F474658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 678 | 249 | 1356 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10478970|Ga0207683_104789701 |
| Length | 160 |
| Sequence | MAQQWNPLQDLMVLQDRMNRLFEDATQRRANTDGDEFERTDWTPPADIYEVTSGYVIAIDLPGISRDAVEIDVDDNRLIVKGTRLVEESRHRSERPRGKFLRTFTIPGSVDQESIGAEYKDGVLNIRLPKRQEQKAQKRIDSLSRTGPALGHGGSAWGPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 174 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 175 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 187 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 188 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 189 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 190 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 191 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 192 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 193 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 194 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 196 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 197 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 198 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 199 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 201 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 202 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 205 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 211 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 212 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 216 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 218 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 220 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 225 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 227 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 230 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 232 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 233 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 234 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 236 | 3300049849 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 97.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207683_10478970 | 3300026121 | Bacteria | 1149 |
| 2 | SwRhRL2b_contig_1788179 | 2162886007 | Bacteria | 967 |
| 3 | CNAas_1000555 | 3300000532 | Bacteria | 3606 |
| 4 | JGI24751J29686_10000104 | 3300002459 | Bacteria | 46525 |
| 5 | JGI25406J46586_10000683 | 3300003203 | Bacteria | 15765 |
| 6 | rootH2_10085677 | 3300003320 | Bacteria | 1995 |
| 7 | rootL2_10122771 | 3300003322 | Bacteria | 1635 |
| 8 | Ga0065714_10168816 | 3300005288 | Bacteria | 1014 |
| 9 | Ga0065704_10006025 | 3300005289 | Bacteria | 5614 |
| 10 | Ga0065704_10384945 | 3300005289 | Unclassified | 769 |
| 11 | Ga0065712_10001505 | 3300005290 | Bacteria | 7032 |
| 12 | Ga0065712_10003789 | 3300005290 | Bacteria | 4279 |
| 13 | Ga0065712_10016812 | 3300005290 | Bacteria | 2412 |
| 14 | Ga0065712_10067727 | 3300005290 | Bacteria | 189643 |
| 15 | Ga0065712_10145848 | 3300005290 | Unclassified | 1407 |
| 16 | Ga0065712_10150664 | 3300005290 | Bacteria | 1372 |
| 17 | Ga0065715_10013317 | 3300005293 | Bacteria | 1902 |
| 18 | Ga0065715_10073066 | 3300005293 | Unclassified | 683 |
| 19 | Ga0065715_10088941 | 3300005293 | Bacteria | 22679 |
| 20 | Ga0065715_10191139 | 3300005293 | Bacteria | 1414 |
| 21 | Ga0065715_10210241 | 3300005293 | Bacteria | 1315 |
| 22 | Ga0065715_10226594 | 3300005293 | Bacteria | 1247 |
| 23 | Ga0065715_10262753 | 3300005293 | Bacteria | 1133 |
| 24 | Ga0065715_10793953 | 3300005293 | Unclassified | 609 |
| 25 | Ga0065707_10002690 | 3300005295 | Bacteria | 4408 |
| 26 | Ga0065707_10015464 | 3300005295 | Bacteria | 2099 |
| 27 | Ga0065707_10129673 | 3300005295 | Bacteria | 1943 |
| 28 | Ga0065707_10559008 | 3300005295 | Unclassified | 655 |
| 29 | Ga0070676_10064199 | 3300005328 | Bacteria | 2189 |
| 30 | Ga0070670_100069688 | 3300005331 | Bacteria | 3019 |
| 31 | Ga0070670_100086259 | 3300005331 | Bacteria | 2697 |
| 32 | Ga0070670_100216658 | 3300005331 | Bacteria | 1665 |
| 33 | Ga0070670_100313178 | 3300005331 | Bacteria | 1374 |
| 34 | Ga0070670_101117874 | 3300005331 | Unclassified | 719 |
| 35 | Ga0070670_101702533 | 3300005331 | Unclassified | 580 |
| 36 | Ga0070677_10797277 | 3300005333 | Unclassified | 539 |
| 37 | Ga0068869_100254331 | 3300005334 | Bacteria | 1404 |
| 38 | Ga0070680_100061867 | 3300005336 | Bacteria | 3065 |
| 39 | Ga0070680_100204505 | 3300005336 | Unclassified | 1665 |
| 40 | Ga0070682_100400579 | 3300005337 | Unclassified | 1038 |
| 41 | Ga0068868_100525816 | 3300005338 | Unclassified | 1039 |
| 42 | Ga0068868_100536690 | 3300005338 | Bacteria | 1029 |
| 43 | Ga0068868_101251249 | 3300005338 | Unclassified | 688 |
| 44 | Ga0070660_100420912 | 3300005339 | Bacteria | 1106 |
| 45 | Ga0070689_100000508 | 3300005340 | Bacteria | 22987 |
| 46 | Ga0070691_10153982 | 3300005341 | Bacteria | 1180 |
| 47 | Ga0070687_100158762 | 3300005343 | Bacteria | 1335 |
| 48 | Ga0070692_10021428 | 3300005345 | Bacteria | 3143 |
| 49 | Ga0070692_10054702 | 3300005345 | Bacteria | 2085 |
| 50 | Ga0070692_10448503 | 3300005345 | Unclassified | 825 |
| 51 | Ga0070692_11010678 | 3300005345 | Unclassified | 582 |
| 52 | Ga0070669_100314954 | 3300005353 | Bacteria | 1262 |
| 53 | Ga0070669_100711791 | 3300005353 | Unclassified | 848 |
| 54 | Ga0070669_101343606 | 3300005353 | Unclassified | 619 |
| 55 | Ga0070675_100531617 | 3300005354 | Bacteria | 1062 |
| 56 | Ga0070671_100006772 | 3300005355 | Bacteria | 9167 |
| 57 | Ga0070673_100087769 | 3300005364 | Bacteria | 2536 |
| 58 | Ga0070673_100275143 | 3300005364 | Unclassified | 1475 |
| 59 | Ga0070673_101181664 | 3300005364 | Unclassified | 716 |
| 60 | Ga0070673_101811848 | 3300005364 | Unclassified | 578 |
| 61 | Ga0070688_100300034 | 3300005365 | Bacteria | 1161 |
| 62 | Ga0070659_100011984 | 3300005366 | Bacteria | 6419 |
| 63 | Ga0070659_100292121 | 3300005366 | Bacteria | 1358 |
| 64 | Ga0070659_100431241 | 3300005366 | Bacteria | 1116 |
| 65 | Ga0070667_101228906 | 3300005367 | Unclassified | 701 |
| 66 | Ga0070701_10141682 | 3300005438 | Bacteria | 1376 |
| 67 | Ga0070701_10620193 | 3300005438 | Unclassified | 718 |
| 68 | Ga0070705_100018555 | 3300005440 | Bacteria | 3648 |
| 69 | Ga0070705_100323743 | 3300005440 | Unclassified | 1114 |
| 70 | Ga0070700_100051084 | 3300005441 | Bacteria | 2573 |
| 71 | Ga0070700_100065981 | 3300005441 | Bacteria | 2296 |
| 72 | Ga0070700_100080878 | 3300005441 | Bacteria | 2098 |
| 73 | Ga0070700_100151244 | 3300005441 | Bacteria | 1588 |
| 74 | Ga0070700_100304469 | 3300005441 | Bacteria | 1165 |
| 75 | Ga0070700_100623752 | 3300005441 | Bacteria | 848 |
| 76 | Ga0070700_100683421 | 3300005441 | Unclassified | 814 |
| 77 | Ga0070694_100097389 | 3300005444 | Bacteria | 2075 |
| 78 | Ga0070694_100114342 | 3300005444 | Bacteria | 1927 |
| 79 | Ga0070694_100141572 | 3300005444 | Bacteria | 1748 |
| 80 | Ga0070708_100312124 | 3300005445 | Bacteria | 1481 |
| 81 | Ga0070662_100125827 | 3300005457 | Bacteria | 1970 |
| 82 | Ga0070662_100753067 | 3300005457 | Unclassified | 826 |
| 83 | Ga0070681_10000735 | 3300005458 | Bacteria | 27091 |
| 84 | Ga0068867_100150749 | 3300005459 | Unclassified | 1826 |
| 85 | Ga0068867_100421922 | 3300005459 | Unclassified | 1130 |
| 86 | Ga0068867_100783862 | 3300005459 | Bacteria | 849 |
| 87 | Ga0070685_10025533 | 3300005466 | Bacteria | 3253 |
| 88 | Ga0070706_100000053 | 3300005467 | Bacteria | 139565 |
| 89 | Ga0070707_100025697 | 3300005468 | Bacteria | 5589 |
| 90 | Ga0070707_100348655 | 3300005468 | Bacteria | 1438 |
| 91 | Ga0070698_100033893 | 3300005471 | Bacteria | 5289 |
| 92 | Ga0070699_100078021 | 3300005518 | Bacteria | 2884 |
| 93 | Ga0070699_100189534 | 3300005518 | Bacteria | 1826 |
| 94 | Ga0070699_100308257 | 3300005518 | Bacteria | 1421 |
| 95 | Ga0070699_100664779 | 3300005518 | Bacteria | 951 |
| 96 | Ga0070699_100831422 | 3300005518 | Unclassified | 845 |
| 97 | Ga0070679_100020112 | 3300005530 | Bacteria | 6505 |
| 98 | Ga0070679_100143502 | 3300005530 | Bacteria | 2366 |
| 99 | Ga0070679_101031389 | 3300005530 | Bacteria | 767 |
| 100 | Ga0070684_100101712 | 3300005535 | Bacteria | 2568 |
| 101 | Ga0070697_100240387 | 3300005536 | Bacteria | 1546 |
| 102 | Ga0068853_100021378 | 3300005539 | Bacteria | 5394 |
| 103 | Ga0068853_100043276 | 3300005539 | Bacteria | 3852 |
| 104 | Ga0068853_100661664 | 3300005539 | Unclassified | 995 |
| 105 | Ga0068853_101527038 | 3300005539 | Unclassified | 647 |
