F474658

General Info

Members Datasets Scaffolds Average Seq Length
678 249 1356 147

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10478970|Ga0207683_104789701
Length 160
Sequence MAQQWNPLQDLMVLQDRMNRLFEDATQRRANTDGDEFERTDWTPPADIYEVTSGYVIAIDLPGISRDAVEIDVDDNRLIVKGTRLVEESRHRSERPRGKFLRTFTIPGSVDQESIGAEYKDGVLNIRLPKRQEQKAQKRIDSLSRTGPALGHGGSAWGPK

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
174 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
187 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
190 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
191 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
200 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
201 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
208 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
209 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
210 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
211 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
216 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
225 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
229 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
230 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
231 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
232 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
233 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
234 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
235 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
236 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
237 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
238 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.06
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 30.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10478970 3300026121 Bacteria 1149
2 SwRhRL2b_contig_1788179 2162886007 Bacteria 967
3 CNAas_1000555 3300000532 Bacteria 3606
4 JGI24751J29686_10000104 3300002459 Bacteria 46525
5 JGI25406J46586_10000683 3300003203 Bacteria 15765
6 rootH2_10085677 3300003320 Bacteria 1995
7 rootL2_10122771 3300003322 Bacteria 1635
8 Ga0065714_10168816 3300005288 Bacteria 1014
9 Ga0065704_10006025 3300005289 Bacteria 5614
10 Ga0065704_10384945 3300005289 Unclassified 769
11 Ga0065712_10001505 3300005290 Bacteria 7032
12 Ga0065712_10003789 3300005290 Bacteria 4279
13 Ga0065712_10016812 3300005290 Bacteria 2412
14 Ga0065712_10067727 3300005290 Bacteria 189643
15 Ga0065712_10145848 3300005290 Unclassified 1407
16 Ga0065712_10150664 3300005290 Bacteria 1372
17 Ga0065715_10013317 3300005293 Bacteria 1902
18 Ga0065715_10073066 3300005293 Unclassified 683
19 Ga0065715_10088941 3300005293 Bacteria 22679
20 Ga0065715_10191139 3300005293 Bacteria 1414
21 Ga0065715_10210241 3300005293 Bacteria 1315
22 Ga0065715_10226594 3300005293 Bacteria 1247
23 Ga0065715_10262753 3300005293 Bacteria 1133
24 Ga0065715_10793953 3300005293 Unclassified 609
25 Ga0065707_10002690 3300005295 Bacteria 4408
26 Ga0065707_10015464 3300005295 Bacteria 2099
27 Ga0065707_10129673 3300005295 Bacteria 1943
28 Ga0065707_10559008 3300005295 Unclassified 655
29 Ga0070676_10064199 3300005328 Bacteria 2189
30 Ga0070670_100069688 3300005331 Bacteria 3019
31 Ga0070670_100086259 3300005331 Bacteria 2697
32 Ga0070670_100216658 3300005331 Bacteria 1665
33 Ga0070670_100313178 3300005331 Bacteria 1374
34 Ga0070670_101117874 3300005331 Unclassified 719
35 Ga0070670_101702533 3300005331 Unclassified 580
36 Ga0070677_10797277 3300005333 Unclassified 539
37 Ga0068869_100254331 3300005334 Bacteria 1404
38 Ga0070680_100061867 3300005336 Bacteria 3065
39 Ga0070680_100204505 3300005336 Unclassified 1665
40 Ga0070682_100400579 3300005337 Unclassified 1038
41 Ga0068868_100525816 3300005338 Unclassified 1039
42 Ga0068868_100536690 3300005338 Bacteria 1029
43 Ga0068868_101251249 3300005338 Unclassified 688
44 Ga0070660_100420912 3300005339 Bacteria 1106
45 Ga0070689_100000508 3300005340 Bacteria 22987
46 Ga0070691_10153982 3300005341 Bacteria 1180
47 Ga0070687_100158762 3300005343 Bacteria 1335
48 Ga0070692_10021428 3300005345 Bacteria 3143
49 Ga0070692_10054702 3300005345 Bacteria 2085
50 Ga0070692_10448503 3300005345 Unclassified 825
51 Ga0070692_11010678 3300005345 Unclassified 582
52 Ga0070669_100314954 3300005353 Bacteria 1262
53 Ga0070669_100711791 3300005353 Unclassified 848
54 Ga0070669_101343606 3300005353 Unclassified 619
55 Ga0070675_100531617 3300005354 Bacteria 1062
56 Ga0070671_100006772 3300005355 Bacteria 9167
57 Ga0070673_100087769 3300005364 Bacteria 2536
58 Ga0070673_100275143 3300005364 Unclassified 1475
59 Ga0070673_101181664 3300005364 Unclassified 716
60 Ga0070673_101811848 3300005364 Unclassified 578
61 Ga0070688_100300034 3300005365 Bacteria 1161
62 Ga0070659_100011984 3300005366 Bacteria 6419
63 Ga0070659_100292121 3300005366 Bacteria 1358
64 Ga0070659_100431241 3300005366 Bacteria 1116
65 Ga0070667_101228906 3300005367 Unclassified 701
66 Ga0070701_10141682 3300005438 Bacteria 1376
67 Ga0070701_10620193 3300005438 Unclassified 718
68 Ga0070705_100018555 3300005440 Bacteria 3648
69 Ga0070705_100323743 3300005440 Unclassified 1114
70 Ga0070700_100051084 3300005441 Bacteria 2573
71 Ga0070700_100065981 3300005441 Bacteria 2296
72 Ga0070700_100080878 3300005441 Bacteria 2098
73 Ga0070700_100151244 3300005441 Bacteria 1588
74 Ga0070700_100304469 3300005441 Bacteria 1165
75 Ga0070700_100623752 3300005441 Bacteria 848
76 Ga0070700_100683421 3300005441 Unclassified 814
77 Ga0070694_100097389 3300005444 Bacteria 2075
78 Ga0070694_100114342 3300005444 Bacteria 1927
79 Ga0070694_100141572 3300005444 Bacteria 1748
80 Ga0070708_100312124 3300005445 Bacteria 1481
81 Ga0070662_100125827 3300005457 Bacteria 1970
82 Ga0070662_100753067 3300005457 Unclassified 826
83 Ga0070681_10000735 3300005458 Bacteria 27091
84 Ga0068867_100150749 3300005459 Unclassified 1826
85 Ga0068867_100421922 3300005459 Unclassified 1130
86 Ga0068867_100783862 3300005459 Bacteria 849
87 Ga0070685_10025533 3300005466 Bacteria 3253
88 Ga0070706_100000053 3300005467 Bacteria 139565
89 Ga0070707_100025697 3300005468 Bacteria 5589
90 Ga0070707_100348655 3300005468 Bacteria 1438
91 Ga0070698_100033893 3300005471 Bacteria 5289
92 Ga0070699_100078021 3300005518 Bacteria 2884
93 Ga0070699_100189534 3300005518 Bacteria 1826
94 Ga0070699_100308257 3300005518 Bacteria 1421
95 Ga0070699_100664779 3300005518 Bacteria 951
96 Ga0070699_100831422 3300005518 Unclassified 845
97 Ga0070679_100020112 3300005530 Bacteria 6505
98 Ga0070679_100143502 3300005530 Bacteria 2366
99 Ga0070679_101031389 3300005530 Bacteria 767
