675_100213041 Ga0070675_1002130412 247
175 3300005456 Ga0070678_100028643 Ga0070678_1000286433 247
176 3300005459 Ga0068867_100590981 Ga0068867_1005909811 247
177 3300005543 Ga0070672_100011455 Ga0070672_1000114554 247
178 3300005548 Ga0070665_100016157 Ga0070665_1000161576 247
179 3300005616 Ga0068852_100194861 Ga0068852_1001948612 247
180 3300005617 Ga0068859_100088520 Ga0068859_1000885202 247
181 3300005840 Ga0068870_10054432 Ga0068870_100544321 247
182 3300005843 Ga0068860_100007275 Ga0068860_1000072759 247
183 3300006881 Ga0068865_100026863 Ga0068865_1000268632 247
184 3300006931 Ga0097620_100088526 Ga0097620_1000885262 247
185 3300013306 Ga0163162_10343624 Ga0163162_103436242 247
186 3300014325 Ga0163163_10000039 Ga0163163_1000003969 247
187 3300025907 Ga0207645_10041768 Ga0207645_100417682 247
188 3300025908 Ga0207643_10008956 Ga0207643_100089562 247
189 3300025923 Ga0207681_10033032 Ga0207681_100330323 247
190 3300025926 Ga0207659_10510307 Ga0207659_105103072 247
191 3300025938 Ga0207704_10268047 Ga0207704_102680472 247
192 3300025940 Ga0207691_10010978 Ga0207691_100109787 247
193 3300025960 Ga0207651_10091127 Ga0207651_100911272 247
194 3300025972 Ga0207668_10074867 Ga0207668_100748672 247
195 3300026023 Ga0207677_10160347 Ga0207677_101603471 247
196 3300026121 Ga0207683_10018093 Ga0207683_100180932 247
197 3300026142 Ga0207698_10191331 Ga0207698_101913312 247
198 3300028381 Ga0268264_10015656 Ga0268264_100156562 247
199 3300005328 Ga0070676_10002044 Ga0070676_100020443 248
200 3300005328 Ga0070676_10064471 Ga0070676_100644712 248
201 3300005331 Ga0070670_100167191 Ga0070670_1001671912 248
202 3300005334 Ga0068869_100011109 Ga0068869_1000111091 248
203 3300005334 Ga0068869_100174295 Ga0068869_1001742952 248
204 3300005340 Ga0070689_100470701 Ga0070689_1004707011 248
205 3300005347 Ga0070668_100093306 Ga0070668_1000933062 248
206 3300005353 Ga0070669_100010333 Ga0070669_1000103332 248
207 3300005355 Ga0070671_100231835 Ga0070671_1002318352 248
208 3300005364 Ga0070673_100058680 Ga0070673_1000586802 248
209 3300005367 Ga0070667_100021558 Ga0070667_1000215585 248
210 3300005455 Ga0070663_100427190 Ga0070663_1004271901 248
211 3300005456 Ga0070678_100177930 Ga0070678_1001779302 248
212 3300005457 Ga0070662_100012047 Ga0070662_1000120475 248
213 3300005539 Ga0068853_100486531 Ga0068853_1004865312 248
214 3300005543 Ga0070672_100013269 Ga0070672_1000132695 248
215 3300005564 Ga0070664_100234468 Ga0070664_1002344682 248
216 3300005617 Ga0068859_100025358 Ga0068859_1000253584 248
217 3300005718 Ga0068866_10001890 Ga0068866_100018902 248
218 3300005719 Ga0068861_100044446 Ga0068861_1000444464 248
219 3300005841 Ga0068863_100006737 Ga0068863_1000067374 248
220 3300005842 Ga0068858_100040886 Ga0068858_1000408862 248
221 3300006881 Ga0068865_100018347 Ga0068865_1000183472 248
222 3300006931 Ga0097620_100025359 Ga0097620_1000253594 248
223 3300009098 Ga0105245_10173897 Ga0105245_101738972 248
224 3300009148 Ga0105243_10020958 Ga0105243_100209584 248
225 3300009176 Ga0105242_10001775 Ga0105242_1000177510 248
226 3300013306 Ga0163162_10007086 Ga0163162_100070866 248
227 3300013308 Ga0157375_10000342 Ga0157375_1000034234 248
228 3300013308 Ga0157375_10030411 Ga0157375_100304114 248
229 3300014326 Ga0157380_10023836 Ga0157380_100238365 248
230 3300014969 Ga0157376_10002239 Ga0157376_100022393 248
231 3300025315 Ga0207697_10012117 Ga0207697_100121174 248
232 3300025893 Ga0207682_10011838 Ga0207682_100118382 248
233 3300025903 Ga0207680_10051797 Ga0207680_100517972 248
234 3300025907 Ga0207645_10002988 Ga0207645_1000298811 248
235 3300025918 Ga0207662_10003987 Ga0207662_100039875 248
236 3300025933 Ga0207706_10009694 Ga0207706_100096942 248
237 3300025934 Ga0207686_10005254 Ga0207686_100052542 248
238 3300025938 Ga0207704_10005663 Ga0207704_100056633 248
239 3300025940 Ga0207691_10001853 Ga0207691_1000185316 248
240 3300025940 Ga0207691_10019096 Ga0207691_100190967 248
241 3300025942 Ga0207689_10004439 Ga0207689_100044399 248