| 106 | Ga0070672_100317308 | 3300005543 | Unclassified | 1324 |
| 107 | Ga0070672_100719026 | 3300005543 | Unclassified | 875 |
| 108 | Ga0070672_101594184 | 3300005543 | Unclassified | 586 |
| 109 | Ga0070695_100089103 | 3300005545 | Bacteria | 2056 |
| 110 | Ga0070695_100333887 | 3300005545 | Bacteria | 1131 |
| 111 | Ga0070695_100391903 | 3300005545 | Unclassified | 1051 |
| 112 | Ga0070695_101496656 | 3300005545 | Unclassified | 562 |
| 113 | Ga0070696_100048255 | 3300005546 | Bacteria | 2955 |
| 114 | Ga0070696_100091447 | 3300005546 | Bacteria | 2166 |
| 115 | Ga0070696_101171776 | 3300005546 | Unclassified | 648 |
| 116 | Ga0070693_100013678 | 3300005547 | Bacteria | 4140 |
| 117 | Ga0070693_100192930 | 3300005547 | Bacteria | 1318 |
| 118 | Ga0070693_100213406 | 3300005547 | Bacteria | 1260 |
| 119 | Ga0070665_102273485 | 3300005548 | Unclassified | 545 |
| 120 | Ga0070704_100017295 | 3300005549 | Bacteria | 4583 |
| 121 | Ga0070704_100134946 | 3300005549 | Bacteria | 1919 |
| 122 | Ga0070704_100184867 | 3300005549 | Bacteria | 1670 |
| 123 | Ga0070704_100185430 | 3300005549 | Bacteria | 1668 |
| 124 | Ga0070704_100838604 | 3300005549 | Bacteria | 823 |
| 125 | Ga0068855_100537095 | 3300005563 | Unclassified | 1267 |
| 126 | Ga0070664_100002661 | 3300005564 | Bacteria | 14406 |
| 127 | Ga0070664_100192471 | 3300005564 | Bacteria | 1818 |
| 128 | Ga0068857_100000175 | 3300005577 | Bacteria | 40688 |
| 129 | Ga0068857_100118964 | 3300005577 | Bacteria | 2378 |
| 130 | Ga0068857_100279417 | 3300005577 | Bacteria | 1536 |
| 131 | Ga0068857_100569859 | 3300005577 | Unclassified | 1068 |
| 132 | Ga0068857_100858876 | 3300005577 | Bacteria | 869 |
| 133 | Ga0068857_101289288 | 3300005577 | Unclassified | 709 |
| 134 | Ga0068854_100214254 | 3300005578 | Bacteria | 1521 |
| 135 | Ga0068854_100262517 | 3300005578 | Bacteria | 1383 |
| 136 | Ga0068854_100362932 | 3300005578 | Bacteria | 1189 |
| 137 | Ga0068854_100838883 | 3300005578 | Unclassified | 804 |
| 138 | Ga0068854_101167537 | 3300005578 | Unclassified | 689 |
| 139 | Ga0070702_100002800 | 3300005615 | Bacteria | 7637 |
| 140 | Ga0070702_100050672 | 3300005615 | Bacteria | 2373 |
| 141 | Ga0070702_100437261 | 3300005615 | Bacteria | 946 |
| 142 | Ga0070702_100605889 | 3300005615 | Unclassified | 822 |
| 143 | Ga0070702_101702730 | 3300005615 | Unclassified | 524 |
| 144 | Ga0068852_100596153 | 3300005616 | Bacteria | 1109 |
| 145 | Ga0068852_100758077 | 3300005616 | Bacteria | 983 |
| 146 | Ga0068859_100001548 | 3300005617 | Bacteria | 23447 |
| 147 | Ga0068859_100023087 | 3300005617 | Bacteria | 6239 |
| 148 | Ga0068859_100030268 | 3300005617 | Bacteria | 5432 |
| 149 | Ga0068859_100084273 | 3300005617 | Bacteria | 3223 |
| 150 | Ga0068859_100106962 | 3300005617 | Bacteria | 2857 |
| 151 | Ga0068859_100117341 | 3300005617 | Bacteria | 2727 |
| 152 | Ga0068859_100163113 | 3300005617 | Bacteria | 2308 |
| 153 | Ga0068859_100269789 | 3300005617 | Bacteria | 1794 |
| 154 | Ga0068859_100313429 | 3300005617 | Bacteria | 1662 |
| 155 | Ga0068859_100351126 | 3300005617 | Bacteria | 1570 |
| 156 | Ga0068859_100362574 | 3300005617 | Bacteria | 1544 |
| 157 | Ga0068859_100902841 | 3300005617 | Unclassified | 968 |
| 158 | Ga0068859_101136383 | 3300005617 | Bacteria | 860 |
| 159 | Ga0068859_101297167 | 3300005617 | Unclassified | 802 |
| 160 | Ga0068859_101322018 | 3300005617 | Unclassified | 794 |
| 161 | Ga0068859_101586611 | 3300005617 | Unclassified | 723 |
| 162 | Ga0068859_101783234 | 3300005617 | Unclassified | 680 |
| 163 | Ga0068864_100049316 | 3300005618 | Bacteria | 3622 |
| 164 | Ga0068864_100062358 | 3300005618 | Bacteria | 3230 |
| 165 | Ga0068864_100140695 | 3300005618 | Bacteria | 2176 |
| 166 | Ga0068864_100227531 | 3300005618 | Bacteria | 1723 |
| 167 | Ga0068864_100407906 | 3300005618 | Bacteria | 1292 |
| 168 | Ga0068864_100555171 | 3300005618 | Bacteria | 1110 |
| 169 | Ga0068864_100779253 | 3300005618 | Unclassified | 939 |
| 170 | Ga0068864_101123547 | 3300005618 | Bacteria | 783 |
| 171 | Ga0068866_10176351 | 3300005718 | Unclassified | 1259 |
| 172 | Ga0068861_100013676 | 3300005719 | Bacteria | 5684 |
| 173 | Ga0068861_101448732 | 3300005719 | Unclassified | 672 |
| 174 | Ga0068870_10090525 | 3300005840 | Unclassified | 1709 |
| 175 | Ga0068870_10160648 | 3300005840 | Bacteria | 1332 |
| 176 | Ga0068870_10323374 | 3300005840 | Bacteria | 981 |
| 177 | Ga0068870_11317657 | 3300005840 | Bacteria | 527 |
| 178 | Ga0068863_100066806 | 3300005841 | Bacteria | 3401 |
| 179 | Ga0068863_100168020 | 3300005841 | Bacteria | 2104 |
| 180 | Ga0068863_100337963 | 3300005841 | Bacteria | 1465 |
| 181 | Ga0068863_100340707 | 3300005841 | Bacteria | 1458 |
| 182 | Ga0068863_101005643 | 3300005841 | Unclassified | 836 |
| 183 | Ga0068858_100142115 | 3300005842 | Bacteria | 2253 |
| 184 | Ga0068858_100146918 | 3300005842 | Bacteria | 2214 |
| 185 | Ga0068858_100163188 | 3300005842 | Bacteria | 2098 |
| 186 | Ga0068858_100192061 | 3300005842 | Bacteria | 1929 |
| 187 | Ga0068858_101903709 | 3300005842 | Unclassified | 588 |
| 188 | Ga0068858_101914200 | 3300005842 | Unclassified | 586 |
| 189 | Ga0068860_100126222 | 3300005843 | Bacteria | 2452 |
| 190 | Ga0068860_100272768 | 3300005843 | Bacteria | 1651 |
| 191 | Ga0068860_100308852 | 3300005843 | Bacteria | 1550 |
| 192 | Ga0068860_100329762 | 3300005843 | Bacteria | 1499 |
| 193 | Ga0068860_100344385 | 3300005843 | Unclassified | 1466 |
| 194 | Ga0068860_100696438 | 3300005843 | Unclassified | 1026 |
| 195 | Ga0068860_100918978 | 3300005843 | Unclassified | 891 |
| 196 | Ga0068862_100058640 | 3300005844 | Bacteria | 3303 |
| 197 | Ga0068862_100182160 | 3300005844 | Bacteria | 1886 |
| 198 | Ga0068862_100279783 | 3300005844 | Bacteria | 1529 |
| 199 | Ga0068862_100683835 | 3300005844 | Unclassified | 992 |
| 200 | Ga0068862_100754283 | 3300005844 | Bacteria | 947 |
| 201 | Ga0068862_100801586 | 3300005844 | Bacteria | 920 |
| 202 | Ga0068862_100815699 | 3300005844 | Unclassified | 912 |
| 203 | Ga0068862_101687846 | 3300005844 | Unclassified | 641 |
| 204 | Ga0081539_10001384 | 3300005985 | Bacteria | 41854 |
| 205 | Ga0081539_10159728 | 3300005985 | Bacteria | 1075 |
| 206 | Ga0075432_10134687 | 3300006058 | Bacteria | 938 |
| 207 | Ga0097621_100019380 | 3300006237 | Bacteria | 5220 |
| 208 | Ga0097621_100451254 | 3300006237 | Unclassified | 1158 |
| 209 | Ga0068871_100003999 | 3300006358 | Bacteria | 10201 |
| 210 | Ga0068871_100654267 | 3300006358 | Bacteria | 959 |
| 211 | Ga0068871_100707923 | 3300006358 | Unclassified | 923 |
| 212 | Ga0075428_100277170 | 3300006844 | Bacteria | 1804 |
| 213 | Ga0075428_100756478 | 3300006844 | Bacteria | 1034 |
| 214 | Ga0075430_100091915 | 3300006846 | Bacteria | 2537 |
| 215 | Ga0075431_100243936 | 3300006847 | Bacteria | 1827 |
| 216 | Ga0075433_10008787 | 3300006852 | Bacteria | 8061 |
| 217 | Ga0075433_10204424 | 3300006852 | Bacteria | 1756 |
| 218 | Ga0075433_10258566 | 3300006852 | Bacteria | 1544 |
| 219 | Ga0075433_10808511 | 3300006852 | Unclassified | 819 |
| 220 | Ga0075433_11448081 | 3300006852 | Unclassified | 594 |
| 221 | Ga0075434_100032356 | 3300006871 | Bacteria | 5158 |
| 222 | Ga0075434_100092484 | 3300006871 | Bacteria | 3027 |
| 223 | Ga0075434_100735457 | 3300006871 | Bacteria | 1004 |
| 224 | Ga0075429_100144984 | 3300006880 | Bacteria | 2078 |
| 225 | Ga0075429_100705639 | 3300006880 | Bacteria | 884 |
| 226 | Ga0075436_100071020 | 3300006914 | Bacteria | 2407 |
| 227 | Ga0097620_100001548 | 3300006931 | Bacteria | 23447 |
| 228 | Ga0097620_100021445 | 3300006931 | Bacteria | 6484 |
| 229 | Ga0097620_100023088 | 3300006931 | Bacteria | 6239 |
| 230 | Ga0097620_100030269 | 3300006931 | Bacteria | 5432 |
| 231 | Ga0097620_100084274 | 3300006931 | Bacteria | 3223 |
| 232 | Ga0097620_100106963 | 3300006931 | Bacteria | 2857 |
| 233 | Ga0097620_100117337 | 3300006931 | Bacteria | 2727 |
| 234 | Ga0097620_100163114 | 3300006931 | Bacteria | 2308 |
| 235 | Ga0097620_100269773 | 3300006931 | Bacteria | 1794 |
| 236 | Ga0097620_100313461 | 3300006931 | Bacteria | 1662 |
| 237 | Ga0097620_100351124 | 3300006931 | Bacteria | 1570 |
| 238 | Ga0097620_100362573 | 3300006931 | Bacteria | 1544 |
| 239 | Ga0097620_100903008 | 3300006931 | Unclassified | 968 |
| 240 | Ga0097620_101136338 | 3300006931 | Bacteria | 860 |
| 241 | Ga0097620_101297024 | 3300006931 | Unclassified | 802 |
| 242 | Ga0097620_101322035 | 3300006931 | Unclassified | 794 |