100 Ga0070684_100101712 3300005535 Bacteria 2568
101 Ga0070697_100240387 3300005536 Bacteria 1546
102 Ga0068853_100021378 3300005539 Bacteria 5394
103 Ga0068853_100043276 3300005539 Bacteria 3852
104 Ga0068853_100661664 3300005539 Unclassified 995
105 Ga0068853_101527038 3300005539 Unclassified 647
106 Ga0070672_100317308 3300005543 Unclassified 1324
107 Ga0070672_100719026 3300005543 Unclassified 875
108 Ga0070672_101594184 3300005543 Unclassified 586
109 Ga0070695_100089103 3300005545 Bacteria 2056
110 Ga0070695_100333887 3300005545 Bacteria 1131
111 Ga0070695_100391903 3300005545 Unclassified 1051
112 Ga0070695_101496656 3300005545 Unclassified 562
113 Ga0070696_100048255 3300005546 Bacteria 2955
114 Ga0070696_100091447 3300005546 Bacteria 2166
115 Ga0070696_101171776 3300005546 Unclassified 648
116 Ga0070693_100013678 3300005547 Bacteria 4140
117 Ga0070693_100192930 3300005547 Bacteria 1318
118 Ga0070693_100213406 3300005547 Bacteria 1260
119 Ga0070665_102273485 3300005548 Unclassified 545
120 Ga0070704_100017295 3300005549 Bacteria 4583
121 Ga0070704_100134946 3300005549 Bacteria 1919
122 Ga0070704_100184867 3300005549 Bacteria 1670
123 Ga0070704_100185430 3300005549 Bacteria 1668
124 Ga0070704_100838604 3300005549 Bacteria 823
125 Ga0068855_100537095 3300005563 Unclassified 1267
126 Ga0070664_100002661 3300005564 Bacteria 14406
127 Ga0070664_100192471 3300005564 Bacteria 1818
128 Ga0068857_100000175 3300005577 Bacteria 40688
129 Ga0068857_100118964 3300005577 Bacteria 2378
130 Ga0068857_100279417 3300005577 Bacteria 1536
131 Ga0068857_100569859 3300005577 Unclassified 1068
132 Ga0068857_100858876 3300005577 Bacteria 869
133 Ga0068857_101289288 3300005577 Unclassified 709
134 Ga0068854_100214254 3300005578 Bacteria 1521
135 Ga0068854_100262517 3300005578 Bacteria 1383
136 Ga0068854_100362932 3300005578 Bacteria 1189
137 Ga0068854_100838883 3300005578 Unclassified 804
138 Ga0068854_101167537 3300005578 Unclassified 689
139 Ga0070702_100002800 3300005615 Bacteria 7637
140 Ga0070702_100050672 3300005615 Bacteria 2373
141 Ga0070702_100437261 3300005615 Bacteria 946
142 Ga0070702_100605889 3300005615 Unclassified 822
143 Ga0070702_101702730 3300005615 Unclassified 524
144 Ga0068852_100596153 3300005616 Bacteria 1109
145 Ga0068852_100758077 3300005616 Bacteria 983
146 Ga0068859_100001548 3300005617 Bacteria 23447
147 Ga0068859_100023087 3300005617 Bacteria 6239
148 Ga0068859_100030268 3300005617 Bacteria 5432
149 Ga0068859_100084273 3300005617 Bacteria 3223
150 Ga0068859_100106962 3300005617 Bacteria 2857
151 Ga0068859_100117341 3300005617 Bacteria 2727
152 Ga0068859_100163113 3300005617 Bacteria 2308
153 Ga0068859_100269789 3300005617 Bacteria 1794
154 Ga0068859_100313429 3300005617 Bacteria 1662
155 Ga0068859_100351126 3300005617 Bacteria 1570
156 Ga0068859_100362574 3300005617 Bacteria 1544
157 Ga0068859_100902841 3300005617 Unclassified 968
158 Ga0068859_101136383 3300005617 Bacteria 860
159 Ga0068859_101297167 3300005617 Unclassified 802
160 Ga0068859_101322018 3300005617 Unclassified 794
161 Ga0068859_101586611 3300005617 Unclassified 723
162 Ga0068859_101783234 3300005617 Unclassified 680
163 Ga0068864_100049316 3300005618 Bacteria 3622
164 Ga0068864_100062358 3300005618 Bacteria 3230
165 Ga0068864_100140695 3300005618 Bacteria 2176
166 Ga0068864_100227531 3300005618 Bacteria 1723
167 Ga0068864_100407906 3300005618 Bacteria 1292
168 Ga0068864_100555171 3300005618 Bacteria 1110
169 Ga0068864_100779253 3300005618 Unclassified 939
170 Ga0068864_101123547 3300005618 Bacteria 783
171 Ga0068866_10176351 3300005718 Unclassified 1259
172 Ga0068861_100013676 3300005719 Bacteria 5684
173 Ga0068861_101448732 3300005719 Unclassified 672
174 Ga0068870_10090525 3300005840 Unclassified 1709
175 Ga0068870_10160648 3300005840 Bacteria 1332
176 Ga0068870_10323374 3300005840 Bacteria 981
177 Ga0068870_11317657 3300005840 Bacteria 527
178 Ga0068863_100066806 3300005841 Bacteria 3401
179 Ga0068863_100168020 3300005841 Bacteria 2104
180 Ga0068863_100337963 3300005841 Bacteria 1465
181 Ga0068863_100340707 3300005841 Bacteria 1458
182 Ga0068863_101005643 3300005841 Unclassified 836
183 Ga0068858_100142115 3300005842 Bacteria 2253
184 Ga0068858_100146918 3300005842 Bacteria 2214
185 Ga0068858_100163188 3300005842 Bacteria 2098
186 Ga0068858_100192061 3300005842 Bacteria 1929
187 Ga0068858_101903709 3300005842 Unclassified 588
188 Ga0068858_101914200 3300005842 Unclassified 586
189 Ga0068860_100126222 3300005843 Bacteria 2452
190 Ga0068860_100272768 3300005843 Bacteria 1651
191 Ga0068860_100308852 3300005843 Bacteria 1550
192 Ga0068860_100329762 3300005843 Bacteria 1499
193 Ga0068860_100344385 3300005843 Unclassified 1466
194 Ga0068860_100696438 3300005843 Unclassified 1026
195 Ga0068860_100918978 3300005843 Unclassified 891
196 Ga0068862_100058640 3300005844 Bacteria 3303
197 Ga0068862_100182160 3300005844 Bacteria 1886
198 Ga0068862_100279783 3300005844 Bacteria 1529
199 Ga0068862_100683835 3300005844 Unclassified 992
200 Ga0068862_100754283 3300005844 Bacteria 947
201 Ga0068862_100801586 3300005844 Bacteria 920
202 Ga0068862_100815699 3300005844 Unclassified 912
203 Ga0068862_101687846 3300005844 Unclassified 641
204 Ga0081539_10001384 3300005985 Bacteria 41854
205 Ga0081539_10159728 3300005985 Bacteria 1075
206 Ga0075432_10134687 3300006058 Bacteria 938
207 Ga0097621_100019380 3300006237 Bacteria 5220
208 Ga0097621_100451254 3300006237 Unclassified 1158
209 Ga0068871_100003999 3300006358 Bacteria 10201
210 Ga0068871_100654267 3300006358 Bacteria 959
211 Ga0068871_100707923 3300006358 Unclassified 923
212 Ga0075428_100277170 3300006844 Bacteria 1804
213 Ga0075428_100756478 3300006844 Bacteria 1034
214 Ga0075430_100091915 3300006846 Bacteria 2537
215 Ga0075431_100243936 3300006847 Bacteria 1827
216 Ga0075433_10008787 3300006852 Bacteria 8061
217 Ga0075433_10204424 3300006852 Bacteria 1756
218 Ga0075433_10258566 3300006852 Bacteria 1544
219 Ga0075433_10808511 3300006852 Unclassified 819
220 Ga0075433_11448081 3300006852 Unclassified 594
221 Ga0075434_100032356 3300006871 Bacteria 5158
222 Ga0075434_100092484 3300006871 Bacteria 3027
223 Ga0075434_100735457 3300006871 Bacteria 1004
224 Ga0075429_100144984 3300006880 Bacteria 2078
225 Ga0075429_100705639 3300006880 Bacteria 884
226 Ga0075436_100071020 3300006914 Bacteria 2407
227 Ga0097620_100001548 3300006931 Bacteria 23447
228 Ga0097620_100021445 3300006931 Bacteria 6484
229 Ga0097620_100023088 3300006931 Bacteria 6239
230 Ga0097620_100030269 3300006931 Bacteria 5432