242 3300025945 Ga0207679_10120486 Ga0207679_101204862 248
243 3300025945 Ga0207679_10409687 Ga0207679_104096872 248
244 3300025960 Ga0207651_10014472 Ga0207651_100144724 248
245 3300025960 Ga0207651_10168943 Ga0207651_101689432 248
246 3300025961 Ga0207712_10055113 Ga0207712_100551132 248
247 3300025972 Ga0207668_10024666 Ga0207668_100246664 248
248 3300025986 Ga0207658_10006534 Ga0207658_100065346 248
249 3300026035 Ga0207703_10026909 Ga0207703_100269095 248
250 3300026067 Ga0207678_10215167 Ga0207678_102151672 248
251 3300026088 Ga0207641_10004384 Ga0207641_1000438412 248
252 3300026089 Ga0207648_10010341 Ga0207648_100103412 248
253 3300026089 Ga0207648_10229490 Ga0207648_102294902 248
254 3300026118 Ga0207675_100001089 Ga0207675_10000108919 248
255 3300026121 Ga0207683_10199833 Ga0207683_101998332 248
256 3300026142 Ga0207698_10074292 Ga0207698_100742923 248
257 3300028381 Ga0268264_10005552 Ga0268264_100055527 248
258 3300028794 Ga0307515_10012894 Ga0307515_100128944 248
259 3300035117 Ga0373953_0074659 Ga0373953_0074659_344_1156 248
260 3300035170 Ga0373943_0085756 Ga0373943_0085756_218_1030 248
261 3300036401 Ga0373937_0416352 Ga0373937_0416352_257_1069 248
262 3300037068 Ga0373925_0217126 Ga0373925_0217126_592_1404 248
263 3300042436 Ga0439435_0101752 Ga0439435_0101752_82_873 248
264 3300044712 Ga0453684_0375171 Ga0453684_0375171_46_870 248
265 3300046681 Ga0495647_0011922 Ga0495647_0011922_987_1799 248
266 3300046689 Ga0495613_0451568 Ga0495613_0451568_22_834 248
267 3300046809 Ga0495600_0065975 Ga0495600_0065975_1360_2172 248
268 3300047471 Ga0495684_0142614 Ga0495684_0142614_723_1535 248
269 3300048907 Ga0496104_0000017 Ga0496104_0000017_137804_138610 248
270 3300048908 Ga0496105_0000009 Ga0496105_0000009_264440_265246 248
271 3300049569 Ga0501032_0087926 Ga0501032_0087926_265_1041 248
272 3300049571 Ga0501034_0032339 Ga0501034_0032339_3389_4165 248
273 3300049574 Ga0501038_0087191 Ga0501038_0087191_793_1569 248
274 3300049575 Ga0501039_0239978 Ga0501039_0239978_65_841 248
275 3300049581 Ga0501047_0169081 Ga0501047_0169081_1050_1826 248
276 3300049583 Ga0501067_0016843 Ga0501067_0016843_33_809 248
277 3300049584 Ga0501068_0009244 Ga0501068_0009244_505_1281 248
278 3300049586 Ga0501070_0066342 Ga0501070_0066342_1964_2740 248
279 3300049588 Ga0501072_0020226 Ga0501072_0020226_2944_3720 248
280 3300049589 Ga0501073_0000406 Ga0501073_0000406_25518_26294 248
281 3300049741 Ga0501079_0049523 Ga0501079_0049523_2274_3050 248
282 3300049742 Ga0501080_0013933 Ga0501080_0013933_3098_3874 248
283 3300049744 Ga0501083_0008440 Ga0501083_0008440_3543_4319 248
284 3300049823 Ga0501044_0039840 Ga0501044_0039840_946_1722 248
285 3300053085 Ga0495619_0066884 Ga0495619_0066884_868_1680 248
286 3300060353 Ga0501082_0073547 Ga0501082_0073547_714_1490 248
287 3300003751 Ga0055538_1000050 Ga0055538_100005018 249
288 3300003752 Ga0055539_1000074 Ga0055539_100007418 249
289 3300003756 Ga0055533_1000081 Ga0055533_100008118 249
290 3300003759 Ga0055525_1000108 Ga0055525_1000108109 249
291 3300003841 Ga0055541_1000052 Ga0055541_100005218 249
292 3300005331 Ga0070670_100301718 Ga0070670_1003017182 249
293 3300005347 Ga0070668_100121787 Ga0070668_1001217872 249
294 3300005353 Ga0070669_100072979 Ga0070669_1000729792 249
295 3300005365 Ga0070688_100039876 Ga0070688_1000398762 249
296 3300005367 Ga0070667_100194438 Ga0070667_1001944382 249
297 3300005456 Ga0070678_100191615 Ga0070678_1001916152 249
298 3300005548 Ga0070665_100010042 Ga0070665_10001004212 249
299 3300005719 Ga0068861_100575234 Ga0068861_1005752342 249
300 3300005844 Ga0068862_100303568 Ga0068862_1003035682 249
301 3300025923 Ga0207681_10063258 Ga0207681_100632582 249
302 3300025925 Ga0207650_10207933 Ga0207650_102079332 249
303 3300025926 Ga0207659_10028796 Ga0207659_100287963 249
304 3300025972 Ga0207668_10105495 Ga0207668_101054952 249
305 3300025986 Ga0207658_10360477 Ga0207658_103604772 249
306 3300026089 Ga0207648_10364661 Ga0207648_103646612 249