| 243 | Ga0097620_101586713 | 3300006931 | Unclassified | 723 |
| 244 | Ga0097620_101783331 | 3300006931 | Unclassified | 680 |
| 245 | Ga0105251_10129328 | 3300009011 | Bacteria | 1145 |
| 246 | Ga0105251_10205772 | 3300009011 | Bacteria | 886 |
| 247 | Ga0105251_10219507 | 3300009011 | Unclassified | 856 |
| 248 | Ga0105240_10141147 | 3300009093 | Bacteria | 2880 |
| 249 | Ga0111539_10007143 | 3300009094 | Bacteria | 14315 |
| 250 | Ga0111539_10013751 | 3300009094 | Bacteria | 10109 |
| 251 | Ga0111539_10079568 | 3300009094 | Bacteria | 3856 |
| 252 | Ga0111539_10315237 | 3300009094 | Bacteria | 1820 |
| 253 | Ga0111539_10583587 | 3300009094 | Bacteria | 1302 |
| 254 | Ga0105245_10565821 | 3300009098 | Bacteria | 1160 |
| 255 | Ga0105245_11790982 | 3300009098 | Unclassified | 667 |
| 256 | Ga0105245_11941335 | 3300009098 | Unclassified | 642 |
| 257 | Ga0105247_10002148 | 3300009101 | Bacteria | 13615 |
| 258 | Ga0105247_10017707 | 3300009101 | Bacteria | 4273 |
| 259 | Ga0105247_10087186 | 3300009101 | Bacteria | 1976 |
| 260 | Ga0105247_10277732 | 3300009101 | Bacteria | 1155 |
| 261 | Ga0105247_10569828 | 3300009101 | Unclassified | 835 |
| 262 | Ga0114129_10052873 | 3300009147 | Bacteria | 5700 |
| 263 | Ga0114129_10057582 | 3300009147 | Bacteria | 5437 |
| 264 | Ga0114129_10325206 | 3300009147 | Bacteria | 2043 |
| 265 | Ga0114129_10548906 | 3300009147 | Bacteria | 1503 |
| 266 | Ga0114129_10748729 | 3300009147 | Unclassified | 1251 |
| 267 | Ga0114129_11786830 | 3300009147 | Unclassified | 748 |
| 268 | Ga0105243_10113544 | 3300009148 | Bacteria | 2272 |
| 269 | Ga0105243_10360745 | 3300009148 | Bacteria | 1337 |
| 270 | Ga0105243_12470604 | 3300009148 | Unclassified | 558 |
| 271 | Ga0105241_10063179 | 3300009174 | Bacteria | 2856 |
| 272 | Ga0105241_10101479 | 3300009174 | Bacteria | 2288 |
| 273 | Ga0105241_10108057 | 3300009174 | Bacteria | 2223 |
| 274 | Ga0105241_10174538 | 3300009174 | Bacteria | 1777 |
| 275 | Ga0105241_10224997 | 3300009174 | Bacteria | 1579 |
| 276 | Ga0105241_10351474 | 3300009174 | Bacteria | 1280 |
| 277 | Ga0105241_10574581 | 3300009174 | Bacteria | 1015 |
| 278 | Ga0105241_10661098 | 3300009174 | Bacteria | 950 |
| 279 | Ga0105241_12291440 | 3300009174 | Unclassified | 537 |
| 280 | Ga0105242_10107104 | 3300009176 | Bacteria | 2377 |
| 281 | Ga0105242_10662547 | 3300009176 | Bacteria | 1016 |
| 282 | Ga0105242_10727277 | 3300009176 | Bacteria | 974 |
| 283 | Ga0105242_11009399 | 3300009176 | Unclassified | 840 |
| 284 | Ga0105242_12055958 | 3300009176 | Unclassified | 614 |
| 285 | Ga0105248_10047580 | 3300009177 | Bacteria | 4810 |
| 286 | Ga0105248_10082286 | 3300009177 | Bacteria | 3620 |
| 287 | Ga0105248_10087769 | 3300009177 | Bacteria | 3501 |
| 288 | Ga0105248_10205825 | 3300009177 | Bacteria | 2217 |
| 289 | Ga0105248_10332141 | 3300009177 | Bacteria | 1712 |
| 290 | Ga0105248_10452440 | 3300009177 | Bacteria | 1447 |
| 291 | Ga0105248_10657168 | 3300009177 | Unclassified | 1183 |
| 292 | Ga0105248_10670461 | 3300009177 | Bacteria | 1170 |
| 293 | Ga0105248_11275018 | 3300009177 | Unclassified | 831 |
| 294 | Ga0105248_11808357 | 3300009177 | Unclassified | 693 |
| 295 | Ga0105248_12113356 | 3300009177 | Bacteria | 640 |
| 296 | Ga0105237_10247264 | 3300009545 | Bacteria | 1785 |
| 297 | Ga0105237_10249087 | 3300009545 | Bacteria | 1778 |
| 298 | Ga0105237_11068028 | 3300009545 | Unclassified | 814 |
| 299 | Ga0105238_10025668 | 3300009551 | Bacteria | 6007 |
| 300 | Ga0105249_10004851 | 3300009553 | Bacteria | 11612 |
| 301 | Ga0105249_10055361 | 3300009553 | Bacteria | 3628 |
| 302 | Ga0105249_10462013 | 3300009553 | Bacteria | 1309 |
| 303 | Ga0105249_10943051 | 3300009553 | Unclassified | 931 |
| 304 | Ga0105249_11516992 | 3300009553 | Unclassified | 742 |
| 305 | Ga0105249_12076619 | 3300009553 | Bacteria | 641 |
| 306 | Ga0105239_10496410 | 3300010375 | Bacteria | 1387 |
| 307 | Ga0105239_10590604 | 3300010375 | Bacteria | 1266 |
| 308 | Ga0105239_10676469 | 3300010375 | Unclassified | 1179 |
| 309 | Ga0105239_11322916 | 3300010375 | Unclassified | 831 |
| 310 | Ga0105246_10220334 | 3300011119 | Bacteria | 1487 |
| 311 | Ga0105246_10227861 | 3300011119 | Bacteria | 1465 |
| 312 | Ga0105246_10255511 | 3300011119 | Bacteria | 1393 |
| 313 | Ga0105246_10331092 | 3300011119 | Bacteria | 1241 |
| 314 | Ga0105246_10577479 | 3300011119 | Bacteria | 968 |
| 315 | Ga0105246_10905626 | 3300011119 | Bacteria | 791 |
| 316 | Ga0105246_11060366 | 3300011119 | Unclassified | 737 |
| 317 | Ga0105246_11209668 | 3300011119 | Unclassified | 696 |
| 318 | Ga0105246_11821266 | 3300011119 | Unclassified | 582 |
| 319 | Ga0157373_10084969 | 3300013100 | Bacteria | 2230 |
| 320 | Ga0157373_10279294 | 3300013100 | Unclassified | 1183 |
| 321 | Ga0157373_10389314 | 3300013100 | Unclassified | 998 |
| 322 | Ga0157373_11239003 | 3300013100 | Unclassified | 563 |
| 323 | Ga0157371_10093368 | 3300013102 | Bacteria | 2132 |
| 324 | Ga0157374_11335950 | 3300013296 | Unclassified | 739 |
| 325 | Ga0157374_12192758 | 3300013296 | Unclassified | 579 |
| 326 | Ga0157378_10015701 | 3300013297 | Bacteria | 6631 |
| 327 | Ga0157378_10243988 | 3300013297 | Bacteria | 1717 |
| 328 | Ga0157378_10626050 | 3300013297 | Bacteria | 1090 |
| 329 | Ga0157378_11690669 | 3300013297 | Unclassified | 680 |
| 330 | Ga0163162_10212138 | 3300013306 | Bacteria | 2066 |
| 331 | Ga0163162_10262986 | 3300013306 | Bacteria | 1857 |
| 332 | Ga0163162_10406756 | 3300013306 | Bacteria | 1494 |
| 333 | Ga0163162_10473164 | 3300013306 | Bacteria | 1384 |
| 334 | Ga0163162_11774940 | 3300013306 | Bacteria | 705 |
| 335 | Ga0163162_11816161 | 3300013306 | Bacteria | 697 |
| 336 | Ga0157372_10178870 | 3300013307 | Bacteria | 2455 |
| 337 | Ga0157372_11446925 | 3300013307 | Bacteria | 792 |
| 338 | Ga0157375_10011533 | 3300013308 | Bacteria | 7804 |
| 339 | Ga0157375_10110835 | 3300013308 | Bacteria | 2842 |
| 340 | Ga0157375_10194954 | 3300013308 | Bacteria | 2181 |
| 341 | Ga0157375_10987879 | 3300013308 | Bacteria | 982 |
| 342 | Ga0157375_11848397 | 3300013308 | Unclassified | 716 |
| 343 | Ga0157375_12377781 | 3300013308 | Unclassified | 632 |
| 344 | Ga0163163_10002062 | 3300014325 | Bacteria | 16976 |
| 345 | Ga0163163_10002406 | 3300014325 | Bacteria | 15837 |
| 346 | Ga0163163_10047816 | 3300014325 | Bacteria | 4205 |
| 347 | Ga0163163_10122003 | 3300014325 | Bacteria | 2640 |
| 348 | Ga0163163_10154793 | 3300014325 | Bacteria | 2336 |
| 349 | Ga0163163_10162815 | 3300014325 | Bacteria | 2277 |
| 350 | Ga0163163_10517454 | 3300014325 | Bacteria | 1255 |
| 351 | Ga0163163_10550019 | 3300014325 | Unclassified | 1217 |
| 352 | Ga0163163_11133198 | 3300014325 | Bacteria | 845 |
| 353 | Ga0163163_11589039 | 3300014325 | Unclassified | 715 |
| 354 | Ga0163163_11992634 | 3300014325 | Unclassified | 640 |
| 355 | Ga0157380_10005239 | 3300014326 | Bacteria | 9058 |
| 356 | Ga0157380_10061632 | 3300014326 | Bacteria | 3002 |
| 357 | Ga0157380_10478823 | 3300014326 | Unclassified | 1203 |
| 358 | Ga0157380_12394012 | 3300014326 | Unclassified | 593 |
| 359 | Ga0157377_10020372 | 3300014745 | Bacteria | 3474 |
| 360 | Ga0157377_10111959 | 3300014745 | Bacteria | 1642 |
| 361 | Ga0157379_10639576 | 3300014968 | Bacteria | 995 |
| 362 | Ga0157379_10737237 | 3300014968 | Bacteria | 927 |
| 363 | Ga0207710_10000680 | 3300025900 | Bacteria | 19152 |
| 364 | Ga0207710_10034439 | 3300025900 | Bacteria | 2225 |
| 365 | Ga0207710_10394568 | 3300025900 | Unclassified | 710 |
| 366 | Ga0207688_10160061 | 3300025901 | Bacteria | 1334 |
| 367 | Ga0207647_10002102 | 3300025904 | Bacteria | 15242 |
| 368 | Ga0207647_10291209 | 3300025904 | Bacteria | 931 |
| 369 | Ga0207645_10065284 | 3300025907 | Bacteria | 2326 |
| 370 | Ga0207643_10016256 | 3300025908 | Bacteria | 4059 |
| 371 | Ga0207643_10067834 | 3300025908 | Bacteria | 2048 |
| 372 | Ga0207643_10503123 | 3300025908 | Unclassified | 775 |
| 373 | Ga0207684_10000053 | 3300025910 | Bacteria | 225260 |
| 374 | Ga0207654_10036539 | 3300025911 | Bacteria | 2745 |
| 375 | Ga0207654_10187197 | 3300025911 | Bacteria | 1354 |
| 376 | Ga0207654_10341328 | 3300025911 | Unclassified | 1029 |
| 377 | Ga0207654_10584783 | 3300025911 | Unclassified | 796 |
| 378 | Ga0207654_11044342 | 3300025911 | Bacteria | 595 |
| 379 | Ga0207707_10029900 | 3300025912 | Bacteria | 4764 |
| 380 | Ga0207707_10035169 | 3300025912 | Bacteria | 4380 |
| 381 | Ga0207695_10090766 | 3300025913 | Bacteria | 3070 |
| 382 | Ga0207695_10393158 | 3300025913 | Bacteria | 1271 |