231 Ga0097620_100084274 3300006931 Bacteria 3223
232 Ga0097620_100106963 3300006931 Bacteria 2857
233 Ga0097620_100117337 3300006931 Bacteria 2727
234 Ga0097620_100163114 3300006931 Bacteria 2308
235 Ga0097620_100269773 3300006931 Bacteria 1794
236 Ga0097620_100313461 3300006931 Bacteria 1662
237 Ga0097620_100351124 3300006931 Bacteria 1570
238 Ga0097620_100362573 3300006931 Bacteria 1544
239 Ga0097620_100903008 3300006931 Unclassified 968
240 Ga0097620_101136338 3300006931 Bacteria 860
241 Ga0097620_101297024 3300006931 Unclassified 802
242 Ga0097620_101322035 3300006931 Unclassified 794
243 Ga0097620_101586713 3300006931 Unclassified 723
244 Ga0097620_101783331 3300006931 Unclassified 680
245 Ga0105251_10129328 3300009011 Bacteria 1145
246 Ga0105251_10205772 3300009011 Bacteria 886
247 Ga0105251_10219507 3300009011 Unclassified 856
248 Ga0105240_10141147 3300009093 Bacteria 2880
249 Ga0111539_10007143 3300009094 Bacteria 14315
250 Ga0111539_10013751 3300009094 Bacteria 10109
251 Ga0111539_10079568 3300009094 Bacteria 3856
252 Ga0111539_10315237 3300009094 Bacteria 1820
253 Ga0111539_10583587 3300009094 Bacteria 1302
254 Ga0105245_10565821 3300009098 Bacteria 1160
255 Ga0105245_11790982 3300009098 Unclassified 667
256 Ga0105245_11941335 3300009098 Unclassified 642
257 Ga0105247_10002148 3300009101 Bacteria 13615
258 Ga0105247_10017707 3300009101 Bacteria 4273
259 Ga0105247_10087186 3300009101 Bacteria 1976
260 Ga0105247_10277732 3300009101 Bacteria 1155
261 Ga0105247_10569828 3300009101 Unclassified 835
262 Ga0114129_10052873 3300009147 Bacteria 5700
263 Ga0114129_10057582 3300009147 Bacteria 5437
264 Ga0114129_10325206 3300009147 Bacteria 2043
265 Ga0114129_10548906 3300009147 Bacteria 1503
266 Ga0114129_10748729 3300009147 Unclassified 1251
267 Ga0114129_11786830 3300009147 Unclassified 748
268 Ga0105243_10113544 3300009148 Bacteria 2272
269 Ga0105243_10360745 3300009148 Bacteria 1337
270 Ga0105243_12470604 3300009148 Unclassified 558
271 Ga0105241_10063179 3300009174 Bacteria 2856
272 Ga0105241_10101479 3300009174 Bacteria 2288
273 Ga0105241_10108057 3300009174 Bacteria 2223
274 Ga0105241_10174538 3300009174 Bacteria 1777
275 Ga0105241_10224997 3300009174 Bacteria 1579
276 Ga0105241_10351474 3300009174 Bacteria 1280
277 Ga0105241_10574581 3300009174 Bacteria 1015
278 Ga0105241_10661098 3300009174 Bacteria 950
279 Ga0105241_12291440 3300009174 Unclassified 537
280 Ga0105242_10107104 3300009176 Bacteria 2377
281 Ga0105242_10662547 3300009176 Bacteria 1016
282 Ga0105242_10727277 3300009176 Bacteria 974
283 Ga0105242_11009399 3300009176 Unclassified 840
284 Ga0105242_12055958 3300009176 Unclassified 614
285 Ga0105248_10047580 3300009177 Bacteria 4810
286 Ga0105248_10082286 3300009177 Bacteria 3620
287 Ga0105248_10087769 3300009177 Bacteria 3501
288 Ga0105248_10205825 3300009177 Bacteria 2217
289 Ga0105248_10332141 3300009177 Bacteria 1712
290 Ga0105248_10452440 3300009177 Bacteria 1447
291 Ga0105248_10657168 3300009177 Unclassified 1183
292 Ga0105248_10670461 3300009177 Bacteria 1170
293 Ga0105248_11275018 3300009177 Unclassified 831
294 Ga0105248_11808357 3300009177 Unclassified 693
295 Ga0105248_12113356 3300009177 Bacteria 640
296 Ga0105237_10247264 3300009545 Bacteria 1785
297 Ga0105237_10249087 3300009545 Bacteria 1778
298 Ga0105237_11068028 3300009545 Unclassified 814
299 Ga0105238_10025668 3300009551 Bacteria 6007
300 Ga0105249_10004851 3300009553 Bacteria 11612
301 Ga0105249_10055361 3300009553 Bacteria 3628
302 Ga0105249_10462013 3300009553 Bacteria 1309
303 Ga0105249_10943051 3300009553 Unclassified 931
304 Ga0105249_11516992 3300009553 Unclassified 742
305 Ga0105249_12076619 3300009553 Bacteria 641
306 Ga0105239_10496410 3300010375 Bacteria 1387
307 Ga0105239_10590604 3300010375 Bacteria 1266
308 Ga0105239_10676469 3300010375 Unclassified 1179
309 Ga0105239_11322916 3300010375 Unclassified 831
310 Ga0105246_10220334 3300011119 Bacteria 1487
311 Ga0105246_10227861 3300011119 Bacteria 1465
312 Ga0105246_10255511 3300011119 Bacteria 1393
313 Ga0105246_10331092 3300011119 Bacteria 1241
314 Ga0105246_10577479 3300011119 Bacteria 968
315 Ga0105246_10905626 3300011119 Bacteria 791
316 Ga0105246_11060366 3300011119 Unclassified 737
317 Ga0105246_11209668 3300011119 Unclassified 696
318 Ga0105246_11821266 3300011119 Unclassified 582
319 Ga0157373_10084969 3300013100 Bacteria 2230
320 Ga0157373_10279294 3300013100 Unclassified 1183
321 Ga0157373_10389314 3300013100 Unclassified 998
322 Ga0157373_11239003 3300013100 Unclassified 563
323 Ga0157371_10093368 3300013102 Bacteria 2132
324 Ga0157374_11335950 3300013296 Unclassified 739
325 Ga0157374_12192758 3300013296 Unclassified 579
326 Ga0157378_10015701 3300013297 Bacteria 6631
327 Ga0157378_10243988 3300013297 Bacteria 1717
328 Ga0157378_10626050 3300013297 Bacteria 1090
329 Ga0157378_11690669 3300013297 Unclassified 680
330 Ga0163162_10212138 3300013306 Bacteria 2066
331 Ga0163162_10262986 3300013306 Bacteria 1857
332 Ga0163162_10406756 3300013306 Bacteria 1494
333 Ga0163162_10473164 3300013306 Bacteria 1384
334 Ga0163162_11774940 3300013306 Bacteria 705
335 Ga0163162_11816161 3300013306 Bacteria 697
336 Ga0157372_10178870 3300013307 Bacteria 2455
337 Ga0157372_11446925 3300013307 Bacteria 792
338 Ga0157375_10011533 3300013308 Bacteria 7804
339 Ga0157375_10110835 3300013308 Bacteria 2842
340 Ga0157375_10194954 3300013308 Bacteria 2181
341 Ga0157375_10987879 3300013308 Bacteria 982
342 Ga0157375_11848397 3300013308 Unclassified 716
343 Ga0157375_12377781 3300013308 Unclassified 632
344 Ga0163163_10002062 3300014325 Bacteria 16976
345 Ga0163163_10002406 3300014325 Bacteria 15837
346 Ga0163163_10047816 3300014325 Bacteria 4205
347 Ga0163163_10122003 3300014325 Bacteria 2640
348 Ga0163163_10154793 3300014325 Bacteria 2336
349 Ga0163163_10162815 3300014325 Bacteria 2277
350 Ga0163163_10517454 3300014325 Bacteria 1255
351 Ga0163163_10550019 3300014325 Unclassified 1217
352 Ga0163163_11133198 3300014325 Bacteria 845
353 Ga0163163_11589039 3300014325 Unclassified 715
354 Ga0163163_11992634 3300014325 Unclassified 640
355 Ga0157380_10005239 3300014326 Bacteria 9058
356 Ga0157380_10061632 3300014326 Bacteria 3002
357 Ga0157380_10478823 3300014326 Unclassified 1203
358 Ga0157380_12394012 3300014326 Unclassified 593
359 Ga0157377_10020372 3300014745 Bacteria 3474
360 Ga0157377_10111959 3300014745 Bacteria 1642
361 Ga0157379_10639576 3300014968 Bacteria 995
362 Ga0157379_10737237 3300014968 Bacteria 927
363 Ga0207710_10000680 3300025900 Bacteria 19152
364 Ga0207710_10034439 3300025900 Bacteria 2225