307 3300026118 Ga0207675_100619853 Ga0207675_1006198532 249
308 3300028379 Ga0268266_10070034 Ga0268266_100700342 249
309 3300041507 Ga0451851_1081793 Ga0451851_1081793_19_825 249
310 iso_pu_bacteria 8002869464 8002870159 249
311 3300005262 Ga0065165_1003189 Ga0065165_100318911 250
312 3300005331 Ga0070670_100026051 Ga0070670_1000260515 250
313 3300005339 Ga0070660_100540062 Ga0070660_1005400621 250
314 3300005344 Ga0070661_100010169 Ga0070661_1000101692 250
315 3300005563 Ga0068855_100017679 Ga0068855_1000176792 250
316 3300005578 Ga0068854_100160310 Ga0068854_1001603102 250
317 3300005614 Ga0068856_100264635 Ga0068856_1002646352 250
318 3300005616 Ga0068852_100192627 Ga0068852_1001926273 250
319 3300005719 Ga0068861_100088337 Ga0068861_1000883372 250
320 3300005841 Ga0068863_100032649 Ga0068863_1000326494 250
321 3300009011 Ga0105251_10121771 Ga0105251_101217712 250
322 3300009174 Ga0105241_10035126 Ga0105241_100351262 250
323 3300009545 Ga0105237_10092651 Ga0105237_100926512 250
324 3300009551 Ga0105238_10005339 Ga0105238_100053396 250
325 3300010375 Ga0105239_10003023 Ga0105239_1000302314 250
326 3300013104 Ga0157370_10029183 Ga0157370_100291836 250
327 3300013296 Ga0157374_10386931 Ga0157374_103869312 250
328 3300013307 Ga0157372_10000819 Ga0157372_1000081926 250
329 3300014968 Ga0157379_10063497 Ga0157379_100634974 250
330 3300020081 Ga0206354_11034403 Ga0206354_110344032 250
331 3300025913 Ga0207695_10000393 Ga0207695_1000039323 250
332 3300025914 Ga0207671_10009835 Ga0207671_100098355 250
333 3300025920 Ga0207649_10051673 Ga0207649_100516732 250
334 3300025924 Ga0207694_10059542 Ga0207694_100595422 250
335 3300025925 Ga0207650_10049457 Ga0207650_100494574 250
336 3300025949 Ga0207667_10021057 Ga0207667_100210572 250
337 3300026041 Ga0207639_10000707 Ga0207639_1000070712 250
338 3300026078 Ga0207702_10481876 Ga0207702_104818762 250
339 3300026088 Ga0207641_10055413 Ga0207641_100554135 250
340 3300026142 Ga0207698_10207138 Ga0207698_102071382 250
341 3300028380 Ga0268265_10008941 Ga0268265_100089414 250
342 3300031548 Ga0307408_100004210 Ga0307408_10000421010 250
343 3300031731 Ga0307405_10029810 Ga0307405_100298105 250
344 3300031852 Ga0307410_10075979 Ga0307410_100759792 250
345 3300031901 Ga0307406_10008301 Ga0307406_100083014 250
346 3300031903 Ga0307407_10004929 Ga0307407_100049294 250
347 3300031911 Ga0307412_10091790 Ga0307412_100917902 250
348 3300031995 Ga0307409_100024545 Ga0307409_1000245456 250
349 3300032002 Ga0307416_100012737 Ga0307416_1000127373 250
350 3300032005 Ga0307411_10012698 Ga0307411_100126982 250
351 3300032126 Ga0307415_100001077 Ga0307415_1000010774 250
352 3300038443 Ga0395901_0015234 Ga0395901_0015234_253_1044 250
353 3300041408 Ga0439453_0005277 Ga0439453_0005277_328_1098 250
354 3300041997 Ga0439431_0096133 Ga0439431_0096133_15_785 250
355 3300042003 Ga0439443_010797 Ga0439443_010797_481_1251 250
356 3300042133 Ga0450896_002242 Ga0450896_002242_1092_1862 250
357 3300042134 Ga0450898_026334 Ga0450898_026334_111_881 250
358 3300042156 Ga0439446_0001503 Ga0439446_0001503_595_1365 250
359 3300042184 Ga0450908_001664 Ga0450908_001664_2770_3540 250
360 3300042435 Ga0439434_0002955 Ga0439434_0002955_3097_3867 250
361 3300042436 Ga0439435_0000148 Ga0439435_0000148_8238_9008 250
362 3300042437 Ga0439444_0000013 Ga0439444_0000013_4969_5739 250
363 3300046472 Ga0495580_0063827 Ga0495580_0063827_536_1366 250
364 3300046615 Ga0495656_0209541 Ga0495656_0209541_91_855 250
365 3300046683 Ga0495658_0137919 Ga0495658_0137919_452_1282 250
366 3300048906 Ga0496103_0016203 Ga0496103_0016203_2812_3579 250
367 3300050496 nmdc:mga07m45_4968_c1 nmdc:mga07m45_4968_c1_5347_6150 250
368 3300053130 Ga0500642_0052515 Ga0500642_0052515_763_1557 250
369 iso_pu_bacteria 2571042365 2572253608 250
370 iso_pu_bacteria 2643221586 2643941256 250
371 3300009177 Ga0105248_10009399 Ga0105248_1000939910 251
372 3300025909 Ga0207705_10059867 Ga0207705_100598672 251
373 3300025919 Ga0207657_10069966 Ga0207657_100699663 251