| 383 | Ga0207671_10795518 | 3300025914 | Unclassified | 750 |
| 384 | Ga0207660_10045848 | 3300025917 | Bacteria | 3082 |
| 385 | Ga0207660_10581705 | 3300025917 | Bacteria | 911 |
| 386 | Ga0207660_11160458 | 3300025917 | Unclassified | 629 |
| 387 | Ga0207662_10118071 | 3300025918 | Bacteria | 1660 |
| 388 | Ga0207649_10300913 | 3300025920 | Viruses | 1173 |
| 389 | Ga0207652_10114977 | 3300025921 | Bacteria | 2390 |
| 390 | Ga0207652_10343002 | 3300025921 | Bacteria | 1348 |
| 391 | Ga0207646_10331830 | 3300025922 | Bacteria | 1374 |
| 392 | Ga0207646_10540996 | 3300025922 | Bacteria | 1048 |
| 393 | Ga0207681_10245165 | 3300025923 | Bacteria | 1396 |
| 394 | Ga0207681_10359243 | 3300025923 | Bacteria | 1168 |
| 395 | Ga0207681_10685078 | 3300025923 | Unclassified | 851 |
| 396 | Ga0207694_10026080 | 3300025924 | Bacteria | 4444 |
| 397 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 398 | Ga0207650_10117717 | 3300025925 | Unclassified | 2065 |
| 399 | Ga0207650_10181461 | 3300025925 | Bacteria | 1677 |
| 400 | Ga0207650_10301086 | 3300025925 | Bacteria | 1309 |
| 401 | Ga0207650_10628526 | 3300025925 | Bacteria | 904 |
| 402 | Ga0207650_10945098 | 3300025925 | Unclassified | 732 |
| 403 | Ga0207650_10985026 | 3300025925 | Unclassified | 717 |
| 404 | Ga0207659_10075016 | 3300025926 | Bacteria | 2480 |
| 405 | Ga0207659_10300759 | 3300025926 | Bacteria | 1318 |
| 406 | Ga0207659_10656655 | 3300025926 | Unclassified | 896 |
| 407 | Ga0207644_10012230 | 3300025931 | Bacteria | 5697 |
| 408 | Ga0207644_10399111 | 3300025931 | Bacteria | 1124 |
| 409 | Ga0207690_10054350 | 3300025932 | Bacteria | 2692 |
| 410 | Ga0207690_10348994 | 3300025932 | Bacteria | 1170 |
| 411 | Ga0207690_10497341 | 3300025932 | Bacteria | 986 |
| 412 | Ga0207706_10048501 | 3300025933 | Bacteria | 3756 |
| 413 | Ga0207706_10548177 | 3300025933 | Unclassified | 996 |
| 414 | Ga0207706_10756181 | 3300025933 | Unclassified | 828 |
| 415 | Ga0207709_10002615 | 3300025935 | Bacteria | 11209 |
| 416 | Ga0207709_10360189 | 3300025935 | Bacteria | 1101 |
| 417 | Ga0207709_10362618 | 3300025935 | Bacteria | 1097 |
| 418 | Ga0207670_10005884 | 3300025936 | Bacteria | 6766 |
| 419 | Ga0207670_10198257 | 3300025936 | Bacteria | 1523 |
| 420 | Ga0207691_10409555 | 3300025940 | Bacteria | 1156 |
| 421 | Ga0207691_10671024 | 3300025940 | Unclassified | 875 |
| 422 | Ga0207711_10010840 | 3300025941 | Bacteria | 7577 |
| 423 | Ga0207711_10015701 | 3300025941 | Bacteria | 6281 |
| 424 | Ga0207711_10186984 | 3300025941 | Bacteria | 1886 |
| 425 | Ga0207711_10307691 | 3300025941 | Unclassified | 1463 |
| 426 | Ga0207711_10613655 | 3300025941 | Bacteria | 1015 |
| 427 | Ga0207711_11261010 | 3300025941 | Unclassified | 681 |
| 428 | Ga0207689_10025130 | 3300025942 | Bacteria | 4993 |
| 429 | Ga0207689_10089825 | 3300025942 | Bacteria | 2524 |
| 430 | Ga0207689_10248066 | 3300025942 | Bacteria | 1472 |
| 431 | Ga0207689_10489036 | 3300025942 | Bacteria | 1030 |
| 432 | Ga0207689_11202353 | 3300025942 | Unclassified | 638 |
| 433 | Ga0207679_10026674 | 3300025945 | Bacteria | 3987 |
| 434 | Ga0207679_10215931 | 3300025945 | Bacteria | 1611 |
| 435 | Ga0207651_10068108 | 3300025960 | Bacteria | 2508 |
| 436 | Ga0207651_11337651 | 3300025960 | Unclassified | 644 |
| 437 | Ga0207712_10015596 | 3300025961 | Bacteria | 4906 |
| 438 | Ga0207712_11334867 | 3300025961 | Bacteria | 641 |
| 439 | Ga0207712_11805947 | 3300025961 | Unclassified | 548 |
| 440 | Ga0207640_10048438 | 3300025981 | Bacteria | 2747 |
| 441 | Ga0207640_10246820 | 3300025981 | Bacteria | 1383 |
| 442 | Ga0207640_10255543 | 3300025981 | Bacteria | 1362 |
| 443 | Ga0207640_10374490 | 3300025981 | Bacteria | 1152 |
| 444 | Ga0207640_10714441 | 3300025981 | Bacteria | 860 |
| 445 | Ga0207658_11810418 | 3300025986 | Unclassified | 557 |
| 446 | Ga0207677_10970028 | 3300026023 | Unclassified | 769 |
| 447 | Ga0207703_10166005 | 3300026035 | Bacteria | 1937 |
| 448 | Ga0207703_10182135 | 3300026035 | Bacteria | 1854 |
| 449 | Ga0207703_10423788 | 3300026035 | Unclassified | 1239 |
| 450 | Ga0207703_10476573 | 3300026035 | Bacteria | 1169 |
| 451 | Ga0207703_10478894 | 3300026035 | Bacteria | 1166 |
| 452 | Ga0207703_10555941 | 3300026035 | Bacteria | 1082 |
| 453 | Ga0207703_11441161 | 3300026035 | Bacteria | 662 |
| 454 | Ga0207703_11679387 | 3300026035 | Unclassified | 611 |
| 455 | Ga0207639_10027635 | 3300026041 | Bacteria | 4135 |
| 456 | Ga0207639_10033986 | 3300026041 | Bacteria | 3765 |
| 457 | Ga0207708_10000825 | 3300026075 | Bacteria | 23369 |
| 458 | Ga0207708_10008818 | 3300026075 | Bacteria | 7462 |
| 459 | Ga0207708_10076137 | 3300026075 | Bacteria | 2574 |
| 460 | Ga0207708_10089891 | 3300026075 | Bacteria | 2367 |
| 461 | Ga0207708_10138191 | 3300026075 | Bacteria | 1909 |
| 462 | Ga0207708_10158687 | 3300026075 | Bacteria | 1785 |
| 463 | Ga0207708_10306075 | 3300026075 | Bacteria | 1294 |
| 464 | Ga0207708_10348514 | 3300026075 | Archaea | 1214 |
| 465 | Ga0207708_10894725 | 3300026075 | Bacteria | 768 |
| 466 | Ga0207641_10136324 | 3300026088 | Bacteria | 2209 |
| 467 | Ga0207641_10207443 | 3300026088 | Bacteria | 1810 |
| 468 | Ga0207641_10302714 | 3300026088 | Bacteria | 1511 |
| 469 | Ga0207641_10306045 | 3300026088 | Bacteria | 1503 |
| 470 | Ga0207641_10463384 | 3300026088 | Unclassified | 1226 |
| 471 | Ga0207641_10928753 | 3300026088 | Bacteria | 865 |
| 472 | Ga0207641_12222610 | 3300026088 | Unclassified | 549 |
| 473 | Ga0207648_10050464 | 3300026089 | Bacteria | 3638 |
| 474 | Ga0207648_10058800 | 3300026089 | Bacteria | 3352 |
| 475 | Ga0207648_10108864 | 3300026089 | Bacteria | 2432 |
| 476 | Ga0207648_10404044 | 3300026089 | Bacteria | 1238 |
| 477 | Ga0207676_10104685 | 3300026095 | Bacteria | 2354 |
| 478 | Ga0207676_10117168 | 3300026095 | Bacteria | 2240 |
| 479 | Ga0207676_10127350 | 3300026095 | Bacteria | 2159 |
| 480 | Ga0207676_10155593 | 3300026095 | Bacteria | 1974 |
| 481 | Ga0207676_10277322 | 3300026095 | Bacteria | 1520 |
| 482 | Ga0207676_10312777 | 3300026095 | Bacteria | 1439 |
| 483 | Ga0207676_10381196 | 3300026095 | Bacteria | 1313 |
| 484 | Ga0207676_10710544 | 3300026095 | Unclassified | 974 |
| 485 | Ga0207676_10889341 | 3300026095 | Bacteria | 873 |
| 486 | Ga0207676_11036233 | 3300026095 | Unclassified | 809 |
| 487 | Ga0207676_11215644 | 3300026095 | Unclassified | 747 |
| 488 | Ga0207676_11788102 | 3300026095 | Unclassified | 613 |
| 489 | Ga0207674_10000472 | 3300026116 | Bacteria | 52784 |
| 490 | Ga0207674_10074434 | 3300026116 | Bacteria | 3408 |
| 491 | Ga0207674_10227576 | 3300026116 | Bacteria | 1813 |
| 492 | Ga0207674_10237749 | 3300026116 | Bacteria | 1769 |
| 493 | Ga0207674_10299689 | 3300026116 | Bacteria | 1556 |
| 494 | Ga0207674_10317725 | 3300026116 | Bacteria | 1507 |
| 495 | Ga0207674_10360065 | 3300026116 | Bacteria | 1406 |
| 496 | Ga0207674_10497738 | 3300026116 | Unclassified | 1178 |
| 497 | Ga0207675_100658875 | 3300026118 | Unclassified | 1053 |
| 498 | Ga0207698_10801873 | 3300026142 | Unclassified | 944 |
| 499 | Ga0207698_11264020 | 3300026142 | Bacteria | 753 |
| 500 | Ga0207698_12115593 | 3300026142 | Unclassified | 576 |
| 501 | Ga0207428_10034046 | 3300027907 | Bacteria | 4178 |
| 502 | Ga0207428_10048170 | 3300027907 | Bacteria | 3420 |
| 503 | Ga0207428_10212414 | 3300027907 | Bacteria | 1453 |
| 504 | Ga0268265_10105628 | 3300028380 | Bacteria | 2286 |
| 505 | Ga0268265_10370716 | 3300028380 | Unclassified | 1314 |
| 506 | Ga0268265_10392807 | 3300028380 | Bacteria | 1280 |
| 507 | Ga0268265_10491332 | 3300028380 | Bacteria | 1155 |
| 508 | Ga0268265_10750996 | 3300028380 | Bacteria | 947 |
| 509 | Ga0268265_11926224 | 3300028380 | Unclassified | 598 |
| 510 | Ga0268264_10018399 | 3300028381 | Bacteria | 5713 |
| 511 | Ga0268264_10058772 | 3300028381 | Bacteria | 3221 |
| 512 | Ga0268264_10442962 | 3300028381 | Unclassified | 1257 |
| 513 | Ga0268264_10988762 | 3300028381 | Unclassified | 847 |
| 514 | Ga0307408_100096076 | 3300031548 | Bacteria | 2247 |
| 515 | Ga0307408_100261120 | 3300031548 | Unclassified | 1433 |
| 516 | Ga0307405_10670303 | 3300031731 | Unclassified | 855 |
| 517 | Ga0307405_10683995 | 3300031731 | Unclassified | 848 |
| 518 | Ga0307413_10015324 | 3300031824 | Bacteria | 3925 |
| 519 | Ga0307413_10686559 | 3300031824 | Unclassified | 849 |
| 520 | Ga0307410_10029326 | 3300031852 | Bacteria | 3503 |
| 521 | Ga0307410_10257157 | 3300031852 | Bacteria | 1360 |