365 Ga0207710_10394568 3300025900 Unclassified 710
366 Ga0207688_10160061 3300025901 Bacteria 1334
367 Ga0207647_10002102 3300025904 Bacteria 15242
368 Ga0207647_10291209 3300025904 Bacteria 931
369 Ga0207645_10065284 3300025907 Bacteria 2326
370 Ga0207643_10016256 3300025908 Bacteria 4059
371 Ga0207643_10067834 3300025908 Bacteria 2048
372 Ga0207643_10503123 3300025908 Unclassified 775
373 Ga0207684_10000053 3300025910 Bacteria 225260
374 Ga0207654_10036539 3300025911 Bacteria 2745
375 Ga0207654_10187197 3300025911 Bacteria 1354
376 Ga0207654_10341328 3300025911 Unclassified 1029
377 Ga0207654_10584783 3300025911 Unclassified 796
378 Ga0207654_11044342 3300025911 Bacteria 595
379 Ga0207707_10029900 3300025912 Bacteria 4764
380 Ga0207707_10035169 3300025912 Bacteria 4380
381 Ga0207695_10090766 3300025913 Bacteria 3070
382 Ga0207695_10393158 3300025913 Bacteria 1271
383 Ga0207671_10795518 3300025914 Unclassified 750
384 Ga0207660_10045848 3300025917 Bacteria 3082
385 Ga0207660_10581705 3300025917 Bacteria 911
386 Ga0207660_11160458 3300025917 Unclassified 629
387 Ga0207662_10118071 3300025918 Bacteria 1660
388 Ga0207649_10300913 3300025920 Viruses 1173
389 Ga0207652_10114977 3300025921 Bacteria 2390
390 Ga0207652_10343002 3300025921 Bacteria 1348
391 Ga0207646_10331830 3300025922 Bacteria 1374
392 Ga0207646_10540996 3300025922 Bacteria 1048
393 Ga0207681_10245165 3300025923 Bacteria 1396
394 Ga0207681_10359243 3300025923 Bacteria 1168
395 Ga0207681_10685078 3300025923 Unclassified 851
396 Ga0207694_10026080 3300025924 Bacteria 4444
397 Ga0207650_10000007 3300025925 Bacteria 530810
398 Ga0207650_10117717 3300025925 Unclassified 2065
399 Ga0207650_10181461 3300025925 Bacteria 1677
400 Ga0207650_10301086 3300025925 Bacteria 1309
401 Ga0207650_10628526 3300025925 Bacteria 904
402 Ga0207650_10945098 3300025925 Unclassified 732
403 Ga0207650_10985026 3300025925 Unclassified 717
404 Ga0207659_10075016 3300025926 Bacteria 2480
405 Ga0207659_10300759 3300025926 Bacteria 1318
406 Ga0207659_10656655 3300025926 Unclassified 896
407 Ga0207644_10012230 3300025931 Bacteria 5697
408 Ga0207644_10399111 3300025931 Bacteria 1124
409 Ga0207690_10054350 3300025932 Bacteria 2692
410 Ga0207690_10348994 3300025932 Bacteria 1170
411 Ga0207690_10497341 3300025932 Bacteria 986
412 Ga0207706_10048501 3300025933 Bacteria 3756
413 Ga0207706_10548177 3300025933 Unclassified 996
414 Ga0207706_10756181 3300025933 Unclassified 828
415 Ga0207709_10002615 3300025935 Bacteria 11209
416 Ga0207709_10360189 3300025935 Bacteria 1101
417 Ga0207709_10362618 3300025935 Bacteria 1097
418 Ga0207670_10005884 3300025936 Bacteria 6766
419 Ga0207670_10198257 3300025936 Bacteria 1523
420 Ga0207691_10409555 3300025940 Bacteria 1156
421 Ga0207691_10671024 3300025940 Unclassified 875
422 Ga0207711_10010840 3300025941 Bacteria 7577
423 Ga0207711_10015701 3300025941 Bacteria 6281
424 Ga0207711_10186984 3300025941 Bacteria 1886
425 Ga0207711_10307691 3300025941 Unclassified 1463
426 Ga0207711_10613655 3300025941 Bacteria 1015
427 Ga0207711_11261010 3300025941 Unclassified 681
428 Ga0207689_10025130 3300025942 Bacteria 4993
429 Ga0207689_10089825 3300025942 Bacteria 2524
430 Ga0207689_10248066 3300025942 Bacteria 1472
431 Ga0207689_10489036 3300025942 Bacteria 1030
432 Ga0207689_11202353 3300025942 Unclassified 638
433 Ga0207679_10026674 3300025945 Bacteria 3987
434 Ga0207679_10215931 3300025945 Bacteria 1611
435 Ga0207651_10068108 3300025960 Bacteria 2508
436 Ga0207651_11337651 3300025960 Unclassified 644
437 Ga0207712_10015596 3300025961 Bacteria 4906
438 Ga0207712_11334867 3300025961 Bacteria 641
439 Ga0207712_11805947 3300025961 Unclassified 548
440 Ga0207640_10048438 3300025981 Bacteria 2747
441 Ga0207640_10246820 3300025981 Bacteria 1383
442 Ga0207640_10255543 3300025981 Bacteria 1362
443 Ga0207640_10374490 3300025981 Bacteria 1152
444 Ga0207640_10714441 3300025981 Bacteria 860
445 Ga0207658_11810418 3300025986 Unclassified 557
446 Ga0207677_10970028 3300026023 Unclassified 769
447 Ga0207703_10166005 3300026035 Bacteria 1937
448 Ga0207703_10182135 3300026035 Bacteria 1854
449 Ga0207703_10423788 3300026035 Unclassified 1239
450 Ga0207703_10476573 3300026035 Bacteria 1169
451 Ga0207703_10478894 3300026035 Bacteria 1166
452 Ga0207703_10555941 3300026035 Bacteria 1082
453 Ga0207703_11441161 3300026035 Bacteria 662
454 Ga0207703_11679387 3300026035 Unclassified 611
455 Ga0207639_10027635 3300026041 Bacteria 4135
456 Ga0207639_10033986 3300026041 Bacteria 3765
457 Ga0207708_10000825 3300026075 Bacteria 23369
458 Ga0207708_10008818 3300026075 Bacteria 7462
459 Ga0207708_10076137 3300026075 Bacteria 2574
460 Ga0207708_10089891 3300026075 Bacteria 2367
461 Ga0207708_10138191 3300026075 Bacteria 1909
462 Ga0207708_10158687 3300026075 Bacteria 1785
463 Ga0207708_10306075 3300026075 Bacteria 1294
464 Ga0207708_10348514 3300026075 Archaea 1214
465 Ga0207708_10894725 3300026075 Bacteria 768
466 Ga0207641_10136324 3300026088 Bacteria 2209
467 Ga0207641_10207443 3300026088 Bacteria 1810
468 Ga0207641_10302714 3300026088 Bacteria 1511
469 Ga0207641_10306045 3300026088 Bacteria 1503
470 Ga0207641_10463384 3300026088 Unclassified 1226
471 Ga0207641_10928753 3300026088 Bacteria 865
472 Ga0207641_12222610 3300026088 Unclassified 549
473 Ga0207648_10050464 3300026089 Bacteria 3638
474 Ga0207648_10058800 3300026089 Bacteria 3352
475 Ga0207648_10108864 3300026089 Bacteria 2432
476 Ga0207648_10404044 3300026089 Bacteria 1238
477 Ga0207676_10104685 3300026095 Bacteria 2354
478 Ga0207676_10117168 3300026095 Bacteria 2240
479 Ga0207676_10127350 3300026095 Bacteria 2159
480 Ga0207676_10155593 3300026095 Bacteria 1974
481 Ga0207676_10277322 3300026095 Bacteria 1520
482 Ga0207676_10312777 3300026095 Bacteria 1439
483 Ga0207676_10381196 3300026095 Bacteria 1313
484 Ga0207676_10710544 3300026095 Unclassified 974
485 Ga0207676_10889341 3300026095 Bacteria 873
486 Ga0207676_11036233 3300026095 Unclassified 809
487 Ga0207676_11215644 3300026095 Unclassified 747
488 Ga0207676_11788102 3300026095 Unclassified 613
489 Ga0207674_10000472 3300026116 Bacteria 52784
490 Ga0207674_10074434 3300026116 Bacteria 3408
491 Ga0207674_10227576 3300026116 Bacteria 1813
492 Ga0207674_10237749 3300026116 Bacteria 1769
493 Ga0207674_10299689 3300026116 Bacteria 1556
494 Ga0207674_10317725 3300026116 Bacteria 1507
495 Ga0207674_10360065 3300026116 Bacteria 1406
496 Ga0207674_10497738 3300026116 Unclassified 1178
497 Ga0207675_100658875 3300026118 Unclassified 1053
498 Ga0207698_10801873 3300026142 Unclassified 944
499 Ga0207698_11264020 3300026142 Bacteria 753