374 3300025921 Ga0207652_10643471 Ga0207652_106434711 251
375 3300025941 Ga0207711_10023415 Ga0207711_100234153 251
376 3300025945 Ga0207679_10366814 Ga0207679_103668141 251
377 3300026078 Ga0207702_10013708 Ga0207702_100137084 251
378 3300026095 Ga0207676_10122949 Ga0207676_101229492 251
379 3300032004 Ga0307414_10009513 Ga0307414_100095135 251
380 3300041452 Ga0451793_1438105 Ga0451793_1438105_1916_2704 251
381 3300041453 Ga0451797_0572638 Ga0451797_0572638_331_1119 251
382 3300041486 Ga0451807_0720322 Ga0451807_0720322_3268_4056 251
383 3300041494 Ga0451837_0074019 Ga0451837_0074019_158_946 251
384 3300046615 Ga0495656_0011107 Ga0495656_0011107_1590_2378 251
385 3300047318 Ga0495636_0024512 Ga0495636_0024512_721_1509 251
386 3300048904 Ga0496101_0122931 Ga0496101_0122931_1057_1845 251
387 3300048907 Ga0496104_0439809 Ga0496104_0439809_125_934 251
388 3300048910 Ga0496107_0097807 Ga0496107_0097807_290_1078 251
389 3300048912 Ga0496109_0703952 Ga0496109_0703952_101_889 251
390 3300048916 Ga0496113_0073437 Ga0496113_0073437_1518_2306 251
391 3300048927 Ga0496124_0254628 Ga0496124_0254628_88_876 251
392 3300005329 Ga0070683_100197012 Ga0070683_1001970122 252
393 3300005331 Ga0070670_100087124 Ga0070670_1000871243 252
394 3300005333 Ga0070677_10036912 Ga0070677_100369122 252
395 3300025920 Ga0207649_10432940 Ga0207649_104329402 252
396 3300025944 Ga0207661_10149050 Ga0207661_101490502 252
397 3300026121 Ga0207683_10077599 Ga0207683_100775992 252
398 3300031548 Ga0307408_100233454 Ga0307408_1002334542 252
399 3300031824 Ga0307413_10536888 Ga0307413_105368882 252
400 3300032004 Ga0307414_10013206 Ga0307414_100132063 252
401 3300041451 Ga0451791_1002939 Ga0451791_1002939_524_1291 252
402 3300041453 Ga0451797_0531083 Ga0451797_0531083_989_1756 252
403 3300041460 Ga0451802_2089645 Ga0451802_2089645_918_1685 252
404 3300041486 Ga0451807_0034953 Ga0451807_0034953_820_1587 252
405 3300041486 Ga0451807_2299026 Ga0451807_2299026_467_1240 252
406 3300041494 Ga0451837_0154854 Ga0451837_0154854_3304_4071 252
407 3300041509 Ga0451843_0906883 Ga0451843_0906883_425_1192 252
408 3300042993 Ga0439440_0010489 Ga0439440_0010489_590_1369 252
409 3300049823 Ga0501044_0523323 Ga0501044_0523323_104_898 252
410 3300005330 Ga0070690_100360797 Ga0070690_1003607972 253
411 3300005354 Ga0070675_100500252 Ga0070675_1005002521 253
412 3300005539 Ga0068853_100228867 Ga0068853_1002288672 253
413 3300005543 Ga0070672_100160355 Ga0070672_1001603551 253
414 3300009551 Ga0105238_10111709 Ga0105238_101117093 253
415 3300025926 Ga0207659_10485655 Ga0207659_104856552 253
416 3300025940 Ga0207691_10011066 Ga0207691_100110666 253
417 3300027360 Ga0209969_1003420 Ga0209969_10034202 253
418 3300027471 Ga0209995_1001196 Ga0209995_10011964 253
419 3300027543 Ga0209999_1001155 Ga0209999_10011553 253
420 3300027552 Ga0209982_1007820 Ga0209982_10078201 253
421 3300027614 Ga0209970_1006128 Ga0209970_10061282 253
422 3300027682 Ga0209971_1000369 Ga0209971_100036912 253
423 3300027876 Ga0209974_10031131 Ga0209974_100311311 253
424 3300032002 Ga0307416_100152973 Ga0307416_1001529732 253
425 3300032004 Ga0307414_10038848 Ga0307414_100388484 253
426 3300032004 Ga0307414_10143286 Ga0307414_101432863 253
427 3300032004 Ga0307414_10695192 Ga0307414_106951922 253
428 3300032005 Ga0307411_10406493 Ga0307411_104064932 253
429 3300041413 Ga0439465_0016461 Ga0439465_0016461_463_1239 253
430 3300041494 Ga0451837_0692191 Ga0451837_0692191_1172_1942 253
431 3300041509 Ga0451843_0190080 Ga0451843_0190080_2409_3179 253
432 3300046537 Ga0495598_0000828 Ga0495598_0000828_1156_1926 253
433 3300046615 Ga0495656_0064915 Ga0495656_0064915_760_1533 253
434 3300046664 Ga0495659_0032880 Ga0495659_0032880_338_1111 253
435 3300046691 Ga0495670_0270838 Ga0495670_0270838_37_798 253
436 3300047318 Ga0495636_0001496 Ga0495636_0001496_7407_8180 253
437 3300003320 rootH2_10233592 rootH2_102335921 254
438 3300005347 Ga0070668_100008286 Ga0070668_1000082868 254
439 3300005367 Ga0070667_100043777 Ga0070667_1000437774 254