| 522 | Ga0307410_10275017 | 3300031852 | Unclassified | 1319 |
| 523 | Ga0307410_10662840 | 3300031852 | Bacteria | 876 |
| 524 | Ga0307406_10005204 | 3300031901 | Bacteria | 7106 |
| 525 | Ga0307407_10031790 | 3300031903 | Bacteria | 2863 |
| 526 | Ga0307412_10013755 | 3300031911 | Bacteria | 4754 |
| 527 | Ga0307412_10251150 | 3300031911 | Unclassified | 1373 |
| 528 | Ga0307409_100039288 | 3300031995 | Bacteria | 3510 |
| 529 | Ga0307409_100717400 | 3300031995 | Unclassified | 1001 |
| 530 | Ga0307416_100016594 | 3300032002 | Bacteria | 5125 |
| 531 | Ga0307416_100736280 | 3300032002 | Bacteria | 1078 |
| 532 | Ga0307416_100787028 | 3300032002 | Bacteria | 1046 |
| 533 | Ga0307414_10002466 | 3300032004 | Bacteria | 9697 |
| 534 | Ga0307414_10064215 | 3300032004 | Bacteria | 2613 |
| 535 | Ga0307414_10180052 | 3300032004 | Bacteria | 1699 |
| 536 | Ga0307411_10082716 | 3300032005 | Bacteria | 2215 |
| 537 | Ga0307411_10104182 | 3300032005 | Bacteria | 2014 |
| 538 | Ga0307415_100010997 | 3300032126 | Bacteria | 5154 |
| 539 | Ga0307415_100539194 | 3300032126 | Unclassified | 1028 |
| 540 | Ga0373951_0007247 | 3300035091 | Bacteria | 2522 |
| 541 | Ga0373951_0018680 | 3300035091 | Bacteria | 1576 |
| 542 | Ga0373951_0083852 | 3300035091 | Bacteria | 828 |
| 543 | Ga0373952_0059674 | 3300035092 | Unclassified | 930 |
| 544 | Ga0373939_0247601 | 3300035114 | Bacteria | 692 |
| 545 | Ga0373960_0118642 | 3300035121 | Bacteria | 876 |
| 546 | Ga0373961_0069711 | 3300035241 | Unclassified | 1085 |
| 547 | Ga0373961_0083987 | 3300035241 | Bacteria | 1006 |
| 548 | Ga0395899_0570310 | 3300037312 | Bacteria | 725 |
| 549 | Ga0395900_0333570 | 3300037418 | Unclassified | 1494 |
| 550 | Ga0395900_0558500 | 3300037418 | Bacteria | 1089 |
| 551 | Ga0395901_0270845 | 3300038443 | Bacteria | 1766 |
| 552 | Ga0242422_01994 | 3300038699 | Bacteria | 1397 |
| 553 | Ga0242420_009227 | 3300038996 | Unclassified | 1616 |
| 554 | Ga0439445_0041266 | 3300042004 | Bacteria | 1227 |
| 555 | Ga0439434_0236204 | 3300042435 | Unclassified | 623 |
| 556 | Ga0439444_0126636 | 3300042437 | Unclassified | 601 |
| 557 | Ga0451576_0067007 | 3300045051 | Bacteria | 3737 |
| 558 | Ga0496104_0089848 | 3300048907 | Bacteria | 2935 |
| 559 | Ga0496106_0050872 | 3300048909 | Bacteria | 3123 |
| 560 | Ga0496106_0250045 | 3300048909 | Bacteria | 1417 |
| 561 | Ga0496107_0018870 | 3300048910 | Bacteria | 4862 |
| 562 | Ga0496108_0998727 | 3300048911 | Bacteria | 715 |
| 563 | Ga0496108_1344089 | 3300048911 | Unclassified | 600 |
| 564 | Ga0496109_0193767 | 3300048912 | Bacteria | 1910 |
| 565 | Ga0496110_0145098 | 3300048913 | Bacteria | 2147 |
| 566 | Ga0496110_0553997 | 3300048913 | Unclassified | 1045 |
| 567 | Ga0496112_0405963 | 3300048915 | Bacteria | 1302 |
| 568 | Ga0496112_0547228 | 3300048915 | Bacteria | 1091 |
| 569 | Ga0496112_1185227 | 3300048915 | Unclassified | 681 |
| 570 | Ga0496112_1461667 | 3300048915 | Unclassified | 598 |
| 571 | Ga0496112_1726737 | 3300048915 | Unclassified | 538 |
| 572 | Ga0501290_024262 | 3300049513 | Unclassified | 844 |
| 573 | Ga0501291_074875 | 3300049514 | Unclassified | 663 |
| 574 | Ga0501292_019712 | 3300049515 | Unclassified | 1081 |
| 575 | Ga0501293_005160 | 3300049516 | Unclassified | 1043 |
| 576 | Ga0501295_005841 | 3300049518 | Bacteria | 1698 |
| 577 | Ga0501296_005950 | 3300049519 | Unclassified | 1372 |
| 578 | Ga0501298_000965 | 3300049521 | Bacteria | 4079 |
| 579 | Ga0501298_002754 | 3300049521 | Bacteria | 2685 |
| 580 | Ga0501299_008009 | 3300049522 | Bacteria | 1707 |
| 581 | Ga0501299_031286 | 3300049522 | Unclassified | 1028 |
| 582 | Ga0501041_0172158 | 3300049577 | Bacteria | 1355 |
| 583 | Ga0501201_052303 | 3300049651 | Unclassified | 513 |
| 584 | Ga0501202_009604 | 3300049652 | Bacteria | 1782 |
| 585 | Ga0501202_022587 | 3300049652 | Unclassified | 1264 |
| 586 | Ga0501202_034414 | 3300049652 | Unclassified | 1070 |
| 587 | Ga0501206_029578 | 3300049653 | Unclassified | 810 |
| 588 | Ga0501207_003344 | 3300049654 | Bacteria | 2131 |
| 589 | Ga0501209_044642 | 3300049656 | Unclassified | 1186 |
| 590 | Ga0501216_013259 | 3300049660 | Bacteria | 1364 |
| 591 | Ga0501217_001734 | 3300049661 | Bacteria | 4162 |
| 592 | Ga0501217_001958 | 3300049661 | Bacteria | 3961 |
| 593 | Ga0501217_012218 | 3300049661 | Bacteria | 1909 |
| 594 | Ga0501223_002051 | 3300049663 | Bacteria | 4522 |
| 595 | Ga0501223_021697 | 3300049663 | Bacteria | 1256 |
| 596 | Ga0501224_005015 | 3300049664 | Bacteria | 1887 |
| 597 | Ga0501224_021455 | 3300049664 | Unclassified | 963 |
| 598 | Ga0501227_006411 | 3300049665 | Bacteria | 2529 |
| 599 | Ga0501227_006474 | 3300049665 | Bacteria | 2517 |
| 600 | Ga0501227_129975 | 3300049665 | Unclassified | 685 |
| 601 | Ga0501233_005760 | 3300049668 | Bacteria | 2305 |
| 602 | Ga0501233_009690 | 3300049668 | Bacteria | 1883 |
| 603 | Ga0501233_071533 | 3300049668 | Unclassified | 879 |
| 604 | Ga0501235_000552 | 3300049669 | Bacteria | 7491 |
| 605 | Ga0501235_030391 | 3300049669 | Unclassified | 1217 |
| 606 | Ga0501236_017659 | 3300049670 | Unclassified | 1022 |
| 607 | Ga0501238_035193 | 3300049671 | Unclassified | 729 |
| 608 | Ga0501239_001808 | 3300049672 | Bacteria | 1883 |
| 609 | Ga0501243_009054 | 3300049675 | Bacteria | 1544 |
| 610 | Ga0501243_026902 | 3300049675 | Unclassified | 969 |
| 611 | Ga0501246_041771 | 3300049676 | Unclassified | 550 |
| 612 | Ga0501249_021330 | 3300049679 | Unclassified | 1413 |
| 613 | Ga0501249_025999 | 3300049679 | Bacteria | 1292 |
| 614 | Ga0501249_049158 | 3300049679 | Bacteria | 966 |
| 615 | Ga0501249_065074 | 3300049679 | Unclassified | 847 |
| 616 | Ga0501253_185066 | 3300049683 | Unclassified | 543 |
| 617 | Ga0501257_004433 | 3300049686 | Bacteria | 3068 |
| 618 | Ga0501257_007509 | 3300049686 | Bacteria | 2437 |
| 619 | Ga0501258_015521 | 3300049687 | Unclassified | 854 |
| 620 | Ga0501261_068049 | 3300049690 | Unclassified | 619 |
| 621 | Ga0501221_020041 | 3300049704 | Unclassified | 1304 |
| 622 | Ga0501221_037397 | 3300049704 | Unclassified | 1045 |
| 623 | Ga0501225_0007568 | 3300049705 | Bacteria | 3146 |
| 624 | Ga0501225_0044204 | 3300049705 | Unclassified | 1231 |
| 625 | Ga0501225_0204393 | 3300049705 | Unclassified | 628 |
| 626 | Ga0501229_003857 | 3300049706 | Bacteria | 1812 |
| 627 | Ga0501234_024230 | 3300049707 | Bacteria | 972 |
| 628 | Ga0501245_012053 | 3300049708 | Unclassified | 1264 |
| 629 | Ga0501079_0224922 | 3300049741 | Bacteria | 1466 |
| 630 | Ga0501080_0206863 | 3300049742 | Bacteria | 1800 |
| 631 | Ga0501232_018789 | 3300049757 | Unclassified | 872 |
| 632 | Ga0501262_056946 | 3300049759 | Unclassified | 616 |
| 633 | Ga0501266_007792 | 3300049763 | Bacteria | 1345 |
| 634 | Ga0501268_010285 | 3300049765 | Bacteria | 1454 |
| 635 | Ga0501268_042449 | 3300049765 | Unclassified | 859 |
| 636 | Ga0501270_021142 | 3300049767 | Bacteria | 992 |
| 637 | Ga0501270_039260 | 3300049767 | Unclassified | 818 |
| 638 | Ga0501271_015221 | 3300049768 | Unclassified | 857 |
| 639 | Ga0501272_003071 | 3300049769 | Bacteria | 1679 |
| 640 | Ga0501272_052824 | 3300049769 | Unclassified | 567 |
| 641 | Ga0501273_027045 | 3300049770 | Unclassified | 802 |
| 642 | Ga0501275_004048 | 3300049772 | Bacteria | 1361 |
| 643 | Ga0501278_007868 | 3300049774 | Unclassified | 816 |
| 644 | Ga0501279_061546 | 3300049775 | Unclassified | 615 |
| 645 | Ga0501283_002463 | 3300049779 | Bacteria | 2405 |
| 646 | Ga0501200_02781 | 3300049849 | Unclassified | 734 |
| 647 | Ga0501212_007062 | 3300049851 | Bacteria | 1530 |
| 648 | Ga0501212_060964 | 3300049851 | Unclassified | 653 |
| 649 | Ga0501226_002624 | 3300049853 | Bacteria | 2182 |
| 650 | Ga0501226_010102 | 3300049853 | Unclassified | 1048 |
| 651 | Ga0501226_013744 | 3300049853 | Unclassified | 893 |
| 652 | nmdc:mga05p37_248238_c1 | 3300050507 | Bacteria | 2136 |
| 653 | nmdc:mga05p37_293523_c1 | 3300050507 | Unclassified | 754 |
| 654 | nmdc:mga05p37_645858_c1 | 3300050507 | Unclassified | 1186 |
| 655 | nmdc:mga05p37_80065_c1 | 3300050507 | Bacteria | 4023 |
| 656 | nmdc:mga09592_1379711_c1 | 3300050508 | Unclassified | 577 |
| 657 | nmdc:mga09592_426040_c1 | 3300050508 | Unclassified | 1146 |
| 658 | nmdc:mga0qj67_319625_c1 | 3300050509 | Bacteria | 1257 |
| 659 | nmdc:mga06r32_266379_c1 | 3300050510 | Bacteria | 1701 |
| 660 | nmdc:mga06r32_50876_c2 | 3300050510 | Bacteria | 3489 |
| 661 | nmdc:mga06r32_84583_c1 | 3300050510 | Bacteria | 3092 |
| 662 | nmdc:mga08y16_346333_c1 | 3300050511 | Bacteria | 1527 |