500 Ga0207698_12115593 3300026142 Unclassified 576
501 Ga0207428_10034046 3300027907 Bacteria 4178
502 Ga0207428_10048170 3300027907 Bacteria 3420
503 Ga0207428_10212414 3300027907 Bacteria 1453
504 Ga0268265_10105628 3300028380 Bacteria 2286
505 Ga0268265_10370716 3300028380 Unclassified 1314
506 Ga0268265_10392807 3300028380 Bacteria 1280
507 Ga0268265_10491332 3300028380 Bacteria 1155
508 Ga0268265_10750996 3300028380 Bacteria 947
509 Ga0268265_11926224 3300028380 Unclassified 598
510 Ga0268264_10018399 3300028381 Bacteria 5713
511 Ga0268264_10058772 3300028381 Bacteria 3221
512 Ga0268264_10442962 3300028381 Unclassified 1257
513 Ga0268264_10988762 3300028381 Unclassified 847
514 Ga0307408_100096076 3300031548 Bacteria 2247
515 Ga0307408_100261120 3300031548 Unclassified 1433
516 Ga0307405_10670303 3300031731 Unclassified 855
517 Ga0307405_10683995 3300031731 Unclassified 848
518 Ga0307413_10015324 3300031824 Bacteria 3925
519 Ga0307413_10686559 3300031824 Unclassified 849
520 Ga0307410_10029326 3300031852 Bacteria 3503
521 Ga0307410_10257157 3300031852 Bacteria 1360
522 Ga0307410_10275017 3300031852 Unclassified 1319
523 Ga0307410_10662840 3300031852 Bacteria 876
524 Ga0307406_10005204 3300031901 Bacteria 7106
525 Ga0307407_10031790 3300031903 Bacteria 2863
526 Ga0307412_10013755 3300031911 Bacteria 4754
527 Ga0307412_10251150 3300031911 Unclassified 1373
528 Ga0307409_100039288 3300031995 Bacteria 3510
529 Ga0307409_100717400 3300031995 Unclassified 1001
530 Ga0307416_100016594 3300032002 Bacteria 5125
531 Ga0307416_100736280 3300032002 Bacteria 1078
532 Ga0307416_100787028 3300032002 Bacteria 1046
533 Ga0307414_10002466 3300032004 Bacteria 9697
534 Ga0307414_10064215 3300032004 Bacteria 2613
535 Ga0307414_10180052 3300032004 Bacteria 1699
536 Ga0307411_10082716 3300032005 Bacteria 2215
537 Ga0307411_10104182 3300032005 Bacteria 2014
538 Ga0307415_100010997 3300032126 Bacteria 5154
539 Ga0307415_100539194 3300032126 Unclassified 1028
540 Ga0373951_0007247 3300035091 Bacteria 2522
541 Ga0373951_0018680 3300035091 Bacteria 1576
542 Ga0373951_0083852 3300035091 Bacteria 828
543 Ga0373952_0059674 3300035092 Unclassified 930
544 Ga0373939_0247601 3300035114 Bacteria 692
545 Ga0373960_0118642 3300035121 Bacteria 876
546 Ga0373961_0069711 3300035241 Unclassified 1085
547 Ga0373961_0083987 3300035241 Bacteria 1006
548 Ga0395899_0570310 3300037312 Bacteria 725
549 Ga0395900_0333570 3300037418 Unclassified 1494
550 Ga0395900_0558500 3300037418 Bacteria 1089
551 Ga0395901_0270845 3300038443 Bacteria 1766
552 Ga0242422_01994 3300038699 Bacteria 1397
553 Ga0242420_009227 3300038996 Unclassified 1616
554 Ga0439445_0041266 3300042004 Bacteria 1227
555 Ga0439434_0236204 3300042435 Unclassified 623
556 Ga0439444_0126636 3300042437 Unclassified 601
557 Ga0451576_0067007 3300045051 Bacteria 3737
558 Ga0496104_0089848 3300048907 Bacteria 2935
559 Ga0496106_0050872 3300048909 Bacteria 3123
560 Ga0496106_0250045 3300048909 Bacteria 1417
561 Ga0496107_0018870 3300048910 Bacteria 4862
562 Ga0496108_0998727 3300048911 Bacteria 715
563 Ga0496108_1344089 3300048911 Unclassified 600
564 Ga0496109_0193767 3300048912 Bacteria 1910
565 Ga0496110_0145098 3300048913 Bacteria 2147
566 Ga0496110_0553997 3300048913 Unclassified 1045
567 Ga0496112_0405963 3300048915 Bacteria 1302
568 Ga0496112_0547228 3300048915 Bacteria 1091
569 Ga0496112_1185227 3300048915 Unclassified 681
570 Ga0496112_1461667 3300048915 Unclassified 598
571 Ga0496112_1726737 3300048915 Unclassified 538
572 Ga0501290_024262 3300049513 Unclassified 844
573 Ga0501291_074875 3300049514 Unclassified 663
574 Ga0501292_019712 3300049515 Unclassified 1081
575 Ga0501293_005160 3300049516 Unclassified 1043
576 Ga0501295_005841 3300049518 Bacteria 1698
577 Ga0501296_005950 3300049519 Unclassified 1372
578 Ga0501298_000965 3300049521 Bacteria 4079
579 Ga0501298_002754 3300049521 Bacteria 2685
580 Ga0501299_008009 3300049522 Bacteria 1707
581 Ga0501299_031286 3300049522 Unclassified 1028
582 Ga0501041_0172158 3300049577 Bacteria 1355
583 Ga0501201_052303 3300049651 Unclassified 513
584 Ga0501202_009604 3300049652 Bacteria 1782
585 Ga0501202_022587 3300049652 Unclassified 1264
586 Ga0501202_034414 3300049652 Unclassified 1070
587 Ga0501206_029578 3300049653 Unclassified 810
588 Ga0501207_003344 3300049654 Bacteria 2131
589 Ga0501209_044642 3300049656 Unclassified 1186
590 Ga0501216_013259 3300049660 Bacteria 1364
591 Ga0501217_001734 3300049661 Bacteria 4162
592 Ga0501217_001958 3300049661 Bacteria 3961
593 Ga0501217_012218 3300049661 Bacteria 1909
594 Ga0501223_002051 3300049663 Bacteria 4522
595 Ga0501223_021697 3300049663 Bacteria 1256
596 Ga0501224_005015 3300049664 Bacteria 1887
597 Ga0501224_021455 3300049664 Unclassified 963
598 Ga0501227_006411 3300049665 Bacteria 2529
599 Ga0501227_006474 3300049665 Bacteria 2517
600 Ga0501227_129975 3300049665 Unclassified 685
601 Ga0501233_005760 3300049668 Bacteria 2305
602 Ga0501233_009690 3300049668 Bacteria 1883
603 Ga0501233_071533 3300049668 Unclassified 879
604 Ga0501235_000552 3300049669 Bacteria 7491
605 Ga0501235_030391 3300049669 Unclassified 1217
606 Ga0501236_017659 3300049670 Unclassified 1022
607 Ga0501238_035193 3300049671 Unclassified 729
608 Ga0501239_001808 3300049672 Bacteria 1883
609 Ga0501243_009054 3300049675 Bacteria 1544
610 Ga0501243_026902 3300049675 Unclassified 969
611 Ga0501246_041771 3300049676 Unclassified 550
612 Ga0501249_021330 3300049679 Unclassified 1413
613 Ga0501249_025999 3300049679 Bacteria 1292
614 Ga0501249_049158 3300049679 Bacteria 966
615 Ga0501249_065074 3300049679 Unclassified 847
616 Ga0501253_185066 3300049683 Unclassified 543
617 Ga0501257_004433 3300049686 Bacteria 3068
618 Ga0501257_007509 3300049686 Bacteria 2437
619 Ga0501258_015521 3300049687 Unclassified 854
620 Ga0501261_068049 3300049690 Unclassified 619
621 Ga0501221_020041 3300049704 Unclassified 1304
622 Ga0501221_037397 3300049704 Unclassified 1045
623 Ga0501225_0007568 3300049705 Bacteria 3146
624 Ga0501225_0044204 3300049705 Unclassified 1231
625 Ga0501225_0204393 3300049705 Unclassified 628
626 Ga0501229_003857 3300049706 Bacteria 1812
627 Ga0501234_024230 3300049707 Bacteria 972
628 Ga0501245_012053 3300049708 Unclassified 1264
629 Ga0501079_0224922 3300049741 Bacteria 1466
630 Ga0501080_0206863 3300049742 Bacteria 1800
631 Ga0501232_018789 3300049757 Unclassified 872
632 Ga0501262_056946 3300049759 Unclassified 616
633 Ga0501266_007792 3300049763 Bacteria 1345
634 Ga0501268_010285 3300049765 Bacteria 1454
635 Ga0501268_042449 3300049765 Unclassified 859