440 3300005440 Ga0070705_100083324 Ga0070705_1000833243 254
441 3300005456 Ga0070678_100134707 Ga0070678_1001347072 254
442 3300005459 Ga0068867_100071423 Ga0068867_1000714233 254
443 3300005617 Ga0068859_100000776 Ga0068859_10000077617 254
444 3300005834 Ga0068851_10060285 Ga0068851_100602852 254
445 3300005841 Ga0068863_100176168 Ga0068863_1001761682 254
446 3300005843 Ga0068860_100020846 Ga0068860_1000208466 254
447 3300005844 Ga0068862_100099071 Ga0068862_1000990712 254
448 3300006931 Ga0097620_100000776 Ga0097620_10000077617 254
449 3300009176 Ga0105242_10042998 Ga0105242_100429982 254
450 3300009177 Ga0105248_10148113 Ga0105248_101481132 254
451 3300009979 Ga0105032_100445 Ga0105032_1004452 254
452 3300012512 Ga0157327_1000667 Ga0157327_10006672 254
453 3300014326 Ga0157380_10062017 Ga0157380_100620173 254
454 3300014968 Ga0157379_10076628 Ga0157379_100766284 254
455 3300025931 Ga0207644_10158889 Ga0207644_101588893 254
456 3300025933 Ga0207706_10161558 Ga0207706_101615582 254
457 3300025941 Ga0207711_10212968 Ga0207711_102129682 254
458 3300025972 Ga0207668_10005000 Ga0207668_100050006 254
459 3300025986 Ga0207658_10252610 Ga0207658_102526102 254
460 3300026089 Ga0207648_10088816 Ga0207648_100888163 254
461 3300026118 Ga0207675_100388152 Ga0207675_1003881522 254
462 3300026121 Ga0207683_10010465 Ga0207683_100104652 254
463 3300028379 Ga0268266_10063379 Ga0268266_100633792 254
464 3300031456 Ga0307513_10138369 Ga0307513_101383692 254
465 3300031548 Ga0307408_100441028 Ga0307408_1004410282 254
466 3300031548 Ga0307408_100536294 Ga0307408_1005362942 254
467 3300031852 Ga0307410_10057177 Ga0307410_100571773 254
468 3300031901 Ga0307406_10391676 Ga0307406_103916762 254
469 3300031911 Ga0307412_10121164 Ga0307412_101211642 254
470 3300031911 Ga0307412_10168796 Ga0307412_101687962 254
471 3300031911 Ga0307412_10413563 Ga0307412_104135632 254
472 3300031995 Ga0307409_100175759 Ga0307409_1001757591 254
473 3300031995 Ga0307409_100758402 Ga0307409_1007584022 254
474 3300032002 Ga0307416_101119200 Ga0307416_1011192001 254
475 3300032005 Ga0307411_10016663 Ga0307411_100166634 254
476 3300041494 Ga0451837_0205854 Ga0451837_0205854_1220_1993 254
477 3300042006 Ga0439432_061071 Ga0439432_061071_190_966 254
478 3300046525 Ga0495663_0016213 Ga0495663_0016213_465_1253 254
479 3300046539 Ga0495621_0000271 Ga0495621_0000271_86_880 254
480 3300046558 Ga0495633_0110071 Ga0495633_0110071_375_1169 254
481 3300048911 Ga0496108_0185991 Ga0496108_0185991_148_936 254
482 3300048913 Ga0496110_0127916 Ga0496110_0127916_1229_2017 254
483 3300048914 Ga0496111_0208339 Ga0496111_0208339_85_873 254
484 3300049705 Ga0501225_0028958 Ga0501225_0028958_597_1373 254
485 3300005331 Ga0070670_100009164 Ga0070670_1000091647 255
486 3300005338 Ga0068868_100482202 Ga0068868_1004822021 255
487 3300005343 Ga0070687_100040405 Ga0070687_1000404053 255
488 3300005353 Ga0070669_100027042 Ga0070669_1000270422 255
489 3300005354 Ga0070675_100098599 Ga0070675_1000985992 255
490 3300005545 Ga0070695_100153380 Ga0070695_1001533802 255
491 3300005842 Ga0068858_100067440 Ga0068858_1000674403 255
492 3300009148 Ga0105243_10071783 Ga0105243_100717832 255
493 3300014326 Ga0157380_10137847 Ga0157380_101378472 255
494 3300025926 Ga0207659_10112883 Ga0207659_101128832 255
495 3300025935 Ga0207709_10127947 Ga0207709_101279472 255
496 3300025940 Ga0207691_10098906 Ga0207691_100989062 255
497 3300026095 Ga0207676_10189588 Ga0207676_101895882 255
498 3300026118 Ga0207675_100108512 Ga0207675_1001085123 255
499 3300028380 Ga0268265_10029219 Ga0268265_100292193 255
500 3300028381 Ga0268264_10063478 Ga0268264_100634782 255
501 3300031824 Ga0307413_10000876 Ga0307413_100008768 255
502 3300031903 Ga0307407_10095458 Ga0307407_100954582 255
503 3300032002 Ga0307416_100088403 Ga0307416_1000884033 255
504 3300041997 Ga0439431_0035802 Ga0439431_0035802_395_1183 255
505 3300044712 Ga0453684_0002611 Ga0453684_0002611_2615_3400 255
506 3300045051 Ga0451576_0000042 Ga0451576_0000042_168666_169451 255