| 663 | nmdc:mga08y16_423779_c1 | 3300050511 | Bacteria | 1360 |
| 664 | nmdc:mga08y16_6272_c1 | 3300050511 | Bacteria | 12465 |
| 665 | nmdc:mga08y16_89290_c1 | 3300050511 | Bacteria | 3212 |
| 666 | nmdc:mga08y16_9708_c1 | 3300050511 | Bacteria | 10105 |
| 667 | nmdc:mga0n895_12134_c1 | 3300050512 | Bacteria | 7712 |
| 668 | nmdc:mga0n895_1465106_c1 | 3300050512 | Bacteria | 650 |
| 669 | nmdc:mga0n895_176413_c1 | 3300050512 | Bacteria | 2168 |
| 670 | nmdc:mga08x19_24879_c1 | 3300050514 | Bacteria | 3726 |
| 671 | nmdc:mga0a205_11485_c1 | 3300050515 | Bacteria | 8156 |
| 672 | nmdc:mga0a205_123703_c1 | 3300050515 | Bacteria | 2486 |
| 673 | nmdc:mga0a205_20138_c1 | 3300050515 | Bacteria | 6294 |
| 674 | nmdc:mga0a205_32218_c1 | 3300050515 | Bacteria | 5025 |
| 675 | nmdc:mga0a205_7270_c1 | 3300050515 | Bacteria | 7933 |
| 676 | Ga0501084_0091708 | 3300054114 | Bacteria | 2551 |
| 677 | Ga0587083_0035502 | 3300059505 | Unclassified | 1017 |
| 678 | Ga0587128_007738 | 3300059630 | Bacteria | 1368 |
| 679 | Ga0207683_10478970 | |||
| 680 | SwRhRL2b_contig_1788179 | |||
| 681 | CNAas_1000555 | |||
| 682 | JGI24751J29686_10000104 | |||
| 683 | JGI25406J46586_10000683 | |||
| 684 | rootH2_10085677 | |||
| 685 | rootL2_10122771 | |||
| 686 | Ga0065714_10168816 | |||
| 687 | Ga0065704_10006025 | |||
| 688 | Ga0065704_10384945 | |||
| 689 | Ga0065712_10001505 | |||
| 690 | Ga0065712_10003789 | |||
| 691 | Ga0065712_10016812 | |||
| 692 | Ga0065712_10067727 | |||
| 693 | Ga0065712_10145848 | |||
| 694 | Ga0065712_10150664 | |||
| 695 | Ga0065715_10013317 | |||
| 696 | Ga0065715_10073066 | |||
| 697 | Ga0065715_10088941 | |||
| 698 | Ga0065715_10191139 | |||
| 699 | Ga0065715_10210241 | |||
| 700 | Ga0065715_10226594 | |||
| 701 | Ga0065715_10262753 | |||
| 702 | Ga0065715_10793953 | |||
| 703 | Ga0065707_10002690 | |||
| 704 | Ga0065707_10015464 | |||
| 705 | Ga0065707_10129673 | |||
| 706 | Ga0065707_10559008 | |||
| 707 | Ga0070676_10064199 | |||
| 708 | Ga0070670_100069688 | |||
| 709 | Ga0070670_100086259 | |||
| 710 | Ga0070670_100216658 | |||
| 711 | Ga0070670_100313178 | |||
| 712 | Ga0070670_101117874 | |||
| 713 | Ga0070670_101702533 | |||
| 714 | Ga0070677_10797277 | |||
| 715 | Ga0068869_100254331 | |||
| 716 | Ga0070680_100061867 | |||
| 717 | Ga0070680_100204505 | |||
| 718 | Ga0070682_100400579 | |||
| 719 | Ga0068868_100525816 | |||
| 720 | Ga0068868_100536690 | |||
| 721 | Ga0068868_101251249 | |||
| 722 | Ga0070660_100420912 | |||
| 723 | Ga0070689_100000508 | |||
| 724 | Ga0070691_10153982 | |||
| 725 | Ga0070687_100158762 | |||
| 726 | Ga0070692_10021428 | |||
| 727 | Ga0070692_10054702 | |||
| 728 | Ga0070692_10448503 | |||
| 729 | Ga0070692_11010678 | |||
| 730 | Ga0070669_100314954 | |||
| 731 | Ga0070669_100711791 | |||
| 732 | Ga0070669_101343606 | |||
| 733 | Ga0070675_100531617 | |||
| 734 | Ga0070671_100006772 | |||
| 735 | Ga0070673_100087769 | |||
| 736 | Ga0070673_100275143 | |||
| 737 | Ga0070673_101181664 | |||
| 738 | Ga0070673_101811848 | |||
| 739 | Ga0070688_100300034 | |||
| 740 | Ga0070659_100011984 | |||
| 741 | Ga0070659_100292121 | |||
| 742 | Ga0070659_100431241 | |||
| 743 | Ga0070667_101228906 | |||
| 744 | Ga0070701_10141682 | |||
| 745 | Ga0070701_10620193 | |||
| 746 | Ga0070705_100018555 | |||
| 747 | Ga0070705_100323743 | |||
| 748 | Ga0070700_100051084 | |||
| 749 | Ga0070700_100065981 | |||
| 750 | Ga0070700_100080878 | |||
| 751 | Ga0070700_100151244 | |||
| 752 | Ga0070700_100304469 | |||
| 753 | Ga0070700_100623752 | |||
| 754 | Ga0070700_100683421 | |||
| 755 | Ga0070694_100097389 | |||
| 756 | Ga0070694_100114342 | |||
| 757 | Ga0070694_100141572 | |||
| 758 | Ga0070708_100312124 | |||
| 759 | Ga0070662_100125827 | |||
| 760 | Ga0070662_100753067 | |||
| 761 | Ga0070681_10000735 | |||
| 762 | Ga0068867_100150749 | |||
| 763 | Ga0068867_100421922 | |||
| 764 | Ga0068867_100783862 | |||
| 765 | Ga0070685_10025533 | |||
| 766 | Ga0070706_100000053 | |||
| 767 | Ga0070707_100025697 | |||
| 768 | Ga0070707_100348655 | |||
| 769 | Ga0070698_100033893 | |||
| 770 | Ga0070699_100078021 | |||
| 771 | Ga0070699_100189534 | |||
| 772 | Ga0070699_100308257 | |||
| 773 | Ga0070699_100664779 | |||
| 774 | Ga0070699_100831422 | |||
| 775 | Ga0070679_100020112 | |||
| 776 | Ga0070679_100143502 | |||
| 777 | Ga0070679_101031389 | |||
| 778 | Ga0070684_100101712 | |||
| 779 | Ga0070697_100240387 | |||
| 780 | Ga0068853_100021378 | |||
| 781 | Ga0068853_100043276 | |||
| 782 | Ga0068853_100661664 | |||
| 783 | Ga0068853_101527038 | |||
| 784 | Ga0070672_100317308 | |||
| 785 | Ga0070672_100719026 | |||
| 786 | Ga0070672_101594184 | |||
| 787 | Ga0070695_100089103 | |||
| 788 | Ga0070695_100333887 | |||
| 789 | Ga0070695_100391903 | |||
| 790 | Ga0070695_101496656 | |||
| 791 | Ga0070696_100048255 | |||
| 792 | Ga0070696_100091447 | |||
| 793 | Ga0070696_101171776 | |||
| 794 | Ga0070693_100013678 | |||
| 795 | Ga0070693_100192930 | |||
| 796 | Ga0070693_100213406 | |||
| 797 | Ga0070665_102273485 | |||
| 798 | Ga0070704_100017295 | |||
| 799 | Ga0070704_100134946 | |||
| 800 | Ga0070704_100184867 | |||
| 801 | Ga0070704_100185430 | |||
| 802 | Ga0070704_100838604 | |||
| 803 | Ga0068855_100537095 | |||
| 804 | Ga0070664_100002661 | |||
| 805 | Ga0070664_100192471 | |||
| 806 | Ga0068857_100000175 | |||
| 807 | Ga0068857_100118964 | |||
| 808 | Ga0068857_100279417 | |||
| 809 | Ga0068857_100569859 | |||
| 810 | Ga0068857_100858876 | |||
| 811 | Ga0068857_101289288 | |||
| 812 | Ga0068854_100214254 | |||
| 813 | Ga0068854_100262517 | |||
| 814 | Ga0068854_100362932 | |||
| 815 | Ga0068854_100838883 | |||
| 816 | Ga0068854_101167537 | |||
| 817 | Ga0070702_100002800 | |||
| 818 | Ga0070702_100050672 | |||
| 819 | Ga0070702_100437261 | |||
| 820 | Ga0070702_100605889 | |||
| 821 | Ga0070702_101702730 | |||
| 822 | Ga0068852_100596153 | |||
| 823 | Ga0068852_100758077 | |||
| 824 | Ga0068859_100001548 | |||
| 825 | Ga0068859_100023087 | |||
| 826 | Ga0068859_100030268 | |||
| 827 | Ga0068859_100084273 | |||
| 828 | Ga0068859_100106962 | |||
| 829 | Ga0068859_100117341 | |||
| 830 | Ga0068859_100163113 | |||
| 831 | Ga0068859_100269789 | |||
| 832 | Ga0068859_100313429 | |||
| 833 | Ga0068859_100351126 | |||
| 834 | Ga0068859_100362574 | |||
| 835 | Ga0068859_100902841 | |||
| 836 | Ga0068859_101136383 | |||
| 837 | Ga0068859_101297167 | |||
| 838 | Ga0068859_101322018 | |||
| 839 | Ga0068859_101586611 | |||
| 840 | Ga0068859_101783234 | |||
| 841 | Ga0068864_100049316 | |||
| 842 | Ga0068864_100062358 | |||
| 843 | Ga0068864_100140695 | |||
| 844 | Ga0068864_100227531 | |||
| 845 | Ga0068864_100407906 | |||
| 846 | Ga0068864_100555171 | |||
| 847 | Ga0068864_100779253 | |||
| 848 | Ga0068864_101123547 | |||
| 849 | Ga0068866_10176351 | |||
| 850 | Ga0068861_100013676 | |||
| 851 | Ga0068861_101448732 | |||
| 852 | Ga0068870_10090525 | |||
| 853 | Ga0068870_10160648 | |||
| 854 | Ga0068870_10323374 | |||
| 855 | Ga0068870_11317657 | |||
| 856 | Ga0068863_100066806 | |||
| 857 | Ga0068863_100168020 | |||
| 858 | Ga0068863_100337963 | |||
| 859 | Ga0068863_100340707 | |||
| 860 | Ga0068863_101005643 | |||
| 861 | Ga0068858_100142115 | |||
| 862 | Ga0068858_100146918 | |||
| 863 | Ga0068858_100163188 | |||
| 864 | Ga0068858_100192061 | |||
| 865 | Ga0068858_101903709 | |||
| 866 | Ga0068858_101914200 | |||
| 867 | Ga0068860_100126222 | |||
| 868 | Ga0068860_100272768 | |||
| 869 | Ga0068860_100308852 | |||
| 870 | Ga0068860_100329762 | |||
| 871 | Ga0068860_100344385 | |||
| 872 | Ga0068860_100696438 | |||
| 873 | Ga0068860_100918978 | |||
| 874 | Ga0068862_100058640 | |||
| 875 | Ga0068862_100182160 | |||
| 876 | Ga0068862_100279783 | |||
| 877 | Ga0068862_100683835 | |||
| 878 | Ga0068862_100754283 | |||
| 879 | Ga0068862_100801586 | |||
| 880 | Ga0068862_100815699 | |||
| 881 | Ga0068862_101687846 | |||
| 882 | Ga0081539_10001384 | |||
| 883 | Ga0081539_10159728 | |||
| 884 | Ga0075432_10134687 | |||
| 885 | Ga0097621_100019380 | |||
| 886 | Ga0097621_100451254 | |||
| 887 | Ga0068871_100003999 | |||
| 888 | Ga0068871_100654267 | |||
| 889 | Ga0068871_100707923 | |||
| 890 | Ga0075428_100277170 | |||
| 891 | Ga0075428_100756478 | |||
| 892 | Ga0075430_100091915 | |||
| 893 | Ga0075431_100243936 | |||
| 894 | Ga0075433_10008787 | |||
| 895 | Ga0075433_10204424 | |||
| 896 | Ga0075433_10258566 | |||
| 897 | Ga0075433_10808511 | |||
| 898 | Ga0075433_11448081 | |||
| 899 | Ga0075434_100032356 | |||