636 Ga0501270_021142 3300049767 Bacteria 992
637 Ga0501270_039260 3300049767 Unclassified 818
638 Ga0501271_015221 3300049768 Unclassified 857
639 Ga0501272_003071 3300049769 Bacteria 1679
640 Ga0501272_052824 3300049769 Unclassified 567
641 Ga0501273_027045 3300049770 Unclassified 802
642 Ga0501275_004048 3300049772 Bacteria 1361
643 Ga0501278_007868 3300049774 Unclassified 816
644 Ga0501279_061546 3300049775 Unclassified 615
645 Ga0501283_002463 3300049779 Bacteria 2405
646 Ga0501200_02781 3300049849 Unclassified 734
647 Ga0501212_007062 3300049851 Bacteria 1530
648 Ga0501212_060964 3300049851 Unclassified 653
649 Ga0501226_002624 3300049853 Bacteria 2182
650 Ga0501226_010102 3300049853 Unclassified 1048
651 Ga0501226_013744 3300049853 Unclassified 893
652 nmdc:mga05p37_248238_c1 3300050507 Bacteria 2136
653 nmdc:mga05p37_293523_c1 3300050507 Unclassified 754
654 nmdc:mga05p37_645858_c1 3300050507 Unclassified 1186
655 nmdc:mga05p37_80065_c1 3300050507 Bacteria 4023
656 nmdc:mga09592_1379711_c1 3300050508 Unclassified 577
657 nmdc:mga09592_426040_c1 3300050508 Unclassified 1146
658 nmdc:mga0qj67_319625_c1 3300050509 Bacteria 1257
659 nmdc:mga06r32_266379_c1 3300050510 Bacteria 1701
660 nmdc:mga06r32_50876_c2 3300050510 Bacteria 3489
661 nmdc:mga06r32_84583_c1 3300050510 Bacteria 3092
662 nmdc:mga08y16_346333_c1 3300050511 Bacteria 1527
663 nmdc:mga08y16_423779_c1 3300050511 Bacteria 1360
664 nmdc:mga08y16_6272_c1 3300050511 Bacteria 12465
665 nmdc:mga08y16_89290_c1 3300050511 Bacteria 3212
666 nmdc:mga08y16_9708_c1 3300050511 Bacteria 10105
667 nmdc:mga0n895_12134_c1 3300050512 Bacteria 7712
668 nmdc:mga0n895_1465106_c1 3300050512 Bacteria 650
669 nmdc:mga0n895_176413_c1 3300050512 Bacteria 2168
670 nmdc:mga08x19_24879_c1 3300050514 Bacteria 3726
671 nmdc:mga0a205_11485_c1 3300050515 Bacteria 8156
672 nmdc:mga0a205_123703_c1 3300050515 Bacteria 2486
673 nmdc:mga0a205_20138_c1 3300050515 Bacteria 6294
674 nmdc:mga0a205_32218_c1 3300050515 Bacteria 5025
675 nmdc:mga0a205_7270_c1 3300050515 Bacteria 7933
676 Ga0501084_0091708 3300054114 Bacteria 2551
677 Ga0587083_0035502 3300059505 Unclassified 1017
678 Ga0587128_007738 3300059630 Bacteria 1368
679 Ga0207683_10478970
680 SwRhRL2b_contig_1788179
681 CNAas_1000555
682 JGI24751J29686_10000104
683 JGI25406J46586_10000683
684 rootH2_10085677
685 rootL2_10122771
686 Ga0065714_10168816
687 Ga0065704_10006025
688 Ga0065704_10384945
689 Ga0065712_10001505
690 Ga0065712_10003789
691 Ga0065712_10016812
692 Ga0065712_10067727
693 Ga0065712_10145848
694 Ga0065712_10150664
695 Ga0065715_10013317
696 Ga0065715_10073066
697 Ga0065715_10088941
698 Ga0065715_10191139
699 Ga0065715_10210241
700 Ga0065715_10226594
701 Ga0065715_10262753
702 Ga0065715_10793953
703 Ga0065707_10002690
704 Ga0065707_10015464
705 Ga0065707_10129673
706 Ga0065707_10559008
707 Ga0070676_10064199
708 Ga0070670_100069688
709 Ga0070670_100086259
710 Ga0070670_100216658
711 Ga0070670_100313178
712 Ga0070670_101117874
713 Ga0070670_101702533
714 Ga0070677_10797277
715 Ga0068869_100254331
716 Ga0070680_100061867
717 Ga0070680_100204505
718 Ga0070682_100400579
719 Ga0068868_100525816
720 Ga0068868_100536690
721 Ga0068868_101251249
722 Ga0070660_100420912
723 Ga0070689_100000508
724 Ga0070691_10153982
725 Ga0070687_100158762
726 Ga0070692_10021428
727 Ga0070692_10054702
728 Ga0070692_10448503
729 Ga0070692_11010678
730 Ga0070669_100314954
731 Ga0070669_100711791
732 Ga0070669_101343606
733 Ga0070675_100531617
734 Ga0070671_100006772
735 Ga0070673_100087769
736 Ga0070673_100275143
737 Ga0070673_101181664
738 Ga0070673_101811848
739 Ga0070688_100300034
740 Ga0070659_100011984
741 Ga0070659_100292121
742 Ga0070659_100431241
743 Ga0070667_101228906
744 Ga0070701_10141682
745 Ga0070701_10620193
746 Ga0070705_100018555
747 Ga0070705_100323743
748 Ga0070700_100051084
749 Ga0070700_100065981
750 Ga0070700_100080878
751 Ga0070700_100151244
752 Ga0070700_100304469
753 Ga0070700_100623752
754 Ga0070700_100683421
755 Ga0070694_100097389
756 Ga0070694_100114342
757 Ga0070694_100141572
758 Ga0070708_100312124
759 Ga0070662_100125827
760 Ga0070662_100753067
761 Ga0070681_10000735
762 Ga0068867_100150749
763 Ga0068867_100421922
764 Ga0068867_100783862
765 Ga0070685_10025533
766 Ga0070706_100000053
767 Ga0070707_100025697
768 Ga0070707_100348655
769 Ga0070698_100033893
770 Ga0070699_100078021
771 Ga0070699_100189534
772 Ga0070699_100308257
773 Ga0070699_100664779
774 Ga0070699_100831422
775 Ga0070679_100020112
776 Ga0070679_100143502
777 Ga0070679_101031389
778 Ga0070684_100101712
779 Ga0070697_100240387
780 Ga0068853_100021378
781 Ga0068853_100043276
782 Ga0068853_100661664
783 Ga0068853_101527038
784 Ga0070672_100317308
785 Ga0070672_100719026
786 Ga0070672_101594184
787 Ga0070695_100089103
788 Ga0070695_100333887
789 Ga0070695_100391903
790 Ga0070695_101496656
791 Ga0070696_100048255
792 Ga0070696_100091447
793 Ga0070696_101171776
794 Ga0070693_100013678
795 Ga0070693_100192930
796 Ga0070693_100213406
797 Ga0070665_102273485
798 Ga0070704_100017295
799 Ga0070704_100134946
800 Ga0070704_100184867
801 Ga0070704_100185430
802 Ga0070704_100838604
803 Ga0068855_100537095
804 Ga0070664_100002661
805 Ga0070664_100192471
806 Ga0068857_100000175
807 Ga0068857_100118964
808 Ga0068857_100279417
809 Ga0068857_100569859
810 Ga0068857_100858876
811 Ga0068857_101289288
812 Ga0068854_100214254
813 Ga0068854_100262517
814 Ga0068854_100362932
815 Ga0068854_100838883
816 Ga0068854_101167537
817 Ga0070702_100002800
818 Ga0070702_100050672
819 Ga0070702_100437261
820 Ga0070702_100605889
821 Ga0070702_101702730
822 Ga0068852_100596153
823 Ga0068852_100758077
824 Ga0068859_100001548
825 Ga0068859_100023087
826 Ga0068859_100030268
827 Ga0068859_100084273
828 Ga0068859_100106962
829 Ga0068859_100117341
830 Ga0068859_100163113
831 Ga0068859_100269789
832 Ga0068859_100313429
833 Ga0068859_100351126
834 Ga0068859_100362574
835 Ga0068859_100902841
836 Ga0068859_101136383
837 Ga0068859_101297167
838 Ga0068859_101322018
839 Ga0068859_101586611
840 Ga0068859_101783234
841 Ga0068864_100049316
842 Ga0068864_100062358
843 Ga0068864_100140695
844 Ga0068864_100227531
845 Ga0068864_100407906
846 Ga0068864_100555171
847 Ga0068864_100779253
848 Ga0068864_101123547
849 Ga0068866_10176351
850 Ga0068861_100013676
851 Ga0068861_101448732
852 Ga0068870_10090525
853 Ga0068870_10160648
854 Ga0068870_10323374
855 Ga0068870_11317657
856 Ga0068863_100066806
857 Ga0068863_100168020
858 Ga0068863_100337963
859 Ga0068863_100340707
860 Ga0068863_101005643
861 Ga0068858_100142115
862 Ga0068858_100146918