507 3300002074 JGI24748J21848_1002862 JGI24748J21848_10028623 256
508 3300005290 Ga0065712_10088811 Ga0065712_100888112 256
509 3300005293 Ga0065715_10102977 Ga0065715_101029772 256
510 3300005328 Ga0070676_10040815 Ga0070676_100408152 256
511 3300005328 Ga0070676_10260102 Ga0070676_102601022 256
512 3300005329 Ga0070683_100025851 Ga0070683_1000258512 256
513 3300005330 Ga0070690_100015015 Ga0070690_1000150155 256
514 3300005330 Ga0070690_100115459 Ga0070690_1001154592 256
515 3300005331 Ga0070670_100002614 Ga0070670_1000026143 256
516 3300005331 Ga0070670_100080610 Ga0070670_1000806102 256
517 3300005333 Ga0070677_10004837 Ga0070677_100048374 256
518 3300005334 Ga0068869_100001806 Ga0068869_1000018065 256
519 3300005334 Ga0068869_100002842 Ga0068869_1000028427 256
520 3300005335 Ga0070666_10024486 Ga0070666_100244863 256
521 3300005338 Ga0068868_100340508 Ga0068868_1003405082 256
522 3300005338 Ga0068868_100424659 Ga0068868_1004246592 256
523 3300005339 Ga0070660_100137406 Ga0070660_1001374062 256
524 3300005340 Ga0070689_100008018 Ga0070689_1000080182 256
525 3300005343 Ga0070687_100001711 Ga0070687_1000017112 256
526 3300005343 Ga0070687_100157953 Ga0070687_1001579532 256
527 3300005344 Ga0070661_100016872 Ga0070661_1000168724 256
528 3300005353 Ga0070669_100010212 Ga0070669_1000102126 256
529 3300005353 Ga0070669_100043416 Ga0070669_1000434164 256
530 3300005354 Ga0070675_100435209 Ga0070675_1004352092 256
531 3300005355 Ga0070671_100439103 Ga0070671_1004391032 256
532 3300005356 Ga0070674_100017689 Ga0070674_1000176894 256
533 3300005364 Ga0070673_100055743 Ga0070673_1000557432 256
534 3300005366 Ga0070659_100364430 Ga0070659_1003644302 256
535 3300005367 Ga0070667_100003163 Ga0070667_10000316312 256
536 3300005438 Ga0070701_10007331 Ga0070701_100073315 256
537 3300005441 Ga0070700_100012120 Ga0070700_1000121205 256
538 3300005455 Ga0070663_100036767 Ga0070663_1000367674 256
539 3300005456 Ga0070678_100039202 Ga0070678_1000392023 256
540 3300005456 Ga0070678_100216465 Ga0070678_1002164652 256
541 3300005457 Ga0070662_100011591 Ga0070662_1000115915 256
542 3300005459 Ga0068867_100014646 Ga0068867_1000146468 256
543 3300005459 Ga0068867_100060893 Ga0068867_1000608934 256
544 3300005466 Ga0070685_10004729 Ga0070685_100047294 256
545 3300005535 Ga0070684_100034625 Ga0070684_1000346252 256
546 3300005539 Ga0068853_100151009 Ga0068853_1001510092 256
547 3300005543 Ga0070672_100015758 Ga0070672_1000157584 256
548 3300005543 Ga0070672_100296881 Ga0070672_1002968812 256
549 3300005544 Ga0070686_100244428 Ga0070686_1002444282 256
550 3300005548 Ga0070665_100262431 Ga0070665_1002624311 256
551 3300005563 Ga0068855_100244969 Ga0068855_1002449692 256
552 3300005564 Ga0070664_100229845 Ga0070664_1002298451 256
553 3300005577 Ga0068857_100026365 Ga0068857_1000263653 256
554 3300005577 Ga0068857_100041636 Ga0068857_1000416364 256
555 3300005614 Ga0068856_100092087 Ga0068856_1000920872 256
556 3300005615 Ga0070702_100004798 Ga0070702_1000047984 256
557 3300005615 Ga0070702_100051557 Ga0070702_1000515573 256
558 3300005617 Ga0068859_100001589 Ga0068859_1000015892 256
559 3300005617 Ga0068859_100034355 Ga0068859_1000343554 256
560 3300005618 Ga0068864_100002477 Ga0068864_1000024775 256
561 3300005718 Ga0068866_10003270 Ga0068866_100032703 256
562 3300005719 Ga0068861_100004069 Ga0068861_1000040692 256
563 3300005719 Ga0068861_100011595 Ga0068861_1000115954 256
564 3300005834 Ga0068851_10006652 Ga0068851_100066522 256
565 3300005840 Ga0068870_10007244 Ga0068870_100072444 256
566 3300005840 Ga0068870_10012938 Ga0068870_100129382 256
567 3300005840 Ga0068870_10055645 Ga0068870_100556453 256
568 3300005841 Ga0068863_100020088 Ga0068863_1000200889 256
569 3300005841 Ga0068863_100027507 Ga0068863_1000275073 256
570 3300005841 Ga0068863_100150402 Ga0068863_1001504021 256
571 3300005842 Ga0068858_100023672 Ga0068858_1000236724 256
572 3300005842 Ga0068858_100047410 Ga0068858_1000474102 256