| 900 | Ga0075434_100092484 | |||
| 901 | Ga0075434_100735457 | |||
| 902 | Ga0075429_100144984 | |||
| 903 | Ga0075429_100705639 | |||
| 904 | Ga0075436_100071020 | |||
| 905 | Ga0097620_100001548 | |||
| 906 | Ga0097620_100021445 | |||
| 907 | Ga0097620_100023088 | |||
| 908 | Ga0097620_100030269 | |||
| 909 | Ga0097620_100084274 | |||
| 910 | Ga0097620_100106963 | |||
| 911 | Ga0097620_100117337 | |||
| 912 | Ga0097620_100163114 | |||
| 913 | Ga0097620_100269773 | |||
| 914 | Ga0097620_100313461 | |||
| 915 | Ga0097620_100351124 | |||
| 916 | Ga0097620_100362573 | |||
| 917 | Ga0097620_100903008 | |||
| 918 | Ga0097620_101136338 | |||
| 919 | Ga0097620_101297024 | |||
| 920 | Ga0097620_101322035 | |||
| 921 | Ga0097620_101586713 | |||
| 922 | Ga0097620_101783331 | |||
| 923 | Ga0105251_10129328 | |||
| 924 | Ga0105251_10205772 | |||
| 925 | Ga0105251_10219507 | |||
| 926 | Ga0105240_10141147 | |||
| 927 | Ga0111539_10007143 | |||
| 928 | Ga0111539_10013751 | |||
| 929 | Ga0111539_10079568 | |||
| 930 | Ga0111539_10315237 | |||
| 931 | Ga0111539_10583587 | |||
| 932 | Ga0105245_10565821 | |||
| 933 | Ga0105245_11790982 | |||
| 934 | Ga0105245_11941335 | |||
| 935 | Ga0105247_10002148 | |||
| 936 | Ga0105247_10017707 | |||
| 937 | Ga0105247_10087186 | |||
| 938 | Ga0105247_10277732 | |||
| 939 | Ga0105247_10569828 | |||
| 940 | Ga0114129_10052873 | |||
| 941 | Ga0114129_10057582 | |||
| 942 | Ga0114129_10325206 | |||
| 943 | Ga0114129_10548906 | |||
| 944 | Ga0114129_10748729 | |||
| 945 | Ga0114129_11786830 | |||
| 946 | Ga0105243_10113544 | |||
| 947 | Ga0105243_10360745 | |||
| 948 | Ga0105243_12470604 | |||
| 949 | Ga0105241_10063179 | |||
| 950 | Ga0105241_10101479 | |||
| 951 | Ga0105241_10108057 | |||
| 952 | Ga0105241_10174538 | |||
| 953 | Ga0105241_10224997 | |||
| 954 | Ga0105241_10351474 | |||
| 955 | Ga0105241_10574581 | |||
| 956 | Ga0105241_10661098 | |||
| 957 | Ga0105241_12291440 | |||
| 958 | Ga0105242_10107104 | |||
| 959 | Ga0105242_10662547 | |||
| 960 | Ga0105242_10727277 | |||
| 961 | Ga0105242_11009399 | |||
| 962 | Ga0105242_12055958 | |||
| 963 | Ga0105248_10047580 | |||
| 964 | Ga0105248_10082286 | |||
| 965 | Ga0105248_10087769 | |||
| 966 | Ga0105248_10205825 | |||
| 967 | Ga0105248_10332141 | |||
| 968 | Ga0105248_10452440 | |||
| 969 | Ga0105248_10657168 | |||
| 970 | Ga0105248_10670461 | |||
| 971 | Ga0105248_11275018 | |||
| 972 | Ga0105248_11808357 | |||
| 973 | Ga0105248_12113356 | |||
| 974 | Ga0105237_10247264 | |||
| 975 | Ga0105237_10249087 | |||
| 976 | Ga0105237_11068028 | |||
| 977 | Ga0105238_10025668 | |||
| 978 | Ga0105249_10004851 | |||
| 979 | Ga0105249_10055361 | |||
| 980 | Ga0105249_10462013 | |||
| 981 | Ga0105249_10943051 | |||
| 982 | Ga0105249_11516992 | |||
| 983 | Ga0105249_12076619 | |||
| 984 | Ga0105239_10496410 | |||
| 985 | Ga0105239_10590604 | |||
| 986 | Ga0105239_10676469 | |||
| 987 | Ga0105239_11322916 | |||
| 988 | Ga0105246_10220334 | |||
| 989 | Ga0105246_10227861 | |||
| 990 | Ga0105246_10255511 | |||
| 991 | Ga0105246_10331092 | |||
| 992 | Ga0105246_10577479 | |||
| 993 | Ga0105246_10905626 | |||
| 994 | Ga0105246_11060366 | |||
| 995 | Ga0105246_11209668 | |||
| 996 | Ga0105246_11821266 | |||
| 997 | Ga0157373_10084969 | |||
| 998 | Ga0157373_10279294 | |||
| 999 | Ga0157373_10389314 | |||
| 1000 | Ga0157373_11239003 | |||
| 1001 | Ga0157371_10093368 | |||
| 1002 | Ga0157374_11335950 | |||
| 1003 | Ga0157374_12192758 | |||
| 1004 | Ga0157378_10015701 | |||
| 1005 | Ga0157378_10243988 | |||
| 1006 | Ga0157378_10626050 | |||
| 1007 | Ga0157378_11690669 | |||
| 1008 | Ga0163162_10212138 | |||
| 1009 | Ga0163162_10262986 | |||
| 1010 | Ga0163162_10406756 | |||
| 1011 | Ga0163162_10473164 | |||
| 1012 | Ga0163162_11774940 | |||
| 1013 | Ga0163162_11816161 | |||
| 1014 | Ga0157372_10178870 | |||
| 1015 | Ga0157372_11446925 | |||
| 1016 | Ga0157375_10011533 | |||
| 1017 | Ga0157375_10110835 | |||
| 1018 | Ga0157375_10194954 | |||
| 1019 | Ga0157375_10987879 | |||
| 1020 | Ga0157375_11848397 | |||
| 1021 | Ga0157375_12377781 | |||
| 1022 | Ga0163163_10002062 | |||
| 1023 | Ga0163163_10002406 | |||
| 1024 | Ga0163163_10047816 | |||
| 1025 | Ga0163163_10122003 | |||
| 1026 | Ga0163163_10154793 | |||
| 1027 | Ga0163163_10162815 | |||
| 1028 | Ga0163163_10517454 | |||
| 1029 | Ga0163163_10550019 | |||
| 1030 | Ga0163163_11133198 | |||
| 1031 | Ga0163163_11589039 | |||
| 1032 | Ga0163163_11992634 | |||
| 1033 | Ga0157380_10005239 | |||
| 1034 | Ga0157380_10061632 | |||
| 1035 | Ga0157380_10478823 | |||
| 1036 | Ga0157380_12394012 | |||
| 1037 | Ga0157377_10020372 | |||
| 1038 | Ga0157377_10111959 | |||
| 1039 | Ga0157379_10639576 | |||
| 1040 | Ga0157379_10737237 | |||
| 1041 | Ga0207710_10000680 | |||
| 1042 | Ga0207710_10034439 | |||
| 1043 | Ga0207710_10394568 | |||
| 1044 | Ga0207688_10160061 | |||
| 1045 | Ga0207647_10002102 | |||
| 1046 | Ga0207647_10291209 | |||
| 1047 | Ga0207645_10065284 | |||
| 1048 | Ga0207643_10016256 | |||
| 1049 | Ga0207643_10067834 | |||
| 1050 | Ga0207643_10503123 | |||
| 1051 | Ga0207684_10000053 | |||
| 1052 | Ga0207654_10036539 | |||
| 1053 | Ga0207654_10187197 | |||
| 1054 | Ga0207654_10341328 | |||
| 1055 | Ga0207654_10584783 | |||
| 1056 | Ga0207654_11044342 | |||
| 1057 | Ga0207707_10029900 | |||
| 1058 | Ga0207707_10035169 | |||
| 1059 | Ga0207695_10090766 | |||
| 1060 | Ga0207695_10393158 | |||
| 1061 | Ga0207671_10795518 | |||
| 1062 | Ga0207660_10045848 | |||
| 1063 | Ga0207660_10581705 | |||
| 1064 | Ga0207660_11160458 | |||
| 1065 | Ga0207662_10118071 | |||
| 1066 | Ga0207649_10300913 | |||
| 1067 | Ga0207652_10114977 | |||
| 1068 | Ga0207652_10343002 | |||
| 1069 | Ga0207646_10331830 | |||
| 1070 | Ga0207646_10540996 | |||
| 1071 | Ga0207681_10245165 | |||
| 1072 | Ga0207681_10359243 | |||
| 1073 | Ga0207681_10685078 | |||
| 1074 | Ga0207694_10026080 | |||
| 1075 | Ga0207650_10000007 | |||
| 1076 | Ga0207650_10117717 | |||
| 1077 | Ga0207650_10181461 | |||
| 1078 | Ga0207650_10301086 | |||
| 1079 | Ga0207650_10628526 | |||
| 1080 | Ga0207650_10945098 | |||
| 1081 | Ga0207650_10985026 | |||
| 1082 | Ga0207659_10075016 | |||
| 1083 | Ga0207659_10300759 | |||
| 1084 | Ga0207659_10656655 | |||
| 1085 | Ga0207644_10012230 | |||
| 1086 | Ga0207644_10399111 | |||
| 1087 | Ga0207690_10054350 | |||
| 1088 | Ga0207690_10348994 | |||
| 1089 | Ga0207690_10497341 | |||
| 1090 | Ga0207706_10048501 | |||
| 1091 | Ga0207706_10548177 | |||
| 1092 | Ga0207706_10756181 | |||
| 1093 | Ga0207709_10002615 | |||
| 1094 | Ga0207709_10360189 | |||
| 1095 | Ga0207709_10362618 | |||
| 1096 | Ga0207670_10005884 | |||
| 1097 | Ga0207670_10198257 | |||
| 1098 | Ga0207691_10409555 | |||
| 1099 | Ga0207691_10671024 | |||
| 1100 | Ga0207711_10010840 | |||
| 1101 | Ga0207711_10015701 | |||
| 1102 | Ga0207711_10186984 | |||
| 1103 | Ga0207711_10307691 | |||
| 1104 | Ga0207711_10613655 | |||
| 1105 | Ga0207711_11261010 | |||
| 1106 | Ga0207689_10025130 | |||
| 1107 | Ga0207689_10089825 | |||
| 1108 | Ga0207689_10248066 | |||
| 1109 | Ga0207689_10489036 | |||
| 1110 | Ga0207689_11202353 | |||
| 1111 | Ga0207679_10026674 | |||
| 1112 | Ga0207679_10215931 | |||
| 1113 | Ga0207651_10068108 | |||
| 1114 | Ga0207651_11337651 | |||
| 1115 | Ga0207712_10015596 | |||
| 1116 | Ga0207712_11334867 | |||
| 1117 | Ga0207712_11805947 | |||
| 1118 | Ga0207640_10048438 | |||
| 1119 | Ga0207640_10246820 | |||
| 1120 | Ga0207640_10255543 | |||
| 1121 | Ga0207640_10374490 | |||
| 1122 | Ga0207640_10714441 | |||
| 1123 | Ga0207658_11810418 | |||
| 1124 | Ga0207677_10970028 | |||
| 1125 | Ga0207703_10166005 | |||
| 1126 | Ga0207703_10182135 | |||
| 1127 | Ga0207703_10423788 | |||
| 1128 | Ga0207703_10476573 | |||
| 1129 | Ga0207703_10478894 | |||
| 1130 | Ga0207703_10555941 | |||
| 1131 | Ga0207703_11441161 | |||
| 1132 | Ga0207703_11679387 | |||
| 1133 | Ga0207639_10027635 | |||
| 1134 | Ga0207639_10033986 | |||
| 1135 | Ga0207708_10000825 | |||
| 1136 | Ga0207708_10008818 | |||
| 1137 | Ga0207708_10076137 | |||
| 1138 | Ga0207708_10089891 | |||
| 1139 | Ga0207708_10138191 | |||
| 1140 | Ga0207708_10158687 | |||
| 1141 | Ga0207708_10306075 | |||
| 1142 | Ga0207708_10348514 | |||
| 1143 | Ga0207708_10894725 | |||
| 1144 | Ga0207641_10136324 | |||
| 1145 | Ga0207641_10207443 | |||
| 1146 | Ga0207641_10302714 | |||
| 1147 | Ga0207641_10306045 | |||
| 1148 | Ga0207641_10463384 | |||
| 1149 | Ga0207641_10928753 | |||
| 1150 | Ga0207641_12222610 | |||
| 1151 | Ga0207648_10050464 | |||