863 Ga0068858_100163188
864 Ga0068858_100192061
865 Ga0068858_101903709
866 Ga0068858_101914200
867 Ga0068860_100126222
868 Ga0068860_100272768
869 Ga0068860_100308852
870 Ga0068860_100329762
871 Ga0068860_100344385
872 Ga0068860_100696438
873 Ga0068860_100918978
874 Ga0068862_100058640
875 Ga0068862_100182160
876 Ga0068862_100279783
877 Ga0068862_100683835
878 Ga0068862_100754283
879 Ga0068862_100801586
880 Ga0068862_100815699
881 Ga0068862_101687846
882 Ga0081539_10001384
883 Ga0081539_10159728
884 Ga0075432_10134687
885 Ga0097621_100019380
886 Ga0097621_100451254
887 Ga0068871_100003999
888 Ga0068871_100654267
889 Ga0068871_100707923
890 Ga0075428_100277170
891 Ga0075428_100756478
892 Ga0075430_100091915
893 Ga0075431_100243936
894 Ga0075433_10008787
895 Ga0075433_10204424
896 Ga0075433_10258566
897 Ga0075433_10808511
898 Ga0075433_11448081
899 Ga0075434_100032356
900 Ga0075434_100092484
901 Ga0075434_100735457
902 Ga0075429_100144984
903 Ga0075429_100705639
904 Ga0075436_100071020
905 Ga0097620_100001548
906 Ga0097620_100021445
907 Ga0097620_100023088
908 Ga0097620_100030269
909 Ga0097620_100084274
910 Ga0097620_100106963
911 Ga0097620_100117337
912 Ga0097620_100163114
913 Ga0097620_100269773
914 Ga0097620_100313461
915 Ga0097620_100351124
916 Ga0097620_100362573
917 Ga0097620_100903008
918 Ga0097620_101136338
919 Ga0097620_101297024
920 Ga0097620_101322035
921 Ga0097620_101586713
922 Ga0097620_101783331
923 Ga0105251_10129328
924 Ga0105251_10205772
925 Ga0105251_10219507
926 Ga0105240_10141147
927 Ga0111539_10007143
928 Ga0111539_10013751
929 Ga0111539_10079568
930 Ga0111539_10315237
931 Ga0111539_10583587
932 Ga0105245_10565821
933 Ga0105245_11790982
934 Ga0105245_11941335
935 Ga0105247_10002148
936 Ga0105247_10017707
937 Ga0105247_10087186
938 Ga0105247_10277732
939 Ga0105247_10569828
940 Ga0114129_10052873
941 Ga0114129_10057582
942 Ga0114129_10325206
943 Ga0114129_10548906
944 Ga0114129_10748729
945 Ga0114129_11786830
946 Ga0105243_10113544
947 Ga0105243_10360745
948 Ga0105243_12470604
949 Ga0105241_10063179
950 Ga0105241_10101479
951 Ga0105241_10108057
952 Ga0105241_10174538
953 Ga0105241_10224997
954 Ga0105241_10351474
955 Ga0105241_10574581
956 Ga0105241_10661098
957 Ga0105241_12291440
958 Ga0105242_10107104
959 Ga0105242_10662547
960 Ga0105242_10727277
961 Ga0105242_11009399
962 Ga0105242_12055958
963 Ga0105248_10047580
964 Ga0105248_10082286
965 Ga0105248_10087769
966 Ga0105248_10205825
967 Ga0105248_10332141
968 Ga0105248_10452440
969 Ga0105248_10657168
970 Ga0105248_10670461
971 Ga0105248_11275018
972 Ga0105248_11808357
973 Ga0105248_12113356
974 Ga0105237_10247264
975 Ga0105237_10249087
976 Ga0105237_11068028
977 Ga0105238_10025668
978 Ga0105249_10004851
979 Ga0105249_10055361
980 Ga0105249_10462013
981 Ga0105249_10943051
982 Ga0105249_11516992
983 Ga0105249_12076619
984 Ga0105239_10496410
985 Ga0105239_10590604
986 Ga0105239_10676469
987 Ga0105239_11322916
988 Ga0105246_10220334
989 Ga0105246_10227861
990 Ga0105246_10255511
991 Ga0105246_10331092
992 Ga0105246_10577479
993 Ga0105246_10905626
994 Ga0105246_11060366
995 Ga0105246_11209668
996 Ga0105246_11821266
997 Ga0157373_10084969
998 Ga0157373_10279294
999 Ga0157373_10389314
1000 Ga0157373_11239003
1001 Ga0157371_10093368
1002 Ga0157374_11335950
1003 Ga0157374_12192758
1004 Ga0157378_10015701
1005 Ga0157378_10243988
1006 Ga0157378_10626050
1007 Ga0157378_11690669
1008 Ga0163162_10212138
1009 Ga0163162_10262986
1010 Ga0163162_10406756
1011 Ga0163162_10473164
1012 Ga0163162_11774940
1013 Ga0163162_11816161
1014 Ga0157372_10178870
1015 Ga0157372_11446925
1016 Ga0157375_10011533
1017 Ga0157375_10110835
1018 Ga0157375_10194954
1019 Ga0157375_10987879
1020 Ga0157375_11848397
1021 Ga0157375_12377781
1022 Ga0163163_10002062
1023 Ga0163163_10002406
1024 Ga0163163_10047816
1025 Ga0163163_10122003
1026 Ga0163163_10154793
1027 Ga0163163_10162815
1028 Ga0163163_10517454
1029 Ga0163163_10550019
1030 Ga0163163_11133198
1031 Ga0163163_11589039
1032 Ga0163163_11992634
1033 Ga0157380_10005239
1034 Ga0157380_10061632
1035 Ga0157380_10478823
1036 Ga0157380_12394012
1037 Ga0157377_10020372
1038 Ga0157377_10111959
1039 Ga0157379_10639576
1040 Ga0157379_10737237
1041 Ga0207710_10000680
1042 Ga0207710_10034439
1043 Ga0207710_10394568
1044 Ga0207688_10160061
1045 Ga0207647_10002102
1046 Ga0207647_10291209
1047 Ga0207645_10065284
1048 Ga0207643_10016256
1049 Ga0207643_10067834
1050 Ga0207643_10503123
1051 Ga0207684_10000053
1052 Ga0207654_10036539
1053 Ga0207654_10187197
1054 Ga0207654_10341328
1055 Ga0207654_10584783
1056 Ga0207654_11044342
1057 Ga0207707_10029900
1058 Ga0207707_10035169
1059 Ga0207695_10090766
1060 Ga0207695_10393158
1061 Ga0207671_10795518
1062 Ga0207660_10045848
1063 Ga0207660_10581705
1064 Ga0207660_11160458
1065 Ga0207662_10118071
1066 Ga0207649_10300913
1067 Ga0207652_10114977
1068 Ga0207652_10343002
1069 Ga0207646_10331830
1070 Ga0207646_10540996
1071 Ga0207681_10245165
1072 Ga0207681_10359243
1073 Ga0207681_10685078
1074 Ga0207694_10026080
1075 Ga0207650_10000007
1076 Ga0207650_10117717
1077 Ga0207650_10181461
1078 Ga0207650_10301086
1079 Ga0207650_10628526
1080 Ga0207650_10945098
1081 Ga0207650_10985026
1082 Ga0207659_10075016
1083 Ga0207659_10300759
1084 Ga0207659_10656655
1085 Ga0207644_10012230
1086 Ga0207644_10399111
1087 Ga0207690_10054350
1088 Ga0207690_10348994
1089 Ga0207690_10497341
1090 Ga0207706_10048501
1091 Ga0207706_10548177
1092 Ga0207706_10756181
1093 Ga0207709_10002615
1094 Ga0207709_10360189
1095 Ga0207709_10362618
1096 Ga0207670_10005884
1097 Ga0207670_10198257
1098 Ga0207691_10409555
1099 Ga0207691_10671024
1100 Ga0207711_10010840
1101 Ga0207711_10015701
1102 Ga0207711_10186984
1103 Ga0207711_10307691
1104 Ga0207711_10613655
1105 Ga0207711_11261010
1106 Ga0207689_10025130
1107 Ga0207689_10089825
1108 Ga0207689_10248066
1109 Ga0207689_10489036
1110 Ga0207689_11202353
1111 Ga0207679_10026674
1112 Ga0207679_10215931
1113 Ga0207651_10068108
1114 Ga0207651_11337651
1115 Ga0207712_10015596
1116 Ga0207712_11334867
1117 Ga0207712_11805947
1118 Ga0207640_10048438
1119 Ga0207640_10246820
1120 Ga0207640_10255543
1121 Ga0207640_10374490
1122 Ga0207640_10714441
1123 Ga0207658_11810418
1124 Ga0207677_10970028
1125 Ga0207703_10166005
1126 Ga0207703_10182135
1127 Ga0207703_10423788
1128 Ga0207703_10476573
1129 Ga0207703_10478894
1130 Ga0207703_10555941
1131 Ga0207703_11441161
1132 Ga0207703_11679387
1133 Ga0207639_10027635
1134 Ga0207639_10033986
1135 Ga0207708_10000825
1136 Ga0207708_10008818
1137 Ga0207708_10076137
1138 Ga0207708_10089891
1139 Ga0207708_10138191