573 3300005843 Ga0068860_100003196 Ga0068860_1000031968 256
574 3300005843 Ga0068860_100018088 Ga0068860_1000180885 256
575 3300005844 Ga0068862_100042009 Ga0068862_1000420096 256
576 3300005844 Ga0068862_100062463 Ga0068862_1000624634 256
577 3300005844 Ga0068862_100118337 Ga0068862_1001183371 256
578 3300006237 Ga0097621_100121296 Ga0097621_1001212963 256
579 3300006237 Ga0097621_100164075 Ga0097621_1001640753 256
580 3300006358 Ga0068871_100067442 Ga0068871_1000674423 256
581 3300006358 Ga0068871_100586657 Ga0068871_1005866572 256
582 3300006881 Ga0068865_100044512 Ga0068865_1000445122 256
583 3300006931 Ga0097620_100001589 Ga0097620_1000015892 256
584 3300006931 Ga0097620_100034354 Ga0097620_1000343543 256
585 3300009094 Ga0111539_10027664 Ga0111539_100276645 256
586 3300009098 Ga0105245_10940961 Ga0105245_109409611 256
587 3300009101 Ga0105247_10031046 Ga0105247_100310461 256
588 3300009148 Ga0105243_10067659 Ga0105243_100676593 256
589 3300009177 Ga0105248_10003392 Ga0105248_100033924 256
590 3300009553 Ga0105249_10028167 Ga0105249_100281674 256
591 3300011119 Ga0105246_10014664 Ga0105246_100146642 256
592 3300013296 Ga0157374_10169624 Ga0157374_101696242 256
593 3300013297 Ga0157378_10025796 Ga0157378_100257963 256
594 3300013297 Ga0157378_10179787 Ga0157378_101797871 256
595 3300013306 Ga0163162_10061859 Ga0163162_100618594 256
596 3300013308 Ga0157375_10095250 Ga0157375_100952504 256
597 3300014325 Ga0163163_10009155 Ga0163163_100091554 256
598 3300014325 Ga0163163_10028200 Ga0163163_100282002 256
599 3300014326 Ga0157380_10029238 Ga0157380_100292384 256
600 3300014745 Ga0157377_10007567 Ga0157377_100075674 256
601 3300014968 Ga0157379_10004427 Ga0157379_100044274 256
602 3300014968 Ga0157379_10061419 Ga0157379_100614192 256
603 3300025271 Ga0207666_1000950 Ga0207666_10009504 256
604 3300025315 Ga0207697_10001006 Ga0207697_1000100615 256
605 3300025893 Ga0207682_10001109 Ga0207682_100011098 256
606 3300025899 Ga0207642_10035094 Ga0207642_100350943 256
607 3300025901 Ga0207688_10003400 Ga0207688_100034007 256
608 3300025903 Ga0207680_10132317 Ga0207680_101323172 256
609 3300025907 Ga0207645_10314687 Ga0207645_103146872 256
610 3300025908 Ga0207643_10005604 Ga0207643_100056046 256
611 3300025908 Ga0207643_10008853 Ga0207643_100088535 256
612 3300025908 Ga0207643_10009803 Ga0207643_100098033 256
613 3300025918 Ga0207662_10003299 Ga0207662_100032997 256
614 3300025918 Ga0207662_10070967 Ga0207662_100709672 256
615 3300025919 Ga0207657_10005814 Ga0207657_100058146 256
616 3300025923 Ga0207681_10009555 Ga0207681_100095557 256
617 3300025923 Ga0207681_10033643 Ga0207681_100336432 256
618 3300025923 Ga0207681_10059392 Ga0207681_100593922 256
619 3300025925 Ga0207650_10007995 Ga0207650_100079954 256
620 3300025925 Ga0207650_10023808 Ga0207650_100238084 256
621 3300025926 Ga0207659_10032629 Ga0207659_100326292 256
622 3300025931 Ga0207644_10014629 Ga0207644_100146294 256
623 3300025931 Ga0207644_10343835 Ga0207644_103438352 256
624 3300025933 Ga0207706_10005220 Ga0207706_100052205 256
625 3300025935 Ga0207709_10015946 Ga0207709_100159464 256
626 3300025936 Ga0207670_10060810 Ga0207670_100608104 256
627 3300025937 Ga0207669_10021717 Ga0207669_100217174 256
628 3300025940 Ga0207691_10018633 Ga0207691_100186334 256
629 3300025940 Ga0207691_10303503 Ga0207691_103035032 256
630 3300025941 Ga0207711_10011042 Ga0207711_100110423 256
631 3300025942 Ga0207689_10004356 Ga0207689_100043565 256
632 3300025942 Ga0207689_10004366 Ga0207689_1000436613 256
633 3300025960 Ga0207651_10016899 Ga0207651_100168993 256
634 3300025961 Ga0207712_10106353 Ga0207712_101063533 256
635 3300025972 Ga0207668_10064389 Ga0207668_100643892 256
636 3300025986 Ga0207658_10007612 Ga0207658_100076125 256
637 3300026023 Ga0207677_10070361 Ga0207677_100703612 256
638 3300026023 Ga0207677_10100221 Ga0207677_101002212 256
639 3300026035 Ga0207703_10004627 Ga0207703_1000462711 256
640 3300026035 Ga0207703_10032798 Ga0207703_100327984 256
641 3300026041 Ga0207639_10106777 Ga0207639_101067772 256