| 1152 | Ga0207648_10058800 | |||
| 1153 | Ga0207648_10108864 | |||
| 1154 | Ga0207648_10404044 | |||
| 1155 | Ga0207676_10104685 | |||
| 1156 | Ga0207676_10117168 | |||
| 1157 | Ga0207676_10127350 | |||
| 1158 | Ga0207676_10155593 | |||
| 1159 | Ga0207676_10277322 | |||
| 1160 | Ga0207676_10312777 | |||
| 1161 | Ga0207676_10381196 | |||
| 1162 | Ga0207676_10710544 | |||
| 1163 | Ga0207676_10889341 | |||
| 1164 | Ga0207676_11036233 | |||
| 1165 | Ga0207676_11215644 | |||
| 1166 | Ga0207676_11788102 | |||
| 1167 | Ga0207674_10000472 | |||
| 1168 | Ga0207674_10074434 | |||
| 1169 | Ga0207674_10227576 | |||
| 1170 | Ga0207674_10237749 | |||
| 1171 | Ga0207674_10299689 | |||
| 1172 | Ga0207674_10317725 | |||
| 1173 | Ga0207674_10360065 | |||
| 1174 | Ga0207674_10497738 | |||
| 1175 | Ga0207675_100658875 | |||
| 1176 | Ga0207698_10801873 | |||
| 1177 | Ga0207698_11264020 | |||
| 1178 | Ga0207698_12115593 | |||
| 1179 | Ga0207428_10034046 | |||
| 1180 | Ga0207428_10048170 | |||
| 1181 | Ga0207428_10212414 | |||
| 1182 | Ga0268265_10105628 | |||
| 1183 | Ga0268265_10370716 | |||
| 1184 | Ga0268265_10392807 | |||
| 1185 | Ga0268265_10491332 | |||
| 1186 | Ga0268265_10750996 | |||
| 1187 | Ga0268265_11926224 | |||
| 1188 | Ga0268264_10018399 | |||
| 1189 | Ga0268264_10058772 | |||
| 1190 | Ga0268264_10442962 | |||
| 1191 | Ga0268264_10988762 | |||
| 1192 | Ga0307408_100096076 | |||
| 1193 | Ga0307408_100261120 | |||
| 1194 | Ga0307405_10670303 | |||
| 1195 | Ga0307405_10683995 | |||
| 1196 | Ga0307413_10015324 | |||
| 1197 | Ga0307413_10686559 | |||
| 1198 | Ga0307410_10029326 | |||
| 1199 | Ga0307410_10257157 | |||
| 1200 | Ga0307410_10275017 | |||
| 1201 | Ga0307410_10662840 | |||
| 1202 | Ga0307406_10005204 | |||
| 1203 | Ga0307407_10031790 | |||
| 1204 | Ga0307412_10013755 | |||
| 1205 | Ga0307412_10251150 | |||
| 1206 | Ga0307409_100039288 | |||
| 1207 | Ga0307409_100717400 | |||
| 1208 | Ga0307416_100016594 | |||
| 1209 | Ga0307416_100736280 | |||
| 1210 | Ga0307416_100787028 | |||
| 1211 | Ga0307414_10002466 | |||
| 1212 | Ga0307414_10064215 | |||
| 1213 | Ga0307414_10180052 | |||
| 1214 | Ga0307411_10082716 | |||
| 1215 | Ga0307411_10104182 | |||
| 1216 | Ga0307415_100010997 | |||
| 1217 | Ga0307415_100539194 | |||
| 1218 | Ga0373951_0007247 | |||
| 1219 | Ga0373951_0018680 | |||
| 1220 | Ga0373951_0083852 | |||
| 1221 | Ga0373952_0059674 | |||
| 1222 | Ga0373939_0247601 | |||
| 1223 | Ga0373960_0118642 | |||
| 1224 | Ga0373961_0069711 | |||
| 1225 | Ga0373961_0083987 | |||
| 1226 | Ga0395899_0570310 | |||
| 1227 | Ga0395900_0333570 | |||
| 1228 | Ga0395900_0558500 | |||
| 1229 | Ga0395901_0270845 | |||
| 1230 | Ga0242422_01994 | |||
| 1231 | Ga0242420_009227 | |||
| 1232 | Ga0439445_0041266 | |||
| 1233 | Ga0439434_0236204 | |||
| 1234 | Ga0439444_0126636 | |||
| 1235 | Ga0451576_0067007 | |||
| 1236 | Ga0496104_0089848 | |||
| 1237 | Ga0496106_0050872 | |||
| 1238 | Ga0496106_0250045 | |||
| 1239 | Ga0496107_0018870 | |||
| 1240 | Ga0496108_0998727 | |||
| 1241 | Ga0496108_1344089 | |||
| 1242 | Ga0496109_0193767 | |||
| 1243 | Ga0496110_0145098 | |||
| 1244 | Ga0496110_0553997 | |||
| 1245 | Ga0496112_0405963 | |||
| 1246 | Ga0496112_0547228 | |||
| 1247 | Ga0496112_1185227 | |||
| 1248 | Ga0496112_1461667 | |||
| 1249 | Ga0496112_1726737 | |||
| 1250 | Ga0501290_024262 | |||
| 1251 | Ga0501291_074875 | |||
| 1252 | Ga0501292_019712 | |||
| 1253 | Ga0501293_005160 | |||
| 1254 | Ga0501295_005841 | |||
| 1255 | Ga0501296_005950 | |||
| 1256 | Ga0501298_000965 | |||
| 1257 | Ga0501298_002754 | |||
| 1258 | Ga0501299_008009 | |||
| 1259 | Ga0501299_031286 | |||
| 1260 | Ga0501041_0172158 | |||
| 1261 | Ga0501201_052303 | |||
| 1262 | Ga0501202_009604 | |||
| 1263 | Ga0501202_022587 | |||
| 1264 | Ga0501202_034414 | |||
| 1265 | Ga0501206_029578 | |||
| 1266 | Ga0501207_003344 | |||
| 1267 | Ga0501209_044642 | |||
| 1268 | Ga0501216_013259 | |||
| 1269 | Ga0501217_001734 | |||
| 1270 | Ga0501217_001958 | |||
| 1271 | Ga0501217_012218 | |||
| 1272 | Ga0501223_002051 | |||
| 1273 | Ga0501223_021697 | |||
| 1274 | Ga0501224_005015 | |||
| 1275 | Ga0501224_021455 | |||
| 1276 | Ga0501227_006411 | |||
| 1277 | Ga0501227_006474 | |||
| 1278 | Ga0501227_129975 | |||
| 1279 | Ga0501233_005760 | |||
| 1280 | Ga0501233_009690 | |||
| 1281 | Ga0501233_071533 | |||
| 1282 | Ga0501235_000552 | |||
| 1283 | Ga0501235_030391 | |||
| 1284 | Ga0501236_017659 | |||
| 1285 | Ga0501238_035193 | |||
| 1286 | Ga0501239_001808 | |||
| 1287 | Ga0501243_009054 | |||
| 1288 | Ga0501243_026902 | |||
| 1289 | Ga0501246_041771 | |||
| 1290 | Ga0501249_021330 | |||
| 1291 | Ga0501249_025999 | |||
| 1292 | Ga0501249_049158 | |||
| 1293 | Ga0501249_065074 | |||
| 1294 | Ga0501253_185066 | |||
| 1295 | Ga0501257_004433 | |||
| 1296 | Ga0501257_007509 | |||
| 1297 | Ga0501258_015521 | |||
| 1298 | Ga0501261_068049 | |||
| 1299 | Ga0501221_020041 | |||
| 1300 | Ga0501221_037397 | |||
| 1301 | Ga0501225_0007568 | |||
| 1302 | Ga0501225_0044204 | |||
| 1303 | Ga0501225_0204393 | |||
| 1304 | Ga0501229_003857 | |||
| 1305 | Ga0501234_024230 | |||
| 1306 | Ga0501245_012053 | |||
| 1307 | Ga0501079_0224922 | |||
| 1308 | Ga0501080_0206863 | |||
| 1309 | Ga0501232_018789 | |||
| 1310 | Ga0501262_056946 | |||
| 1311 | Ga0501266_007792 | |||
| 1312 | Ga0501268_010285 | |||
| 1313 | Ga0501268_042449 | |||
| 1314 | Ga0501270_021142 | |||
| 1315 | Ga0501270_039260 | |||
| 1316 | Ga0501271_015221 | |||
| 1317 | Ga0501272_003071 | |||
| 1318 | Ga0501272_052824 | |||
| 1319 | Ga0501273_027045 | |||
| 1320 | Ga0501275_004048 | |||
| 1321 | Ga0501278_007868 | |||
| 1322 | Ga0501279_061546 | |||
| 1323 | Ga0501283_002463 | |||
| 1324 | Ga0501200_02781 | |||
| 1325 | Ga0501212_007062 | |||
| 1326 | Ga0501212_060964 | |||
| 1327 | Ga0501226_002624 | |||
| 1328 | Ga0501226_010102 | |||
| 1329 | Ga0501226_013744 | |||
| 1330 | nmdc:mga05p37_248238_c1 | |||
| 1331 | nmdc:mga05p37_293523_c1 | |||
| 1332 | nmdc:mga05p37_645858_c1 | |||
| 1333 | nmdc:mga05p37_80065_c1 | |||
| 1334 | nmdc:mga09592_1379711_c1 | |||
| 1335 | nmdc:mga09592_426040_c1 | |||
| 1336 | nmdc:mga0qj67_319625_c1 | |||
| 1337 | nmdc:mga06r32_266379_c1 | |||
| 1338 | nmdc:mga06r32_50876_c2 | |||
| 1339 | nmdc:mga06r32_84583_c1 | |||
| 1340 | nmdc:mga08y16_346333_c1 | |||
| 1341 | nmdc:mga08y16_423779_c1 | |||
| 1342 | nmdc:mga08y16_6272_c1 | |||
| 1343 | nmdc:mga08y16_89290_c1 | |||
| 1344 | nmdc:mga08y16_9708_c1 | |||
| 1345 | nmdc:mga0n895_12134_c1 | |||
| 1346 | nmdc:mga0n895_1465106_c1 | |||
| 1347 | nmdc:mga0n895_176413_c1 | |||
| 1348 | nmdc:mga08x19_24879_c1 | |||
| 1349 | nmdc:mga0a205_11485_c1 | |||
| 1350 | nmdc:mga0a205_123703_c1 | |||
| 1351 | nmdc:mga0a205_20138_c1 | |||
| 1352 | nmdc:mga0a205_32218_c1 | |||
| 1353 | nmdc:mga0a205_7270_c1 | |||
| 1354 | Ga0501084_0091708 | |||
| 1355 | Ga0587083_0035502 | |||
| 1356 | Ga0587128_007738 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2byu-assembly1.cif.gz_B | negative stain em reconstruction of m.tuberculosis acr1(hsp 16.3) fitted with wheat shsp dimer | 0.9177 | 47 | 134 |
| 1gme-assembly1.cif.gz_B | crystal structure and assembly of an eukaryotic small heat shock protein | 0.9177 | 47 | 134 |
| 2h50-assembly1.cif.gz_P | multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 | 0.9163 | 48 | 134 |
| 5ds2-assembly2.cif.gz_D | core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum | 0.9098 | 47 | 134 |
| 5zul-assembly1.cif.gz_E-2 | small heat shock protein from mycobacterium marinum m : form-3 | 0.899 | 42 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ds2D00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9098 | 47 | 134 | 2.60.40.790 |
| af_Q8IB02_36_170_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.9061 | 41 | 135 | 2.60.40.790 |
| af_Q208N7_181_285_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.901 | 42 | 135 | 2.60.40.790 |
| 3glaB00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8919 | 45 | 136 | 2.60.40.790 |
| af_Q55GH8_4_121_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8903 | 47 | 133 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S0BLE1-F1-model_v4 | SHSP domain-containing protein | 0.9212 | 47 | 136 |
GO:0009408
|
| AF-A0A7I7MJ87-F1-model_v4 | SHSP domain-containing protein | 0.9163 | 45 | 135 |
|
| AF-Q8MZU6-F1-model_v4 | Small heat shock protein | 0.9099 | 45 | 145 |
|
| AF-A0A0J6VPK7-F1-model_v4 | Alpha-crystallin | 0.9076 | 45 | 134 |
|
| AF-A0A7I9ZTR3-F1-model_v4 | Alpha-crystallin | 0.906 | 46 | 134 |
|