1140 Ga0207708_10158687
1141 Ga0207708_10306075
1142 Ga0207708_10348514
1143 Ga0207708_10894725
1144 Ga0207641_10136324
1145 Ga0207641_10207443
1146 Ga0207641_10302714
1147 Ga0207641_10306045
1148 Ga0207641_10463384
1149 Ga0207641_10928753
1150 Ga0207641_12222610
1151 Ga0207648_10050464
1152 Ga0207648_10058800
1153 Ga0207648_10108864
1154 Ga0207648_10404044
1155 Ga0207676_10104685
1156 Ga0207676_10117168
1157 Ga0207676_10127350
1158 Ga0207676_10155593
1159 Ga0207676_10277322
1160 Ga0207676_10312777
1161 Ga0207676_10381196
1162 Ga0207676_10710544
1163 Ga0207676_10889341
1164 Ga0207676_11036233
1165 Ga0207676_11215644
1166 Ga0207676_11788102
1167 Ga0207674_10000472
1168 Ga0207674_10074434
1169 Ga0207674_10227576
1170 Ga0207674_10237749
1171 Ga0207674_10299689
1172 Ga0207674_10317725
1173 Ga0207674_10360065
1174 Ga0207674_10497738
1175 Ga0207675_100658875
1176 Ga0207698_10801873
1177 Ga0207698_11264020
1178 Ga0207698_12115593
1179 Ga0207428_10034046
1180 Ga0207428_10048170
1181 Ga0207428_10212414
1182 Ga0268265_10105628
1183 Ga0268265_10370716
1184 Ga0268265_10392807
1185 Ga0268265_10491332
1186 Ga0268265_10750996
1187 Ga0268265_11926224
1188 Ga0268264_10018399
1189 Ga0268264_10058772
1190 Ga0268264_10442962
1191 Ga0268264_10988762
1192 Ga0307408_100096076
1193 Ga0307408_100261120
1194 Ga0307405_10670303
1195 Ga0307405_10683995
1196 Ga0307413_10015324
1197 Ga0307413_10686559
1198 Ga0307410_10029326
1199 Ga0307410_10257157
1200 Ga0307410_10275017
1201 Ga0307410_10662840
1202 Ga0307406_10005204
1203 Ga0307407_10031790
1204 Ga0307412_10013755
1205 Ga0307412_10251150
1206 Ga0307409_100039288
1207 Ga0307409_100717400
1208 Ga0307416_100016594
1209 Ga0307416_100736280
1210 Ga0307416_100787028
1211 Ga0307414_10002466
1212 Ga0307414_10064215
1213 Ga0307414_10180052
1214 Ga0307411_10082716
1215 Ga0307411_10104182
1216 Ga0307415_100010997
1217 Ga0307415_100539194
1218 Ga0373951_0007247
1219 Ga0373951_0018680
1220 Ga0373951_0083852
1221 Ga0373952_0059674
1222 Ga0373939_0247601
1223 Ga0373960_0118642
1224 Ga0373961_0069711
1225 Ga0373961_0083987
1226 Ga0395899_0570310
1227 Ga0395900_0333570
1228 Ga0395900_0558500
1229 Ga0395901_0270845
1230 Ga0242422_01994
1231 Ga0242420_009227
1232 Ga0439445_0041266
1233 Ga0439434_0236204
1234 Ga0439444_0126636
1235 Ga0451576_0067007
1236 Ga0496104_0089848
1237 Ga0496106_0050872
1238 Ga0496106_0250045
1239 Ga0496107_0018870
1240 Ga0496108_0998727
1241 Ga0496108_1344089
1242 Ga0496109_0193767
1243 Ga0496110_0145098
1244 Ga0496110_0553997
1245 Ga0496112_0405963
1246 Ga0496112_0547228
1247 Ga0496112_1185227
1248 Ga0496112_1461667
1249 Ga0496112_1726737
1250 Ga0501290_024262
1251 Ga0501291_074875
1252 Ga0501292_019712
1253 Ga0501293_005160
1254 Ga0501295_005841
1255 Ga0501296_005950
1256 Ga0501298_000965
1257 Ga0501298_002754
1258 Ga0501299_008009
1259 Ga0501299_031286
1260 Ga0501041_0172158
1261 Ga0501201_052303
1262 Ga0501202_009604
1263 Ga0501202_022587
1264 Ga0501202_034414
1265 Ga0501206_029578
1266 Ga0501207_003344
1267 Ga0501209_044642
1268 Ga0501216_013259
1269 Ga0501217_001734
1270 Ga0501217_001958
1271 Ga0501217_012218
1272 Ga0501223_002051
1273 Ga0501223_021697
1274 Ga0501224_005015
1275 Ga0501224_021455
1276 Ga0501227_006411
1277 Ga0501227_006474
1278 Ga0501227_129975
1279 Ga0501233_005760
1280 Ga0501233_009690
1281 Ga0501233_071533
1282 Ga0501235_000552
1283 Ga0501235_030391
1284 Ga0501236_017659
1285 Ga0501238_035193
1286 Ga0501239_001808
1287 Ga0501243_009054
1288 Ga0501243_026902
1289 Ga0501246_041771
1290 Ga0501249_021330
1291 Ga0501249_025999
1292 Ga0501249_049158
1293 Ga0501249_065074
1294 Ga0501253_185066
1295 Ga0501257_004433
1296 Ga0501257_007509
1297 Ga0501258_015521
1298 Ga0501261_068049
1299 Ga0501221_020041
1300 Ga0501221_037397
1301 Ga0501225_0007568
1302 Ga0501225_0044204
1303 Ga0501225_0204393
1304 Ga0501229_003857
1305 Ga0501234_024230
1306 Ga0501245_012053
1307 Ga0501079_0224922
1308 Ga0501080_0206863
1309 Ga0501232_018789
1310 Ga0501262_056946
1311 Ga0501266_007792
1312 Ga0501268_010285
1313 Ga0501268_042449
1314 Ga0501270_021142
1315 Ga0501270_039260
1316 Ga0501271_015221
1317 Ga0501272_003071
1318 Ga0501272_052824
1319 Ga0501273_027045
1320 Ga0501275_004048
1321 Ga0501278_007868
1322 Ga0501279_061546
1323 Ga0501283_002463
1324 Ga0501200_02781
1325 Ga0501212_007062
1326 Ga0501212_060964
1327 Ga0501226_002624
1328 Ga0501226_010102
1329 Ga0501226_013744
1330 nmdc:mga05p37_248238_c1
1331 nmdc:mga05p37_293523_c1
1332 nmdc:mga05p37_645858_c1
1333 nmdc:mga05p37_80065_c1
1334 nmdc:mga09592_1379711_c1
1335 nmdc:mga09592_426040_c1
1336 nmdc:mga0qj67_319625_c1
1337 nmdc:mga06r32_266379_c1
1338 nmdc:mga06r32_50876_c2
1339 nmdc:mga06r32_84583_c1
1340 nmdc:mga08y16_346333_c1
1341 nmdc:mga08y16_423779_c1
1342 nmdc:mga08y16_6272_c1
1343 nmdc:mga08y16_89290_c1
1344 nmdc:mga08y16_9708_c1
1345 nmdc:mga0n895_12134_c1
1346 nmdc:mga0n895_1465106_c1
1347 nmdc:mga0n895_176413_c1
1348 nmdc:mga08x19_24879_c1
1349 nmdc:mga0a205_11485_c1
1350 nmdc:mga0a205_123703_c1
1351 nmdc:mga0a205_20138_c1
1352 nmdc:mga0a205_32218_c1
1353 nmdc:mga0a205_7270_c1
1354 Ga0501084_0091708
1355 Ga0587083_0035502
1356 Ga0587128_007738

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

52

128

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

47

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2byu-assembly1.cif.gz_B negative stain em reconstruction of m.tuberculosis acr1(hsp 16.3) fitted with wheat shsp dimer 0.9177 47 134
1gme-assembly1.cif.gz_B crystal structure and assembly of an eukaryotic small heat shock protein 0.9177 47 134
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.9163 48 134
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.9098 47 134
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.899 42 133
ID Description Score Start End Superfamily
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9098 47 134 2.60.40.790
af_Q8IB02_36_170_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9061 41 135 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.901 42 135 2.60.40.790
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8919 45 136 2.60.40.790
af_Q55GH8_4_121_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8903 47 133 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A7S0BLE1-F1-model_v4 SHSP domain-containing protein 0.9212 47 136 GO:0009408
AF-A0A7I7MJ87-F1-model_v4 SHSP domain-containing protein 0.9163 45 135
AF-Q8MZU6-F1-model_v4 Small heat shock protein 0.9099 45 145
AF-A0A0J6VPK7-F1-model_v4 Alpha-crystallin 0.9076 45 134
AF-A0A7I9ZTR3-F1-model_v4 Alpha-crystallin 0.906 46 134

Map