642 3300026067 Ga0207678_10032358 Ga0207678_100323585 256
643 3300026075 Ga0207708_10003088 Ga0207708_100030888 256
644 3300026078 Ga0207702_10354488 Ga0207702_103544882 256
645 3300026088 Ga0207641_10057327 Ga0207641_100573273 256
646 3300026089 Ga0207648_10015262 Ga0207648_100152624 256
647 3300026095 Ga0207676_10023223 Ga0207676_100232234 256
648 3300026095 Ga0207676_10026809 Ga0207676_100268094 256
649 3300026116 Ga0207674_10005202 Ga0207674_100052025 256
650 3300026116 Ga0207674_10034188 Ga0207674_100341887 256
651 3300026118 Ga0207675_100006423 Ga0207675_10000642314 256
652 3300026118 Ga0207675_100007214 Ga0207675_1000072147 256
653 3300026121 Ga0207683_10102674 Ga0207683_101026743 256
654 3300026121 Ga0207683_10161436 Ga0207683_101614362 256
655 3300026142 Ga0207698_10045861 Ga0207698_100458612 256
656 3300028379 Ga0268266_10264261 Ga0268266_102642612 256
657 3300028380 Ga0268265_10025546 Ga0268265_100255466 256
658 3300028380 Ga0268265_10028035 Ga0268265_100280354 256
659 3300028380 Ga0268265_10154826 Ga0268265_101548262 256
660 3300028381 Ga0268264_10002324 Ga0268264_1000232412 256
661 3300028381 Ga0268264_10741048 Ga0268264_107410482 256
662 3300035170 Ga0373943_0167539 Ga0373943_0167539_74_844 256
663 3300035171 Ga0373946_0053028 Ga0373946_0053028_124_894 256
664 3300035725 Ga0373947_0082224 Ga0373947_0082224_454_1224 256
665 3300046537 Ga0495598_0025574 Ga0495598_0025574_132_902 256
666 3300048903 Ga0496100_0123979 Ga0496100_0123979_857_1627 256
667 3300048904 Ga0496101_0031890 Ga0496101_0031890_1034_1804 256
668 3300048905 Ga0496102_0156312 Ga0496102_0156312_903_1673 256
669 3300048907 Ga0496104_0112629 Ga0496104_0112629_669_1439 256
670 3300048908 Ga0496105_0387104 Ga0496105_0387104_179_949 256
671 3300048909 Ga0496106_0047660 Ga0496106_0047660_1983_2753 256
672 3300048909 Ga0496106_0283314 Ga0496106_0283314_102_872 256
673 3300048910 Ga0496107_0043602 Ga0496107_0043602_903_1673 256
674 3300048911 Ga0496108_0016568 Ga0496108_0016568_3351_4121 256
675 3300048912 Ga0496109_0031279 Ga0496109_0031279_819_1589 256
676 3300048913 Ga0496110_0016522 Ga0496110_0016522_1814_2584 256
677 3300048916 Ga0496113_0158950 Ga0496113_0158950_412_1182 256
678 3300048917 Ga0496114_0055839 Ga0496114_0055839_1545_2315 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

36

269

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pf5-assembly5.cif.gz_E crystal structure of the human tsg-6 link module 0.7966 109 134
2pf5-assembly3.cif.gz_C crystal structure of the human tsg-6 link module 0.7463 108 139
2pf5-assembly2.cif.gz_B crystal structure of the human tsg-6 link module 0.734 108 139
2i83-assembly1.cif.gz_A hyaluronan-binding domain of cd44 in its ligand-bound form 0.7335 106 140
2pf5-assembly4.cif.gz_D crystal structure of the human tsg-6 link module 0.7324 108 139
ID Description Score Start End Superfamily
af_A0A2R8QLT6_37_131_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.815 105 134 3.10.100.10
af_Q8R4U0_2206_2297_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.8001 106 134 3.10.100.10
af_A8WFK8_153_292_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7876 103 126 3.10.100.10
af_A0A2R8RJD1_252_376_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7467 109 131 3.10.100.10
af_D4A3B8_261_389_3.10.100.10 Alpha Beta;Roll;Mannose-Binding Protein A; Chain A;Mannose-Binding Protein A, subunit A 0.7412 109 133 3.10.100.10
ID Description Score Start End GO Terms
AF-A0A2W4MCI1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9348 24 253 GO:0120147
AF-A0A401K024-F1-model_v4 Probable signal peptide protein 0.9327 23 206 GO:0120147
AF-A0A350EQC3-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9304 24 171 GO:0120147
AF-A0A2W4MCI1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9269 24 253 GO:0120147
AF-A0A350EQC3-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9185 24 171 GO:0120147

Feature Viewer

pLDDT pTM Quality
82.54 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map